Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13728g8.260ON29662966156130.0
Kwal_YGOB_56.238088.260ON2941298887910.0
Kwal_56.23810singletonOFF2763278581210.0
SAKL0H17072g8.260ON2997302165290.0
YLR087C (CSF1)8.260ON2958302150190.0
Smik_12.1468.260ON2958303850020.0
Suva_10.1718.260ON2958305349700.0
Skud_12.1558.260ON2959302149590.0
NDAI0B019808.260ON2959302249370.0
CAGL0L12210g8.260ON2981305248100.0
KAFR0B027208.260ON2982306147890.0
ZYRO0C01694g8.260ON3006309145570.0
TDEL0F038708.260ON2942304045110.0
Kpol_392.78.260ON2995307244460.0
TPHA0J007308.260ON3046295238220.0
TBLA0E044208.260ON3148261136970.0
KNAG0G020308.260ON2998156828520.0
NCAS0B050108.260ON2952174028210.0
Ecym_43108.260ON2943153824860.0
KLLA0F19096g8.260ON2923156722330.0
AGR088W8.260ON2887152321610.0
Kwal_56.23808singletonOFF62622589e-26
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13728g
         (2966 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  6018   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  3390   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  3132   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2519   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  1937   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  1931   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  1919   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  1914   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  1906   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  1857   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  1849   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  1759   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  1742   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  1717   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  1476   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  1428   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  1103   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  1091   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   962   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   864   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   837   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...   103   9e-26

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 6018 bits (15613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2918/2966 (98%), Positives = 2918/2966 (98%)

Query: 1    MASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKV 60
            MASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKV
Sbjct: 1    MASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKV 60

Query: 61   KISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDK 120
            KISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDK
Sbjct: 61   KISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDK 120

Query: 121  SVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTDECSVD 180
            SVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTDECSVD
Sbjct: 121  SVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTDECSVD 180

Query: 181  EDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIGNKTS 240
            EDSAGQRSHLE            LNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIGNKTS
Sbjct: 181  EDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIGNKTS 240

Query: 241  SSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVKR 300
            SSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVKR
Sbjct: 241  SSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVKR 300

Query: 301  SKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRFQF 360
            SKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRFQF
Sbjct: 301  SKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRFQF 360

Query: 361  DLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPPDYSIDI 420
            DLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPPDYSIDI
Sbjct: 361  DLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPPDYSIDI 420

Query: 421  QISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIVGESV 480
            QISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIVGESV
Sbjct: 421  QISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIVGESV 480

Query: 481  WRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDL 540
            WRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDL
Sbjct: 481  WRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDL 540

Query: 541  HFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHITL 600
            HFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHITL
Sbjct: 541  HFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHITL 600

Query: 601  LGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXXXCYLSFH 660
            LGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYL                 CYLSFH
Sbjct: 601  LGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNNPVNFNENCYLSFH 660

Query: 661  GDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSL 720
            GDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSL
Sbjct: 661  GDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSL 720

Query: 721  SGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEYM 780
            SGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEYM
Sbjct: 721  SGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEYM 780

Query: 781  EELRGTNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWF 840
            EELRGTNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWF
Sbjct: 781  EELRGTNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWF 840

Query: 841  TFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCE 900
            TFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCE
Sbjct: 841  TFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCE 900

Query: 901  EVFEQKGRALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTL 960
            EVFEQKGRALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTL
Sbjct: 901  EVFEQKGRALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTL 960

Query: 961  GFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETAIQLNAQDI 1020
            GFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETAIQLNAQDI
Sbjct: 961  GFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETAIQLNAQDI 1020

Query: 1021 SAKFADLENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQ 1080
            SAKFADLENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQ
Sbjct: 1021 SAKFADLENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQ 1080

Query: 1081 QQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQ 1140
            QQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQ
Sbjct: 1081 QQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQ 1140

Query: 1141 GYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNT 1200
            GYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNT
Sbjct: 1141 GYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNT 1200

Query: 1201 LVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNI 1260
            LVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNI
Sbjct: 1201 LVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNI 1260

Query: 1261 RVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLK 1320
            RVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLK
Sbjct: 1261 RVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLK 1320

Query: 1321 IESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALD 1380
            IESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALD
Sbjct: 1321 IESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALD 1380

Query: 1381 KFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKP 1440
            KFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKP
Sbjct: 1381 KFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKP 1440

Query: 1441 AYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEI 1500
            AYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEI
Sbjct: 1441 AYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEI 1500

Query: 1501 FSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESSTKIETGTFMLNFFDSINTGSDSVIL 1560
            FSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESSTKIETGTFMLNFFDSINTGSDSVIL
Sbjct: 1501 FSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESSTKIETGTFMLNFFDSINTGSDSVIL 1560

Query: 1561 KNLKAQRTLEACKDEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELF 1620
            KNLKAQRTLEACKDEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELF
Sbjct: 1561 KNLKAQRTLEACKDEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELF 1620

Query: 1621 TFEAEHAAVKENEKLPAFQQYTALVDRCDIQLLCGANRANLKSFGNTLTIVRENKSEDAD 1680
            TFEAEHAAVKENEKLPAFQQYTALVDRCDIQLLCGANRANLKSFGNTLTIVRENKSEDAD
Sbjct: 1621 TFEAEHAAVKENEKLPAFQQYTALVDRCDIQLLCGANRANLKSFGNTLTIVRENKSEDAD 1680

Query: 1681 AFSTAFAWSWFEFGIRHRNTILLDAFSRSSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSE 1740
            AFSTAFAWSWFEFGIRHRNTILLDAFSRSSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSE
Sbjct: 1681 AFSTAFAWSWFEFGIRHRNTILLDAFSRSSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSE 1740

Query: 1741 SKHYCTFIDSLEESWNNLRLALGPNTGFLEKPHSAATEKVAPQFALNXXXXXXXXXXXXX 1800
            SKHYCTFIDSLEESWNNLRLALGPNTGFLEKPHSAATEKVAPQFALN             
Sbjct: 1741 SKHYCTFIDSLEESWNNLRLALGPNTGFLEKPHSAATEKVAPQFALNIDISDLTTDISLL 1800

Query: 1801 XXXXXXKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPK 1860
                  KNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPK
Sbjct: 1801 SSLAITKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPK 1860

Query: 1861 KNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIM 1920
            KNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIM
Sbjct: 1861 KNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIM 1920

Query: 1921 SQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGA 1980
            SQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGA
Sbjct: 1921 SQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGA 1980

Query: 1981 LRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPF 2040
            LRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPF
Sbjct: 1981 LRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPF 2040

Query: 2041 SLVRILFLVNELSRLSELQKRQTVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFD 2100
            SLVRILFLVNELSRLSELQKRQTVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFD
Sbjct: 2041 SLVRILFLVNELSRLSELQKRQTVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFD 2100

Query: 2101 VNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFL 2160
            VNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFL
Sbjct: 2101 VNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFL 2160

Query: 2161 PSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPF 2220
            PSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPF
Sbjct: 2161 PSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPF 2220

Query: 2221 KSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPS 2280
            KSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPS
Sbjct: 2221 KSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPS 2280

Query: 2281 VEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQE 2340
            VEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQE
Sbjct: 2281 VEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQE 2340

Query: 2341 ASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTND 2400
            ASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTND
Sbjct: 2341 ASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTND 2400

Query: 2401 LDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNI 2460
            LDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNI
Sbjct: 2401 LDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNI 2460

Query: 2461 DVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFP 2520
            DVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFP
Sbjct: 2461 DVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFP 2520

Query: 2521 WNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLG 2580
            WNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLG
Sbjct: 2521 WNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLG 2580

Query: 2581 GTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKL 2640
            GTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKL
Sbjct: 2581 GTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKL 2640

Query: 2641 FNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDS 2700
            FNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDS
Sbjct: 2641 FNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDS 2700

Query: 2701 NTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQI 2760
            NTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQI
Sbjct: 2701 NTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQI 2760

Query: 2761 EGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAIL 2820
            EGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAIL
Sbjct: 2761 EGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAIL 2820

Query: 2821 IGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPR 2880
            IGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPR
Sbjct: 2821 IGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPR 2880

Query: 2881 GFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLT 2940
            GFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLT
Sbjct: 2881 GFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLT 2940

Query: 2941 HQAMIVPLQKLAHIAETEWARILGRA 2966
            HQAMIVPLQKLAHIAETEWARILGRA
Sbjct: 2941 HQAMIVPLQKLAHIAETEWARILGRA 2966

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 3390 bits (8791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1696/2988 (56%), Positives = 2155/2988 (72%), Gaps = 69/2988 (2%)

Query: 1    MASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKV 60
            M+S+F+RV +ST +DFSWVFL DWVLILSVSLL AFYFGRV GYT+T +LE+LAWKRY V
Sbjct: 1    MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60

Query: 61   KISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDK 120
            K+           GR+FFKNLTV+TQ+QT+S L GSITWRYWLL+SRKT+    SE    
Sbjct: 61   KV-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEK--- 106

Query: 121  SVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTDECSVD 180
               KLPCRFR+ECQGLEHFIYN+TQAFDNIL+SLPRED E  K FF D S + T+E S +
Sbjct: 107  -AAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETSTE 165

Query: 181  EDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIGNKTS 240
             DSA Q+SHLE            LNDR++Q P+S P FL+LLPLEYSVQKGA++IGNK +
Sbjct: 166  NDSAAQKSHLETSMSSPSASTESLNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKT 225

Query: 241  SSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVKR 300
            SSVMV S+EKL G LD C PD+KIDLYKIK++++  KF +SL+PNL  +++ PLK+  K 
Sbjct: 226  SSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKA 285

Query: 301  SKLSKLWHRSYQLFFKTDSP--SSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRF 358
            ++L KL H+ Y+ F +      S  +   S +   RNPL+RWRGLGLYWKE D AWDD F
Sbjct: 286  NRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVF 345

Query: 359  QFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPPDYSI 418
             F+L KHEYARY+KVMKC++ML+EY+ D PG+VPHGA PT + +DGPDVGN G PPD+S+
Sbjct: 346  HFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSL 405

Query: 419  DIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIVGE 478
            DIQ+ GA+++YGPW+HHEIMP+QK+FSPVVSRDS P E+L+ GS R++TRLR+SI+I+ +
Sbjct: 406  DIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSD 465

Query: 479  SVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTL 538
            S+WRIPTRE SKDL+FLKR++ETED+TRPFGWLE+SL+EGSEVR NIAMCPT+TGFDN L
Sbjct: 466  SIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKL 525

Query: 539  DLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHI 598
            DLHF+KPEIRTSVNHDILLSA+TH + A +GYPLGWN KA+W FD  S+Q ++FILKDHI
Sbjct: 526  DLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHI 585

Query: 599  TLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXXXCYLS 658
            TLLGDI+SDFG+G+PTPY+LFRPF Y FNW  TGYS+YL                 CYLS
Sbjct: 586  TLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLS 645

Query: 659  FHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANF 718
            FHGDDLR++F VPQ++IAGNST I+Y L+TPLFRLNMNTPSWNTLHEFMKDKEVGR+ +F
Sbjct: 646  FHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDF 705

Query: 719  SLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEE 778
            SL+GSYLFHSKLDV+NIDTIIIEC S+ TTLKCYGYV+R+ +GVKMNYFGDFVHFKTTEE
Sbjct: 706  SLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEE 765

Query: 779  YMEELRGTNAVTKTTHD---SETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVNE 835
            YMEELR      K   +   + TE   A +  D+ ++ +  H  DP+ AKK SLKRMVNE
Sbjct: 766  YMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPK-NHTTDPVMAKKLSLKRMVNE 824

Query: 836  KDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLI 895
            KDVWFTF+VEDGC ILP+NLYDC++C+A EFDSLDIDLR+INYYMD+QAALSP+ +R L 
Sbjct: 825  KDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLS 884

Query: 896  DCGCEEVFEQKGRALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSD 955
            DC    +F             G +S LHIH HRMFGLPP EETYFCKWDFS+G LD+SSD
Sbjct: 885  DCDPAHLFSGSEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSD 944

Query: 956  LPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETAIQL 1015
            L   L F +AW KL F F+DYENIMNYK+ PILDMTS+      I    + +  +  I +
Sbjct: 945  LSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIV 1004

Query: 1016 NAQDISAKFADLENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDL 1075
              ++++A+  D EN  YSSR D+D+ ++T  + +  K    I  F +S+KI+ FCQL++ 
Sbjct: 1005 EVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNF 1064

Query: 1076 LAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENV 1135
            L HS QQK HIA+NDAPFHRC FL+PL +Q S +Y+ L G I PGVSIP +  P+  ENV
Sbjct: 1065 LVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENV 1124

Query: 1136 KAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPT 1195
              +   +LK E  S    +  F     K +      +F   L         +SS+ +D  
Sbjct: 1125 TMILDEFLKGEKNSLQMGNEHFCS---KKEEDGYAFNFASGL---------MSSTENDSN 1172

Query: 1196 FEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQK 1255
             E  +LVV L   + SIS  C +   +  +Q +   +EQ ID+ E++VVLHFI+   ++K
Sbjct: 1173 VESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRK 1232

Query: 1256 NYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDP-ED 1314
              KN++V  PT ++    +  +N       V +   ++S+D S+++      S+    +D
Sbjct: 1233 QCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQD 1292

Query: 1315 TTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSIN 1374
             T+L+K+ESL L V N   +      + E+     S+K+LE W     I  SS    SI+
Sbjct: 1293 ITALVKVESLALCVSNT-SRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSID 1351

Query: 1375 ASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDP 1434
              V  DK      F++    +   +   +S    + +KA+++FFYRIS ASDEYQI HDP
Sbjct: 1352 TWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDP 1411

Query: 1435 PVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAE 1494
            PVITKPAYITRLP+QHVRE++SWKI+TRLRHILNYLP +L+++I+  LK++ +   + A 
Sbjct: 1412 PVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAG 1471

Query: 1495 ETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESSTKIETGTFMLNFFDSINTG 1554
            E FL IFS W +W+ SDVE+CYMYR+ F +  +   A   + ++E  +      DS +  
Sbjct: 1472 EIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQ-AGPLNLRVEVDSCSATVSDSTHKE 1530

Query: 1555 SDSVILKNLKAQRTLEACKDEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLL 1614
             D + +K LK  +      +      +       D    LSC +   + S+S+ T IKLL
Sbjct: 1531 GDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATD-GNSLSCSLKAVKASISE-TAIKLL 1588

Query: 1615 SVRELFTFEAEHAAVKENEKLPA-----FQQYTALVDRCDIQLLCGANRANLKSFGNTLT 1669
            + RELF  +     +   + LP+       +   L+DRC+I++   +  ANLKSFGN+++
Sbjct: 1589 AFRELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKTANLKSFGNSIS 1648

Query: 1670 --IVRENKSEDADAFSTAFAWSWFEFGIRHRNTILLDAFSRSSAVGAH-GFSGKNSRRKL 1726
              +V    + D  + S A AWSWFEF +RH N I++DAF+R  ++G+    S   +  ++
Sbjct: 1649 FALVDTESARDTGS-SMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRV 1707

Query: 1727 DLRAKKFRLKLPSESKHYCTFIDSLEESWNNLRLALGPNTGFLEKPHSAATE-KVAPQFA 1785
             L ++K RLK+PS +K YC FI+SL ESW+    +L P   F  +    + E K   + A
Sbjct: 1708 HLGSQKLRLKVPSSTKDYCNFINSLSESWS----SLAPKLKFNTRSKDLSPEMKNFSKVA 1763

Query: 1786 LNXXXXXXXXXXXXXXXXXXXKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYL 1845
                                 K FK LT+ +E+ A+S+L+L  E  D+D+ S  T QQYL
Sbjct: 1764 FEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYL 1823

Query: 1846 KISQSNISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLK 1905
            K+SQS +  +     K       ++L+S +TK KL DPR+I   L +D+  AK  L  LK
Sbjct: 1824 KVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLK 1883

Query: 1906 -------SCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELN 1958
                   + FG  +T  D+++ +       +   W++Q+ + YVGLL+PLG+TSYI+E+N
Sbjct: 1884 IHLLALGALFGTDST--DEEVFAGAL----WPREWLWQLDMKYVGLLVPLGTTSYISEIN 1937

Query: 1959 EISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKE 2018
            E+S+ ++ DE    A+E S   + G+LS A I+FLIND+ LPE LS+V++FA  IK+AK 
Sbjct: 1938 ELSSSLSCDE----AAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKV 1993

Query: 2019 SEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQKRQTVGKLPESVEVRETFR 2078
            +E  ++SLQIES +FRIAL PFSL+RIL L  E + LS LQ  +    +  S + ++ F 
Sbjct: 1994 AENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDAKDFFN 2053

Query: 2079 FRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAE 2138
              + F S+Q+LSY+FCLGWIF+ + +   GL WGYQRLFAAHEKPYGKLTLLDAYF IA 
Sbjct: 2054 ISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIAR 2113

Query: 2139 GSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDV 2198
            GSTS+DFY   +  + PNRS LPSMQI YW E+ G  DELF+RINGERLDV FLSKSI +
Sbjct: 2114 GSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGI 2173

Query: 2199 AGGLMKSLNMFDELKKQYVDPFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVF 2258
            AGG  +SL++F ELK+QY+DPFK     KR  A S FSK P LS+I  V+CKV+YAGGVF
Sbjct: 2174 AGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVF 2233

Query: 2259 RLYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVP 2318
            +LYSLDD++ + GPSFQLESPSV+++F+Y +M+ GK  H+LRA M V SSHNT+FPTCVP
Sbjct: 2234 KLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVP 2293

Query: 2319 VLNEMARDIRQLLKGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCE 2378
            +++EMA DIRQLLK  N+S  E    S  QE ++YRS L+  DISF+++I KQQIS SCE
Sbjct: 2294 IISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCE 2353

Query: 2379 PKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLS 2438
            PKAKVQAD+GFEK A+K+FTND D+ EPLSLS+DI+ ITA SRHIFSREVSTS+ I+ LS
Sbjct: 2354 PKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLS 2413

Query: 2439 WIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRA 2498
            ++F+LTHPDTIHTYGI +IP IDVYFNIKQLQDLN+F+NIWK DS + +QPELD++    
Sbjct: 2414 FVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIG 2473

Query: 2499 LTSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYS 2558
             T+ EKPL +K+KKV S +SFPWNF++I+S+I+G+IDLGISLGVLSLTT++IWA+TDHYS
Sbjct: 2474 PTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYS 2533

Query: 2559 DWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFD 2618
            DWTQ LSLQ++K+ LSSDGRLGGT LL+NF WMS+I+WP+ EG FESPLV L++ LDE  
Sbjct: 2534 DWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETA 2593

Query: 2619 LKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDV 2678
            +KL+FDYHL+LIASVE L L LFNKRDPRG+ RNLLSV++SS+STQ+FLTALAPANI DV
Sbjct: 2594 VKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDV 2653

Query: 2679 YNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYP 2738
            YNTILRMRKDNRKSY ETLGDSNT+DT+ +S+S +IL+SLSFLRTEL V LKFVHIQ+YP
Sbjct: 2654 YNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYP 2713

Query: 2739 SKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGV 2798
            S LFDMEV+TFKA+DF T SQ EG +KLKT LK ++H VK+ALS +K+QLHE+ ASQIGV
Sbjct: 2714 STLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGV 2773

Query: 2799 KEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFL 2858
            KEYIEHA K DGGTIL  PAILIGMTTWHDVATN VELLYSNSFGGKIG+RWNLGSINFL
Sbjct: 2774 KEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFL 2833

Query: 2859 REMWATHVRAMALRRSHNGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKD 2918
            REMWATH RAMALRRSHNGQ + FFEDEHL +KL+DVDLGDEY Y+PLEEPHIEIPQTKD
Sbjct: 2834 REMWATHARAMALRRSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKD 2893

Query: 2919 LGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966
            LGEATPPVEWFGVNRKQFPGLTHQ +IVPLQKLAH+AE+EWARILGRA
Sbjct: 2894 LGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 3132 bits (8121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1570/2785 (56%), Positives = 2007/2785 (72%), Gaps = 54/2785 (1%)

Query: 204  LNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSK 263
            LNDR++Q P+S P FL+LLPLEYSVQKGA++IGNK +SSVMV S+EKL G LD C PD+K
Sbjct: 11   LNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTK 70

Query: 264  IDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSP--S 321
            IDLYKIK++++  KF +SL+PNL  +++ PLK+  K ++L KL H+ Y+ F +      S
Sbjct: 71   IDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLS 130

Query: 322  SKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLL 381
              +   S +   RNPL+RWRGLGLYWKE D AWDD F F+L KHEYARY+KVMKC++ML+
Sbjct: 131  RGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLI 190

Query: 382  EYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQ 441
            EY+ D PG+VPHGA PT + +DGPDVGN G PPD+S+DIQ+ GA+++YGPW+HHEIMP+Q
Sbjct: 191  EYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQ 250

Query: 442  KLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRET 501
            K+FSPVVSRDS P E+L+ GS R++TRLR+SI+I+ +S+WRIPTRE SKDL+FLKR++ET
Sbjct: 251  KVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKET 310

Query: 502  EDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQT 561
            ED+TRPFGWLE+SL+EGSEVR NIAMCPT+TGFDN LDLHF+KPEIRTSVNHDILLSA+T
Sbjct: 311  EDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAET 370

Query: 562  HSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRP 621
            H + A +GYPLGWN KA+W FD  S+Q ++FILKDHITLLGDI+SDFG+G+PTPY+LFRP
Sbjct: 371  HDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRP 430

Query: 622  FSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXXXCYLSFHGDDLRLNFEVPQENIAGNSTK 681
            F Y FNW  TGYS+YL                 CYLSFHGDDLR++F VPQ++IAGNST 
Sbjct: 431  FIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTT 490

Query: 682  INYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIE 741
            I+Y L+TPLFRLNMNTPSWNTLHEFMKDKEVGR+ +FSL+GSYLFHSKLDV+NIDTIIIE
Sbjct: 491  IDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIE 550

Query: 742  CCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEYMEELRGTNAVTKTTHD---SET 798
            C S+ TTLKCYGYV+R+ +GVKMNYFGDFVHFKTTEEYMEELR      K   +   + T
Sbjct: 551  CKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANST 610

Query: 799  EIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDC 858
            E   A +  D+ ++ +  H  DP+ AKK SLKRMVNEKDVWFTF+VEDGC ILP+NLYDC
Sbjct: 611  ETTTAGEGEDKQNAPK-NHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDC 669

Query: 859  DSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFEQKGRALCGELVAGR 918
            ++C+A EFDSLDIDLR+INYYMD+QAALSP+ +R L DC    +F             G 
Sbjct: 670  NACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANFGS 729

Query: 919  LSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYEN 978
            +S LHIH HRMFGLPP EETYFCKWDFS+G LD+SSDL   L F +AW KL F F+DYEN
Sbjct: 730  ISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYEN 789

Query: 979  IMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDL 1038
            IMNYK+ PILDMTS+      I    + +  +  I +  ++++A+  D EN  YSSR D+
Sbjct: 790  IMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADV 849

Query: 1039 DVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPF 1098
            D+ ++T  + +  K    I  F +S+KI+ FCQL++ L HS QQK HIA+NDAPFHRC F
Sbjct: 850  DIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSF 909

Query: 1099 LIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRWFP 1158
            L+PL +Q S +Y+ L G I PGVSIP +  P+  ENV  +   +LK E  S    +  F 
Sbjct: 910  LLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFC 969

Query: 1159 VNEVKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYE 1218
                K +      +F   L         +SS+ +D   E  +LVV L   + SIS  C +
Sbjct: 970  S---KKEEDGYAFNFASGL---------MSSTENDSNVESESLVVKLIKPQASISACCIK 1017

Query: 1219 VIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKEN 1278
               +  +Q +   +EQ ID+ E++VVLHFI+   ++K  KN++V  PT ++    +  +N
Sbjct: 1018 PFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDN 1077

Query: 1279 TYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDP-EDTTSLLKIESLDLEVFNKLDKKTK 1337
                   V +   ++S+D S+++      S+    +D T+L+K+ESL L V N   +   
Sbjct: 1078 ISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNT-SRNGP 1136

Query: 1338 FAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSK 1397
               + E+     S+K+LE W     I  SS    SI+  V  DK      F++    +  
Sbjct: 1137 LENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANID 1196

Query: 1398 QLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSW 1457
             +   +S    + +KA+++FFYRIS ASDEYQI HDPPVITKPAYITRLP+QHVRE++SW
Sbjct: 1197 TITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSW 1256

Query: 1458 KIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYM 1517
            KI+TRLRHILNYLP +L+++I+  LK++ +   + A E FL IFS W +W+ SDVE+CYM
Sbjct: 1257 KIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYM 1316

Query: 1518 YRRVFTNTLDDTVAHESSTKIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAA 1577
            YR+ F +  +   A   + ++E  +      DS +   D + +K LK  +      +   
Sbjct: 1317 YRKAFYSQYEGQ-AGPLNLRVEVDSCSATVSDSTHKEGDMIAVKGLKLLKKFILKSEMVG 1375

Query: 1578 EKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEKLPA 1637
               +       D    LSC +   + S+S+ T IKLL+ RELF  +     +   + LP+
Sbjct: 1376 SILAIDDGTATD-GNSLSCSLKAVKASISE-TAIKLLAFRELFESQNSQDILSNTQVLPS 1433

Query: 1638 -----FQQYTALVDRCDIQLLCGANRANLKSFGNTLT--IVRENKSEDADAFSTAFAWSW 1690
                   +   L+DRC+I++   +  ANLKSFGN+++  +V    + D  + S A AWSW
Sbjct: 1434 GKILKLMELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGS-SMALAWSW 1492

Query: 1691 FEFGIRHRNTILLDAFSRSSAVGAH-GFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFID 1749
            FEF +RH N I++DAF+R  ++G+    S   +  ++ L ++K RLK+PS +K YC FI+
Sbjct: 1493 FEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFIN 1552

Query: 1750 SLEESWNNLRLALGPNTGFLEKPHSAATE-KVAPQFALNXXXXXXXXXXXXXXXXXXXKN 1808
            SL ESW+    +L P   F  +    + E K   + A                     K 
Sbjct: 1553 SLSESWS----SLAPKLKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKR 1608

Query: 1809 FKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPT 1868
            FK LT+ +E+ A+S+L+L  E  D+D+ S  T QQYLK+SQS +  +     K       
Sbjct: 1609 FKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASK 1668

Query: 1869 VKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLK-------SCFGKLNTKNDKDIMS 1921
            ++L+S +TK KL DPR+I   L +D+  AK  L  LK       + FG  +T  D+++ +
Sbjct: 1669 MQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDST--DEEVFA 1726

Query: 1922 QGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGAL 1981
                   +   W++Q+ + YVGLL+PLG+TSYI+E+NE+S+ ++ DE    A+E S   +
Sbjct: 1727 GAL----WPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSLSCDE----AAEFSFPLV 1778

Query: 1982 RGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFS 2041
             G+LS A I+FLIND+ LPE LS+V++FA  IK+AK +E  ++SLQIES +FRIAL PFS
Sbjct: 1779 HGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFS 1838

Query: 2042 LVRILFLVNELSRLSELQKRQTVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDV 2101
            L+RIL L  E + LS LQ  +    +  S + ++ F   + F S+Q+LSY+FCLGWIF+ 
Sbjct: 1839 LIRILSLAYEATHLSGLQALKDNAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNN 1898

Query: 2102 NDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLP 2161
            + +   GL WGYQRLFAAHEKPYGKLTLLDAYF IA GSTS+DFY   +  + PNRS LP
Sbjct: 1899 DGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLP 1958

Query: 2162 SMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFK 2221
            SMQI YW E+ G  DELF+RINGERLDV FLSKSI +AGG  +SL++F ELK+QY+DPFK
Sbjct: 1959 SMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFK 2018

Query: 2222 SVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSV 2281
                 KR  A S FSK P LS+I  V+CKV+YAGGVF+LYSLDD++ + GPSFQLESPSV
Sbjct: 2019 PEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSV 2078

Query: 2282 EILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQEA 2341
            +++F+Y +M+ GK  H+LRA M V SSHNT+FPTCVP+++EMA DIRQLLK  N+S  E 
Sbjct: 2079 DVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVET 2138

Query: 2342 SHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDL 2401
               S  QE ++YRS L+  DISF+++I KQQIS SCEPKAKVQAD+GFEK A+K+FTND 
Sbjct: 2139 PRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDF 2198

Query: 2402 DMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNID 2461
            D+ EPLSLS+DI+ ITA SRHIFSREVSTS+ I+ LS++F+LTHPDTIHTYGI +IP ID
Sbjct: 2199 DVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTID 2258

Query: 2462 VYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFPW 2521
            VYFNIKQLQDLN+F+NIWK DS + +QPELD++     T+ EKPL +K+KKV S +SFPW
Sbjct: 2259 VYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPW 2318

Query: 2522 NFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGG 2581
            NF++I+S+I+G+IDLGISLGVLSLTT++IWA+TDHYSDWTQ LSLQ++K+ LSSDGRLGG
Sbjct: 2319 NFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGG 2378

Query: 2582 TLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLF 2641
            T LL+NF WMS+I+WP+ EG FESPLV L++ LDE  +KL+FDYHL+LIASVE L L LF
Sbjct: 2379 TFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLF 2438

Query: 2642 NKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSN 2701
            NKRDPRG+ RNLLSV++SS+STQ+FLTALAPANI DVYNTILRMRKDNRKSY ETLGDSN
Sbjct: 2439 NKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSN 2498

Query: 2702 TKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIE 2761
            T+DT+ +S+S +IL+SLSFLRTEL V LKFVHIQ+YPS LFDMEV+TFKA+DF T SQ E
Sbjct: 2499 TRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTE 2558

Query: 2762 GDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILI 2821
            G +KLKT LK ++H VK+ALS +K+QLHE+ ASQIGVKEYIEHA K DGGTIL  PAILI
Sbjct: 2559 GSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILI 2618

Query: 2822 GMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRG 2881
            GMTTWHDVATN VELLYSNSFGGKIG+RWNLGSINFLREMWATH RAMALRRSHNGQ + 
Sbjct: 2619 GMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKS 2678

Query: 2882 FFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTH 2941
            FFEDEHL +KL+DVDLGDEY Y+PLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTH
Sbjct: 2679 FFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTH 2738

Query: 2942 QAMIVPLQKLAHIAETEWARILGRA 2966
            Q +IVPLQKLAH+AE+EWARILGRA
Sbjct: 2739 QGVIVPLQKLAHLAESEWARILGRA 2763

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2519 bits (6529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1320/3021 (43%), Positives = 1882/3021 (62%), Gaps = 87/3021 (2%)

Query: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61
             SQFK + +S   +FSWVFLVDWVL++ +SL   FYFGR   Y +T L++W+ W+RYKVK
Sbjct: 4    GSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRYKVK 63

Query: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKT---AFAKASENI 118
            I+IQSLKISFLGGR+FFKNLTV+T++QT SFLQGS TWRYWLLNSRKT      K+ E  
Sbjct: 64   INIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSGEEK 123

Query: 119  DKSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDK--NTDE 176
            D+    L CRF +E  G E FIYN+T A+D IL S+ ++D E FK FF+   D   +++E
Sbjct: 124  DQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFFEGGEDSLHSSEE 183

Query: 177  CSVDEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIG 236
               DE  A   S                NDR+FQ  DS    L+ LP+   V +GAV++G
Sbjct: 184  KLEDETLASDSSVSNVDST---------NDRNFQEQDSRSMLLQFLPIHLKVNRGAVLLG 234

Query: 237  NKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKS 296
            N T+ SVM++ YE  +GV+D C  + K+DLYKI+   +F    + +KPN+S   ENP+KS
Sbjct: 235  NTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKS 294

Query: 297  FVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP--LKRWRGLGLYWKEEDAAW 354
            ++  S++S++W +  ++FF+  S    +  N      ++    ++WRGL LY  E +   
Sbjct: 295  YIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALY-SEYNVTT 353

Query: 355  DDR------------FQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTV 402
             D                D+  HEYA+YT+++K   + + YA+D PG+VPHGAL T +  
Sbjct: 354  SDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQR 413

Query: 403  DGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGS 462
            DGPDVGNSG PP++S+D ++ GA++ YGPW+H +I  LQ++  P+VSRD+ P+++LTPGS
Sbjct: 414  DGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGS 473

Query: 463  KRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVR 522
            +RIYTR  LS+L++ +++WRIPTRE+SKD +FLK++RE++++ RPFGWL++ L++ +++ 
Sbjct: 474  RRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLF 533

Query: 523  FNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVF 582
              + MCPT TGF+N L  H VKPEIR+SVNHDI   A   ++ A +GYPLGWN +A+WVF
Sbjct: 534  MTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVF 593

Query: 583  DSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXX 642
               S Q   F L+DHI LL DI  DFGSG PTPYELFRPF Y F W+   YSIYL     
Sbjct: 594  QFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDA 653

Query: 643  XXXXXXXXXXXXCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNT 702
                        CYLS HGD L+++F V  + I GNST +NY + TP F L ++TPSW+T
Sbjct: 654  NIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWST 713

Query: 703  LHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGV 762
            LHEFMK+KEVGRS +F ++GSY FHS +DV N+DTI+IEC SK TTL+C G+V+RY + +
Sbjct: 714  LHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNI 773

Query: 763  KMNYFGDFVHFKTTEEYMEEL------RGTNAVTKTTHDSETEIQEAP-KQMDEDSSQRE 815
             MNYFGDF+HFKTTEEY  EL      R    +     D  +++        D+++++ +
Sbjct: 774  NMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYD 833

Query: 816  QH--IKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDL 873
             H   +DP   K+  LKR  NEKDVWFTF VEDGC + PEN+YDC SC  L FDSLD+DL
Sbjct: 834  LHEFNEDP-KVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDL 892

Query: 874  RHINYYMDMQAALSPLRIRRLIDCGCEEVFEQKGRALCGELVAGR---LSRLHIHTHRMF 930
            R++NYYMD+QA+LSP  I+R  D     +F+   RA C  LV G    LS L+IH HRMF
Sbjct: 893  RYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVV-RA-CEGLVDGHQGFLSELNIHAHRMF 950

Query: 931  GLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDM 990
            GLP  EETYFCKWDF +G+LD+ SD+ F  G I A+ K+GFG++DYEN++ Y++   +DM
Sbjct: 951  GLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDM 1010

Query: 991  TSVTLAIDAIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASIIDK 1050
            TS+TL  D+I F          + L+   ISA   D EN  YS+++   + N+   + +K
Sbjct: 1011 TSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEK 1070

Query: 1051 NKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDY 1110
            +  N+    F TS+ ++ F Q +D   H   Q+ HI  +D+P+HRC FL+P+  Q +  Y
Sbjct: 1071 SSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLY 1130

Query: 1111 KGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFV-DRWFPVNEVKNKNSSS 1169
              LFG I PGVSIP L  P+    + ++F+  L       +   D  +       + +SS
Sbjct: 1131 NKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSS 1190

Query: 1170 LKDFKGQ---LQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQ 1226
                 G    L+ +   + +  S   +P FE+++ ++NL  + ++I+P   + + +   Q
Sbjct: 1191 FIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQ 1250

Query: 1227 CHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQV 1286
                 I+  ID  E+D+V  F K    +    N+RVL P +   F +   +        +
Sbjct: 1251 FCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHL 1310

Query: 1287 KVTANQVSLDWSLKKGLKLPGSDNDP-----EDTTSLLKIESLDLEVFNKLDKKTKFAEM 1341
             V  N  SLD   K   K+ G  N       E+ TS LK  S++  + N+   K K   +
Sbjct: 1311 YVEVNHPSLDLCQK---KIFGQTNSSKLEYTEEVTSSLKASSINFFI-NQQQLKPK-TLL 1365

Query: 1342 DENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLIN 1401
                 F    +ELE WS  +  + +SL  ++++  V   +  WL D++R     + +L  
Sbjct: 1366 KARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFA 1425

Query: 1402 RLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVT 1461
              S      +  ++E  +R + AS EY I HD PVITKPAYITRL   H+RE+RSW+I+T
Sbjct: 1426 SFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIIT 1485

Query: 1462 RLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRV 1521
            RLRHILNYLP +        LK  E+     A + FL+IFSNW +W++SDV+KCY+Y+RV
Sbjct: 1486 RLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRV 1545

Query: 1522 F-TNTLDDTVAHESSTKIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAAEKR 1580
            F + ++       +  K+       +   S +   D +++KNLK+  + E  +       
Sbjct: 1546 FLSRSMKKNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSA 1605

Query: 1581 SNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRE----LFTFEAEHAAVKENEKLP 1636
             N  ++    +  +SC I   +  L D  ++KL+ + +    L     +  +VK + K P
Sbjct: 1606 KNTEDSASTEKMIISCNIKSIRGDLGDN-IVKLVRMYDGLSNLSDTNLKTTSVKHDVK-P 1663

Query: 1637 AFQQYTALVDRCDIQLLCGANRANLKSFGNTLTIVRE---NKSEDADAFSTAFAWSWFEF 1693
               Q   LVDR D  +     R  L+SF N  +   E   +KSE   + +   A S  E 
Sbjct: 1664 KLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCASS--EA 1721

Query: 1694 GIRHRNTILLDAFSRSSAVG-AHGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFIDSLE 1752
             +RH + +LL++  +  A+  +     ++   K+ LR+    +   + ++ Y  FI S++
Sbjct: 1722 WVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIHFIWSIK 1781

Query: 1753 ESWNNLRLALGPNTGFLEKPHSAATEKVAPQ-------FALNXXXXXXXXXXXXXXXXXX 1805
             S + +R  L      + K ++       P+         L+                  
Sbjct: 1782 ASVDGIRKELA---SAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTPFGI 1838

Query: 1806 XKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNAS 1865
             ++   + +  E+       +    +DI++ STR+ Q+YLK SQS ++  +    + NA 
Sbjct: 1839 HQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQNAM 1898

Query: 1866 PPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNT 1925
               V + S I+KL + DPR+    L +D   A    A LKS   K  +KN +    +  T
Sbjct: 1899 FLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQRKQT 1958

Query: 1926 KFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDL 1985
                   W+  V + Y+G+++ LGS  Y+ ELN +   ++ +    K  E     + GD 
Sbjct: 1959 NI----IWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGDF 2014

Query: 1986 SAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRI 2045
            S  ++  LI+   L   LS++VD AV++K+++E  + ++++QIES +FR+AL P SL ++
Sbjct: 2015 SIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKV 2074

Query: 2046 LFLVNELSRLSELQKRQTVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSP 2105
            L+ +NE +R+SE  K ++     +     +       FRS+Q+LSYNFC+GWIFD     
Sbjct: 2075 LWAINEFTRVSEAYKTRSSLLQHKKTAPTDISELSNKFRSIQILSYNFCIGWIFDAGSET 2134

Query: 2106 EPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQI 2165
            +PGLIWGY+RLFAA++KPYGKLTLLDAYFSIA G++SD F+++    +  NRS+LPSMQI
Sbjct: 2135 DPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQI 2194

Query: 2166 RYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFKSVAN 2225
             YW   +G T  LF+RI GERLDV FLS SI +A G +KS+  F ELKK  VDPF +   
Sbjct: 2195 GYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATNKT 2254

Query: 2226 PKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEILF 2285
             ++P  +      P LS I+  +C V+YAGGVF+L+S +D+QN + PSF++ESPSVE+  
Sbjct: 2255 TEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAI 2314

Query: 2286 DYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQEASHKS 2345
            DY+ +     SH +R  + V  S+NT+FPTCVP+L+ M +D+R +LK FN  P+   + +
Sbjct: 2315 DYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNST 2374

Query: 2346 VSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDMSE 2405
            +S   ++Y+  LR  DI+FL++IGKQ IS SCEPKAKVQAD+GFEKLAVK+FTN+LD SE
Sbjct: 2375 ISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSE 2434

Query: 2406 PLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVYFN 2465
            PLSLSIDI  + A SRHIFSREVSTS +ID +  +F+LTHP+ I TYG   + ++ +YFN
Sbjct: 2435 PLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFN 2494

Query: 2466 IKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFPWNFIL 2525
            +KQLQDLN+F++IWKPDS +   P+  +  +R+L+S +K  V+KF+K + T +FPWN+ L
Sbjct: 2495 MKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTL 2554

Query: 2526 IISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGTLLL 2585
            I S IKGDIDLG SLGVLS+  +R WAI+DH+ DW Q+LS+ +E ILLSSDGRLGG L +
Sbjct: 2555 IFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGI 2614

Query: 2586 RNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFNKRD 2645
                W S I WPV+ G +E+PL++L + L    LK SFDYH+ LIA+VE L LKL+N+RD
Sbjct: 2615 ERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERD 2674

Query: 2646 PRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNTKDT 2705
              GI ++LL+V+++     LFLTALA AN +D+YNTI+RMR+DN+ SY ETL DSNT+ T
Sbjct: 2675 EMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQST 2734

Query: 2706 RSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEGDEK 2765
            +S   ++++L SLS LRT+L V +   ++Q++PS LFDMEVL  KA+D    +Q +GD K
Sbjct: 2735 KSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHK 2794

Query: 2766 LKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIGMTT 2825
            +KT L WQ+H  K++LS FKNQ +E+  SQI VKEYI+HA K  GGTIL  PAIL+ MTT
Sbjct: 2795 VKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTT 2854

Query: 2826 WHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHN--GQPRGFF 2883
            W +V++N +ELLY++SFGGK+ ++WNLG INF+REMWATHVRA+ALRR H+   + + FF
Sbjct: 2855 WQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDKNKSFF 2914

Query: 2884 EDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQA 2943
            EDEH+EEK++DVDLG++Y Y+PLEEP IE+PQ KDLG+ATPPVEWFGVNR++FPGLTHQ+
Sbjct: 2915 EDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQS 2974

Query: 2944 MIVPLQKLAHIAETEWARILG 2964
            ++VPLQKLAH+AE E+AR+LG
Sbjct: 2975 VVVPLQKLAHMAEEEYARVLG 2995

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 1937 bits (5019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1096/3021 (36%), Positives = 1692/3021 (56%), Gaps = 131/3021 (4%)

Query: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62
            SQ + V L+  +DFSWVFLVDW+L + V L   FY GR++ Y ++F+LEWL WKR K+KI
Sbjct: 5    SQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAKIKI 64

Query: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKSV 122
            ++++L++S LGGRI FKNL+V+ ++ T S L+GS+TW+YWLLN RK    + +++     
Sbjct: 65   NVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSSSGKK 124

Query: 123  EKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS--DKNTDECSVD 180
             KLPC+  VEC+GLE FIYN+T A+DN++N L +++ ++F+ +  ++S  +  +D  S D
Sbjct: 125  AKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSAD 184

Query: 181  EDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPD--STPPFLKLLPLEYSVQKGAVVIGNK 238
            +        L             +NDR +Q  D    P  L  LP+E    +G++++GNK
Sbjct: 185  K----LDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK 240

Query: 239  TSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFV 298
             + SVM+LSYE   G++D   P  ++DLY+ K + EF+ F IS+K N+  +    LK  +
Sbjct: 241  FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI 300

Query: 299  KRSKLSKLWHRSYQLF-FKTDSPSSKNPANSAKDGTRNPLKRWRGLGLY---WKEEDAAW 354
             R K+SKLW    ++F   T     K    SA     N   +W+GL LY     +  A+ 
Sbjct: 301  DRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLYKASAGDAKASD 360

Query: 355  DDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPP 414
             D  +FDL+ HEYA++T ++KC  + + Y  D PG+VPHGA PT   +DGPDVGN+G PP
Sbjct: 361  LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 420

Query: 415  DYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSIL 474
            D+++D+QI G S+ YGPW+  ++  LQ++ SPVVSR ++P+++L PGS+RIYT  R++I 
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS 480

Query: 475  IVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGF 534
            I+ ++ WRIPTRE+SKD EFLK ++ET +E RPFGW+++   + +   FNI++CPT  GF
Sbjct: 481  IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF 540

Query: 535  DNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFIL 594
             N   +HF++ EIR+SVNHDILL ++   +   +GYPLGWN KA W+ +  S Q + F+L
Sbjct: 541  QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600

Query: 595  KDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXXX 654
            ++HITL+ D +SDF +G+PTPYELFRPF Y  NW   GYSIYL                 
Sbjct: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 655  CYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGR 714
            CYLS HGD L ++  VP+E+I G  T ++YE+ TP+FR+ +NTP WNTL+EFMK KEVGR
Sbjct: 661  CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 715  SANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFK 774
            + +F++ GSYL +S+LD+DN+DT++IEC SKST L CYG+V+RY   VKMNYFG+F +F 
Sbjct: 721  AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 775  TTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSS-QREQHIKDPLTAKKTSLKRMV 833
            T+EEY   L        TT  S  ++        ++SS + E   K P+  K++ LKR  
Sbjct: 781  TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPM--KRSDLKRTT 838

Query: 834  NEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRR 893
            NE D+WFTF V DG  ILPE +Y  D C AL F  L +D R  NYYMD+ A L+   I+R
Sbjct: 839  NETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKR 898

Query: 894  LIDCGCEEVFEQKGR-ALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDL 952
             +     EVF+   R     E   G LS L IH HRM+GLPP E TYFC+WD +LG L +
Sbjct: 899  HVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCI 958

Query: 953  SSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAI-VFCTDKIKDET 1011
             SD+ F  GF N++ K+GFG+ D ENI+ Y    I DMTS+T+ ++ I +   D +    
Sbjct: 959  DSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQ 1018

Query: 1012 AIQLNAQDISAKFADLENSLYSSRVDLDVANLTASI--IDKNKSNKAIASFMTSIKISNF 1069
            ++ ++A+ I     D EN  YS R+D+ +  LT S+  +  +  + +   F T ++ +NF
Sbjct: 1019 SV-ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNF 1077

Query: 1070 CQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVP 1129
             Q +D+     +Q+ +I  +D+P+HRCPFL+PL  Q+S  Y+ L+G I P  SIP+L +P
Sbjct: 1078 EQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGAIAPSSSIPTLPLP 1137

Query: 1130 LQTENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSS 1189
               + +  + +  +  E A+   ++   P   +  +  S+++  +       +D  +  S
Sbjct: 1138 TLPDTIDYIIEDIV-GEYAT--LLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPS 1194

Query: 1190 SFSDPTF------EHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDV 1243
            SF    F      E +  VV++    L + P  +    + +EQ + + + Q +D+IE+ +
Sbjct: 1195 SFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGI 1254

Query: 1244 VLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGL 1303
            V     +     +  NI + +  L+++++   +E       ++    ++ SL+       
Sbjct: 1255 VKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLE------- 1307

Query: 1304 KLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGI 1363
                  N   +  +L K++++ + V  K  K    +E D   A    ++  E WS     
Sbjct: 1308 --KNRTNKLLEVAALAKVKTVRVTVNQK--KNPDLSE-DRPPALSLGIEGFEVWSSTEDR 1362

Query: 1364 ADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISK 1423
              +SL L S + ++   +  WL ++     N  +++    +        ++ E   +++ 
Sbjct: 1363 QVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTA 1422

Query: 1424 ASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLK 1483
            AS+ YQI+HDP VITKPA+I RL   HVRE+RSWKI+TRLRHIL YLP    S+I   LK
Sbjct: 1423 ASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLK 1482

Query: 1484 NSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFT--NTLDDTVAHESSTKIETG 1541
              +Y     A+  F+ +FS W NW++SDV + Y+Y ++FT  N        +   K   G
Sbjct: 1483 EKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMG 1542

Query: 1542 TFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAAEKRSNMSNAEDDLEERLSCIINKA 1601
            +F L  +     G    +  N           D      S  SN E+ +E  ++  +   
Sbjct: 1543 SFYLTVY-----GEGYEVEHNFVVADA-NLVVDLTPPVTSLPSNREETIE--ITGRVGSV 1594

Query: 1602 QISLSDGTLIKLLSVRELFTFEAEHAAVKENEK-------LPAFQQYTA-LVDRCDIQLL 1653
            +   SD    +LL +++L       AAV E++K          F+  T  LVD+ ++QL+
Sbjct: 1595 KGKFSD----RLLKLQDLIPL---IAAVGEDDKSDPKKELSKQFKMNTVLLVDKSELQLV 1647

Query: 1654 CGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWSWFEFGIRHRNTILLDAFSRSSAV 1712
                +   ++ G  ++++ EN K   + A S        E  ++H + IL +A  R  +V
Sbjct: 1648 MDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSV 1707

Query: 1713 GA--HGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFIDSLEESWNNLRLALGPNTGFLE 1770
             A    +S K +   ++ +      +  S ++   T I  + ES   ++          E
Sbjct: 1708 LATTEAWSHKPTIL-INNQCADLHFRAMSSTEQLVTAITEIRESLMMIK----------E 1756

Query: 1771 KPHSAATEKVAPQF-------ALNXXXXXXXXXXXXXXXXXXXKNFKKLTLAYEQSASSA 1823
            +       K   QF        L+                      K+L + + +  S+ 
Sbjct: 1757 RIKFKPKSKKKSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNE 1816

Query: 1824 LKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDSNITKLKLYDP 1883
            + L+    D  + S +T +QYL+ S  +I        +   S   V +  ++ KL   +P
Sbjct: 1817 ILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIK-GGISREGYSLINVDISISMIKLTFSEP 1875

Query: 1884 RDITLPLGKD---IAQAKACLASLKSCFGKLN-TKNDKDIMSQGNTKFNFSASWIFQVRL 1939
            R I     +D    +Q    L SLK  F   N  K +K   S          +W     +
Sbjct: 1876 RRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPS-------IMINWTLDTSI 1928

Query: 1940 NYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRML 1999
             Y G+L+P+ ST ++ EL+ +   +T    TN      +  + G  S  +I FLI +R L
Sbjct: 1929 TYFGVLVPVASTYFVFELHMLLLSLTN---TNNGMLPEETKVTGQFSIENILFLIKERSL 1985

Query: 2000 PEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQ 2059
            P  LS+++DF++ +   + + +  +S Q+ES +FR+ LSP SL+R+++  ++L  LS   
Sbjct: 1986 PIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYY 2045

Query: 2060 KRQTV----------GKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGL 2109
             R+            GK  +S E+         FRS+ +LSY FC+GWIF       PGL
Sbjct: 2046 SRRHAPNIWNTKMFTGKSDKSKEMPIN------FRSIHILSYKFCIGWIFQYGAGSNPGL 2099

Query: 2110 IWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWI 2169
            + GY RLF+A+EK +GK T++DA+FS+A G+TS  F++  N  +  NRSFLP+MQI YW 
Sbjct: 2100 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWF 2159

Query: 2170 ESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFKSVANPKRP 2229
            +  G   + F R +GE LDV F+   +DV    ++S+  F ELKK  +D  +S+      
Sbjct: 2160 KRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDN 2219

Query: 2230 SATSTFSKF------PGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEI 2283
            S  ST  +       P L  I+ V+   +Y GGVFR+Y+ +D++ ++ PSF+++SP V I
Sbjct: 2220 SYASTSVESASSSLAPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTI 2279

Query: 2284 LFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQEASH 2343
               Y+        H  R  + V  +HNT++  C P+L E +  +++++K  + + ++ + 
Sbjct: 2280 NCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKK-HSTDEKPNF 2338

Query: 2344 KSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDM 2403
               S +++DY+  L   D++  +   KQQ+S SCEPKAKVQAD+GFE     + TN+ D 
Sbjct: 2339 TKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDS 2398

Query: 2404 SEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVY 2463
             +PL  S+ +    A  +HIFSREVSTS ++  +    + THPD I  YG   + ++ V+
Sbjct: 2399 EQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVF 2458

Query: 2464 FNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSE-EKPLVAKFKKVSSTTSFPWN 2522
            FN+KQLQ+L +F++IW+  S + T+P       R +  E E   +       + T  PW 
Sbjct: 2459 FNVKQLQNLYLFLDIWRFSSILHTRPV-----QRTVNKEIEMSSLTSTNYADAGTEIPWC 2513

Query: 2523 FILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGT 2582
            F LI + + GD+DLG SLG++SL T R W  TDHY++  Q L    + I L+S+GRL G 
Sbjct: 2514 FTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGL 2573

Query: 2583 LLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFN 2642
              + N SW+S ++WP  +     PLV+  + +D+  +K +FDYH+ LI ++  +   L N
Sbjct: 2574 FEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHN 2633

Query: 2643 KRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNT 2702
            ++D +G+  +LL V+ SS+   L  TAL  ANILD+YNTI+RMR+DN+ SY ETL DSN 
Sbjct: 2634 EKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNP 2693

Query: 2703 KDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEG 2762
             ++R     KDIL SL  LRT+L V++    +QI P  LFD+EVL  +      +S+   
Sbjct: 2694 GESRQPILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHS 2753

Query: 2763 DEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIG 2822
             +KLKT L+ Q+  V  ALS  K +L E+  + I + +Y+ +A K  GGTI+ IP + + 
Sbjct: 2754 GKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVH 2813

Query: 2823 MTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGF 2882
            MTT  +  TN +E L++ SF  KI +RWNLG ++F++EMW THV+A+A+RRS        
Sbjct: 2814 MTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFG 2873

Query: 2883 FEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQ 2942
              +E LEE ++  +   ++ Y+ LEEP IE+PQ +DLG+ATPP+EWFGVNRK+FP  THQ
Sbjct: 2874 QTEEELEESIKKEEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQ 2933

Query: 2943 AMIVPLQKLAHIAETEWARIL 2963
              ++P+QKL ++AE ++ +IL
Sbjct: 2934 TAVIPVQKLVYLAEKQYVKIL 2954

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 1931 bits (5002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1094/3038 (36%), Positives = 1690/3038 (55%), Gaps = 163/3038 (5%)

Query: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61
             SQ + V L+  +DFSWVFLVDW+L +   L   FY GR++ Y ++F+LEWL WKR KVK
Sbjct: 4    VSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAKVK 63

Query: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKS 121
            I++++L++S LGGRI FK+L+V+ ++ T S L+GSITW+YWLLN RK      +++  K+
Sbjct: 64   INVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSPSKN 123

Query: 122  VEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS--DKNTDECSV 179
              KLPC+F +EC+GLE FIYN+T A+DN++N L +++ ++F+ +  ++S  +  +D  S 
Sbjct: 124  NVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSA 183

Query: 180  DEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPD--STPPFLKLLPLEYSVQKGAVVIGN 237
            D+        L             +NDR +Q  D    P FLK LP+E +  +G++++GN
Sbjct: 184  DK----LDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGN 239

Query: 238  KTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSF 297
            K + SVM+LSYE  +G++D   P  ++DLY+ K + EF+ F IS+K N+  +    LK  
Sbjct: 240  KFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK 299

Query: 298  VKRSKLSKLWHRSYQLFFKTDSPS-SKNPANSAKDGTRNPLKRWRGLGLYWK---EEDAA 353
            +   K+SKLW    ++      P  SK    + +    +  ++W+GL LY     E  A 
Sbjct: 300  LDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAN 359

Query: 354  WDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPP 413
              D  +FDL+ HEYA++T ++KC  + + Y  D PG+VPHGA PT   +DGPDVGN+G P
Sbjct: 360  DLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAP 419

Query: 414  PDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSI 473
            PD+++D+QI G S+ YGPW+  ++  LQ++ SPVVSR ++P+++L PGS+R+YT  R++I
Sbjct: 420  PDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNI 479

Query: 474  LIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATG 533
             I  ++ WRIPTRE SKD EFL+ ++ET +E RPFGW+++   + +   FNI++CPT  G
Sbjct: 480  SITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEG 539

Query: 534  FDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFI 593
            F N   +HFV+ EIR+SVNHDILL ++  ++   +GYPLGWN KA W+ +  S Q + F+
Sbjct: 540  FQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFL 599

Query: 594  LKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXX 653
            L++HITL+ D +SDF +G+PTPYELFRPF Y  NW   GYSIYL                
Sbjct: 600  LREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNE 659

Query: 654  XCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVG 713
             CYLS HGD L ++  VP+E+I G  T I+YE+ TP+FR+ +NTP WNTL+EFMK KEVG
Sbjct: 660  NCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVG 719

Query: 714  RSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHF 773
            R+ +F++ G+YL +S+LD+DN+DT++IEC S ST L CYG+V+RY   VKMNYFG+F +F
Sbjct: 720  RAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNF 779

Query: 774  KTTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSS-QREQHIKDPLTAKKTSLKRM 832
             T+EEY   L   +    TT  S  ++        ++SS +     K P+  K++ LKR 
Sbjct: 780  VTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPM--KRSDLKRT 837

Query: 833  VNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIR 892
             NE D+WFTF V +G  ILPE +Y  D C AL F  L +D R  NYYMD+ A L    I+
Sbjct: 838  TNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIK 897

Query: 893  RLIDCGCEEVFEQKGR-ALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLD 951
            R +     EVF+   R     E   G LS L IH HRM+GLPP E TYFC+WD +LG L 
Sbjct: 898  RHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLS 957

Query: 952  LSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDET 1011
            + SD+ F  GF +++ K+GFG+ D ENI+ Y    I DMTS+T+  + I    +    ++
Sbjct: 958  IDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKS 1017

Query: 1012 AIQLNAQDISAKFADLENSLYSSRVDLDVANLTASI--IDKNKSNKAIASFMTSIKISNF 1069
               ++A+ I     D EN  YS R+D+ V  L  S+  +  +  + +   F T ++ +NF
Sbjct: 1018 QSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNF 1077

Query: 1070 CQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVP 1129
             Q +D+     +Q+ +I  +D+P+HRC FL+PL  Q+S  Y+ L+G I P  SIP+L +P
Sbjct: 1078 EQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLP 1137

Query: 1130 LQTENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQP-----ILDDN 1184
               + +  + +          D V  +  + E  N    S  +    ++P       DDN
Sbjct: 1138 TLPDTIDFIIE----------DIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDN 1187

Query: 1185 --TSLSSSFSDPTF------EHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFI 1236
               + SS F    F      E +  VV++    L I P  +    + +EQ + + + Q +
Sbjct: 1188 DEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVL 1247

Query: 1237 DNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLD 1296
            D+IE+ +V     +     +  NI + +  L+++++   +E       ++     + SL+
Sbjct: 1248 DDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLE 1307

Query: 1297 WSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEA 1356
             +    L          +  +L +++++ + V  K  K    +E D   A    ++  E 
Sbjct: 1308 KNRTTKLL---------EVAALARVKTVRVTVNQK--KNPDLSE-DRPPALSLGLEGFEI 1355

Query: 1357 WSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQE 1416
            WS   G   +SL L S + ++   +  WL  +     N  +++             ++ E
Sbjct: 1356 WSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTE 1415

Query: 1417 FFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLIS 1476
                ++ AS+ YQI+HDP VITKPA+I RL   HVRE+RSWKI+TRLRHIL YLP    +
Sbjct: 1416 LISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQN 1475

Query: 1477 DIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESS- 1535
            +I   LK  +Y   + A+  F+ +FS W NW++SDV + Y+Y ++F+    D   H+ + 
Sbjct: 1476 NIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFST---DNEKHKQNL 1532

Query: 1536 ----TKIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAAEKRSNMSNAEDDLE 1591
                 K   G+F L  +     G    +  N           D      S   N E+ +E
Sbjct: 1533 IKKLLKCTMGSFYLTVY-----GEGYEVEHNFVVADA-NLVVDLTPPVTSLSLNREETIE 1586

Query: 1592 ERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEK-------LPAFQQYTA- 1643
              ++  I   +   SD    +LL +++L       AAV E++K          F+  T  
Sbjct: 1587 --ITGRIGSVKGKFSD----RLLKLQDLIPLV---AAVGEDDKSDPKTELSKQFRMNTVL 1637

Query: 1644 LVDRCDIQLLCGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWSWFEFGIRHRNTIL 1702
            LVD+ ++QL+    +   ++ G  ++++ EN K   + A S        E  ++H + IL
Sbjct: 1638 LVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIIL 1697

Query: 1703 LDAFSRSSAVGA--HGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFIDSLEESWNNLRL 1760
             +A  R  ++ A    +S K +   ++ +      +  S ++   T I  + ES   ++ 
Sbjct: 1698 GEAQLRDFSILATTEAWSHKPTIL-INNQCADLHFRAMSSTEQTVTAITEIRESALKIK- 1755

Query: 1761 ALGPNTGFLEKPHSAATEKVAPQF-------ALNXXXXXXXXXXXXXXXXXXXKNFKKLT 1813
                     E+       K   QF        L                       K+L 
Sbjct: 1756 ---------ERIKFKPKSKKKSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLD 1806

Query: 1814 LAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDS 1873
            + + +  S+ + ++    D  + S +T +QYL+ S  +I        K   S   V +  
Sbjct: 1807 IYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIK-GGVSKEGYSLINVDISI 1865

Query: 1874 NITKLKLYDPRDITLPLGKD---IAQAKACLASLKSCFGKLNT-KNDKDIMSQGNTKFNF 1929
            ++ KL   +PR I     +D    +Q    L SLKS F   N  K +K + +        
Sbjct: 1866 SMIKLTFSEPRRIVNSFLQDEKLASQGINLLCSLKSLFFSSNIPKKEKQVPA-------L 1918

Query: 1930 SASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAAS 1989
              +W     ++Y G+LIP+ ST ++ EL+ +   +T    TN      +  + G  S  +
Sbjct: 1919 MINWTLDTSISYFGILIPVASTYFVFELHMLLLSLTN---TNNGMLPEETKVTGQFSIEN 1975

Query: 1990 IAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLV 2049
            I FLI +R LP  LS+V+DF++ +   + + +  +S Q+ES +FR+ LSP SL+R+++  
Sbjct: 1976 ILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGA 2035

Query: 2050 NELSRLSELQKRQTV----------GKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIF 2099
            ++L  L     +             GK  +  E+         FRS+ +LSY FC+GW+F
Sbjct: 2036 HKLLDLGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLN------FRSIHILSYKFCIGWLF 2089

Query: 2100 DVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSF 2159
                  +PGL+ GY RLF+A+E+ +GK T++D++FS+A G+TS  F++  N  +  NRSF
Sbjct: 2090 QYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSF 2149

Query: 2160 LPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDP 2219
            LP+MQI YW +  G   + F R +GE LDV F+   +DV    ++S+  F ELK+  +D 
Sbjct: 2150 LPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDV 2209

Query: 2220 FKS--------VANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAG 2271
             ++         A     +A S+ + F  L+ I+ V+   +Y GGVFR+Y+ +D++ ++ 
Sbjct: 2210 SENSHSEDSNIYAASSVENAPSSLAPF--LNNIRSVNSNFKYDGGVFRVYTYEDIEAKSE 2267

Query: 2272 PSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLL 2331
            PSF+++SP V I   Y+        H +R  + V  +HNT++  C P+L E +  +++++
Sbjct: 2268 PSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMI 2327

Query: 2332 KGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEK 2391
            K  + + ++ +    S +++DY+  L   D++  +   KQQ+S SCEPKAKVQAD+GFE 
Sbjct: 2328 KK-HSTDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFES 2386

Query: 2392 LAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHT 2451
                V TN+ D   PL  S+ +    A  +HIFSREVSTS ++  +    + THPD I  
Sbjct: 2387 FLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISM 2446

Query: 2452 YGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDS------EHSRALTSEEKP 2505
            YGI  + +++V+FN+KQLQ+L +F++IW+  S + T+P   S       HS   TS    
Sbjct: 2447 YGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSH--- 2503

Query: 2506 LVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLS 2565
                   V   T  PW F LI + + GD+DLG SLGV+SL T R W  TDHY +  Q L 
Sbjct: 2504 -------VDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLH 2556

Query: 2566 LQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDY 2625
               + I L+S+GRL G   + N SW+S ++W   +G    PLV+  + +D+  +K +FDY
Sbjct: 2557 AFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDY 2616

Query: 2626 HLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRM 2685
            H+ LI ++  +  +L N++D +G+  +LL V+ SS+   L  TAL  ANILD+YNTI+RM
Sbjct: 2617 HMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRM 2676

Query: 2686 RKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDME 2745
            R+DN+ SY ETL DSN  ++R     KDIL SL  LRT+L VS+  + +QI P  LFD+E
Sbjct: 2677 RQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVE 2736

Query: 2746 VLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHA 2805
            VL  +      +S+    +KLKT L+ Q+  V  ALS  K +L E+  + I + +Y+ +A
Sbjct: 2737 VLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYA 2796

Query: 2806 RKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATH 2865
             K  GGTI+ IP + + MTT  +  TN +E L++ SF  KI +RWNLG +NF++EMW TH
Sbjct: 2797 SKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTH 2856

Query: 2866 VRAMALRRSHNGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPP 2925
            V+A+A+RRS          +E LEE +   +   ++ Y+ LEEP IE+PQ +DLG+ATPP
Sbjct: 2857 VKALAVRRSQIANISFGQTEEELEESINKEETASKFNYIALEEPQIEVPQIRDLGDATPP 2916

Query: 2926 VEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARIL 2963
            +EWFGVNRK+FP  THQ  ++P+QKL ++AE ++ +IL
Sbjct: 2917 MEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 1919 bits (4970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1078/3053 (35%), Positives = 1687/3053 (55%), Gaps = 193/3053 (6%)

Query: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61
             SQ + V L+  +DFSWVFLVDW+L +   L   FY GR++ Y ++F+LEWL WKR K+K
Sbjct: 4    VSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAKIK 63

Query: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKS 121
            I++++L+IS LGGRI+FK+L+V+ ++ T S L+GS+TW+YWLLN RK    +  +N    
Sbjct: 64   INVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNSSGK 123

Query: 122  VEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS--DKNTDECSV 179
              +LPC+F +EC+GLE+FIYN+T A+DN++N L +++ ++F+ +  ++S  +  +D  S 
Sbjct: 124  NIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSA 183

Query: 180  DEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPD--STPPFLKLLPLEYSVQKGAVVIGN 237
            D+        L             +NDR +Q  +    P  L   P+E  + +G++++GN
Sbjct: 184  DK----LDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGN 239

Query: 238  KTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSF 297
            K + SVM+LSYE  +G++D   P  ++DLY+ K   E + F IS+K N+  +    LK  
Sbjct: 240  KFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFK 299

Query: 298  VKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWD-- 355
            +   K+SKLW    ++      P        A        ++W+GL LY      A    
Sbjct: 300  LDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYKASAGDAKTSD 359

Query: 356  -DRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPP 414
             D  +FD + HEYA++T ++KC  + L Y  D PG+VPHGA PT   +DGPDVGN+G PP
Sbjct: 360  LDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 419

Query: 415  DYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSIL 474
            D+++D+QI G S+ YGPW+  ++  LQ++ SPVVSR ++P+++L PGS+R+YT  R++IL
Sbjct: 420  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIL 479

Query: 475  IVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGF 534
            I+ ++ WRIPTRE+SKD EFL+ +++T +E RPFGW+++   + +   FNI++CPT  GF
Sbjct: 480  IMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 539

Query: 535  DNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFIL 594
             N   +HFV+ EIR+SVNHDILL ++   +   +GYPLGWN    W+ +  S Q + F+L
Sbjct: 540  KNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLL 599

Query: 595  KDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXXX 654
            ++HITL+ D +SDF +G+PTPYELFRPF Y  NW   GYSIYL                 
Sbjct: 600  REHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNEN 659

Query: 655  CYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGR 714
            CYLS HGD L ++  VP+E+I G  T ++YE+ TP+FR+ +NTP WNTL+EFMK KEVGR
Sbjct: 660  CYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 719

Query: 715  SANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFK 774
            S +F++ G YL +S+LD+DN+D++ I C S ST L CYG+V+RY + VKMNYFG+F +F 
Sbjct: 720  SYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFV 779

Query: 775  TTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVN 834
            T+EEY   L         T  S  ++        ++ S +    +D    K++ LKR  N
Sbjct: 780  TSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKND-AEDNGPMKRSDLKRTTN 838

Query: 835  EKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRL 894
            E D+WFTF V +G  ILPE +Y  D C AL F  L +D R  NYYMD+ A L+   I+R 
Sbjct: 839  ETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRH 898

Query: 895  IDCGCEEVFEQKGRA-LCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLS 953
            +     EVF+   R     E   G LS L IH HRM+GLPP E TYFC+WD +LG L+++
Sbjct: 899  VSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNIN 958

Query: 954  SDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAI-VFCTDKIKDETA 1012
            SD+ F  GF  ++ K+GFG+ D ENI+ Y    I DMTS+T+  + I +   D +    +
Sbjct: 959  SDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQS 1018

Query: 1013 IQLNAQDISAKFADLENSLYSSRVDLDVANLTASI--IDKNKSNKAIASFMTSIKISNFC 1070
            I ++ + +     D EN  YS R+D+ V  LT S+  +  + +N +  +F T ++ +NF 
Sbjct: 1019 I-VSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFG 1077

Query: 1071 QLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPL 1130
            Q +D      +Q+ +I  ND+P+HRCPFL+PL  Q+S  Y+ L+G I P  SIP+L +P 
Sbjct: 1078 QYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPT 1137

Query: 1131 QTENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSSS 1190
              + +  + +  +  E A+   ++   P  ++  +  S+++  +       D+  +    
Sbjct: 1138 LPDTIDYIIEDIV-GEYAT--LLEATNPFKDLFAETPSTVEPLRASFTEDDDEEAADPLE 1194

Query: 1191 FSDPTF------EHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVV 1244
            F    F      E +  V+++    L I P  +    + +EQ + + + Q +D+IE+ +V
Sbjct: 1195 FKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIV 1254

Query: 1245 LHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWS-LKKGL 1303
                 +     +  NI + +  L+++++   +E       ++    ++ SL+ +   K L
Sbjct: 1255 KRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSL 1314

Query: 1304 KLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGI 1363
            ++            L K++++   V  K  K  + +E D   A    ++  E WS     
Sbjct: 1315 EV----------AVLAKVKTVRATVNQK--KNPELSE-DRPPALSLGLEGFEVWSSTEDR 1361

Query: 1364 ADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISK 1423
              +SL L S + ++   +  WL ++     N  +++   ++         + E   +++ 
Sbjct: 1362 QVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTA 1421

Query: 1424 ASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLK 1483
            AS+ YQI+HDP VITKPA+I RL   HVRE+RSWKI+TRLRHIL YLP    ++I   LK
Sbjct: 1422 ASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLK 1481

Query: 1484 NSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESST-----KI 1538
              +Y     A+  F+ +FS W NW++SDV + Y+Y ++F   L D   H+ ++     K 
Sbjct: 1482 ERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLF---LADHAKHKGNSIKKLLKC 1538

Query: 1539 ETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAAEKRSNMSNAEDDLEERLSCII 1598
              G+F L  +     G    +  N           D      S  SN E+ +E  ++  +
Sbjct: 1539 TMGSFYLTVY-----GEGYEVEHNFVVADA-NLVVDLTPPVTSLSSNREETIE--ITGKV 1590

Query: 1599 NKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEKL-------PAFQQYTAL-VDRCDI 1650
               +   SD    KLL +++L        AV E++K          F+  T L VD+ +I
Sbjct: 1591 GSVKGKFSD----KLLKLQDLIPLVV---AVTEDDKSDPKAELSKQFKMNTVLLVDKSEI 1643

Query: 1651 QLLCGANRANLKSFGNTLTIVREN----------------KSE----------------D 1678
            Q++    +   ++ G  ++++ EN                KSE                D
Sbjct: 1644 QVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCD 1703

Query: 1679 ADAFSTAFAWSWFEFGIRHRNTILL-----DAFSRSSAVGAHGFSGKNSRRKLDLRAKKF 1733
                +T  AWS       H+ TIL+     D   R+ +      +     ++  L+ K+ 
Sbjct: 1704 FSILATTEAWS-------HKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKE- 1755

Query: 1734 RLKLPSESKHYCTFIDS-----LEESWNNLRLALGPNTGFLEKPHSAATEKVAPQFALNX 1788
            ++K   +SK+   F+ S     L   ++N+   + P + F  + H A             
Sbjct: 1756 QIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIR-HEA------------- 1801

Query: 1789 XXXXXXXXXXXXXXXXXXKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKIS 1848
                                 K+L + + +  S+ + L+    D  + S +T +QYL+ S
Sbjct: 1802 ---------------------KQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFS 1840

Query: 1849 QSNISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCF 1908
              +I       K+   S   V +  ++ KL   +PR I     +D   A   +  L S  
Sbjct: 1841 FGDIEIKGGFSKEA-YSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLN 1899

Query: 1909 GKLNTKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADE 1968
                T +  +   +   K     +W     ++Y G+L+P+ ST ++ EL+ +   +T   
Sbjct: 1900 SLFLTTDPMNAKKETPAKM---INWTLDTNISYFGILVPVASTYFVFELHMLLLSLTN-- 1954

Query: 1969 FTNKASENSQGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQI 2028
             TN      Q  L G LS  +I FLI +R LP  LS+++DF++ +   + + +  +S Q+
Sbjct: 1955 -TNNGLLPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQV 2013

Query: 2029 ESPYFRIALSPFSLVRILFLVNELSRLSELQKRQTVGKL------------PESVEVRET 2076
            ES +FR+ LSP SL+R+++   +L  + +   ++    +            P+ + +   
Sbjct: 2014 ESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPIN-- 2071

Query: 2077 FRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSI 2136
                  FRS+ +LSY FC+GW+F      +PGL++GY RLF+A+EK +GK T++DA+FS+
Sbjct: 2072 ------FRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSV 2125

Query: 2137 AEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSI 2196
            + G+TS  F++  N  E  NRSFLP+MQI YW +  G   + F R +GE LDV FL   +
Sbjct: 2126 SNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFM 2185

Query: 2197 DVAGGLMKSLNMFDELKKQYVD-PFKSVANPKRPSAT-----STFSKFPGLSTIQRVDCK 2250
            DV    ++S+  F ELKK  +D P +S      P A      ++ S  P L  I+ V+C 
Sbjct: 2186 DVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCN 2245

Query: 2251 VQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHN 2310
             +Y GGVFR+Y+ DD++ ++ PSF+L+SP V I   Y+        H +R  + V  +HN
Sbjct: 2246 FKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHN 2305

Query: 2311 TIFPTCVPVLNEMARDIRQLLKGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGK 2370
            T++  C P+L E +  ++ ++K  +   ++ +    S +++DY+  L   D++  +   K
Sbjct: 2306 TLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAK 2365

Query: 2371 QQISFSCEPKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVST 2430
            QQ+S SCEPKAKVQAD+GFE     + TN+ D  +PL  S+ + +  A  +HIFSREVST
Sbjct: 2366 QQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVST 2425

Query: 2431 SIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPE 2490
            S ++  +    + THPD I  YG   + ++ V+FN+KQLQ+L +F++IW+  S + T+P 
Sbjct: 2426 SFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPT 2485

Query: 2491 LDSEHSRALTSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRI 2550
                +     S     ++    V   T  PW F LI + + GD+DLG SLGV+SL + R 
Sbjct: 2486 QRPNNKEVNMST----LSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRT 2541

Query: 2551 WAITDHYSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTL 2610
            W  TDHY +  Q L    + I L+S+GRL G   + N SW+S ++WP+       PLV+ 
Sbjct: 2542 WLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVST 2601

Query: 2611 DVLLDEFDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTAL 2670
             + +D+  +K +FDYH+ LI ++  ++  L N++D +GI  +LL V+ SS+   L  TAL
Sbjct: 2602 SLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTAL 2661

Query: 2671 APANILDVYNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLK 2730
              ANILD+YNTI+RMR+DN+ SY ETL DSN  +++     KDIL SL  LRT+L V++ 
Sbjct: 2662 VAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNIS 2721

Query: 2731 FVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHE 2790
             + +QI P  LFD+EVL  +      +S+    +KLKT L+ Q+  V  ALS  K +L E
Sbjct: 2722 SLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDE 2781

Query: 2791 KAASQIGVKEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRW 2850
            +  + I + +Y+ +A K  GGTI+ IP + + MTT  +  TN +E L++ SF  KI +RW
Sbjct: 2782 EIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRW 2841

Query: 2851 NLGSINFLREMWATHVRAMALRRSHNGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPH 2910
            NLG INF++EMW THV+A+A+RRS          +E LEE ++  +   ++ Y+ LEEP 
Sbjct: 2842 NLGPINFIKEMWTTHVKALAVRRSQTANISFGQTEEELEESIKREENASKFNYIALEEPQ 2901

Query: 2911 IEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARIL 2963
            IE+PQ +DLGEATPP+EWFGVNRK+ P  THQ  ++P+QKL ++AE ++ +IL
Sbjct: 2902 IEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 1914 bits (4959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1078/3021 (35%), Positives = 1684/3021 (55%), Gaps = 130/3021 (4%)

Query: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62
            SQ + V L+  +DFSWVFLVDW+L + + L   FY GR++ Y +TF+LEWL WKR  +KI
Sbjct: 5    SQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRANIKI 64

Query: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKSV 122
            ++++L++S LGGRI FK+L+V+ ++ T S L+GS+TW+YWLLN RK    + +++     
Sbjct: 65   NVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDSLSKN 124

Query: 123  EKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS--DKNTDECSVD 180
             KLPC+F +EC+GLE FIYN+T A+DN++N L +++ ++F+ +  ++S  +  +D  S D
Sbjct: 125  VKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDGSSAD 184

Query: 181  EDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPD--STPPFLKLLPLEYSVQKGAVVIGNK 238
            +        L             +NDR +Q  D    P FLK LP+E    +G++++GNK
Sbjct: 185  K----LDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK 240

Query: 239  TSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFV 298
             + SVM+LSYE  +GV+D   P  ++DLY+ K + EF+ F IS+K N+  +    LK  +
Sbjct: 241  FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300

Query: 299  KRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP--LKRWRGLGLYWKEEDAAWD- 355
               K+SKLW +++    +  +    +  N  K G  +    ++W+GL LY      A   
Sbjct: 301  DTGKVSKLW-KTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLYKAAPGDAKPS 359

Query: 356  --DRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPP 413
              D  +FD + HEYA++T ++KC  + + Y  D  G VPHGA PT   +DGPDVGN+G P
Sbjct: 360  DLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAP 419

Query: 414  PDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSI 473
            PD+++D+QI G S+ YGPW+  ++  LQ++ SPVVSR S+PV++L PGS+RIYT  R+++
Sbjct: 420  PDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNV 479

Query: 474  LIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATG 533
            LI+ ++ WRIPTRE SKD EFL+ ++ET +E RPFGW+++   + +   FN+ +CPT  G
Sbjct: 480  LIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEG 539

Query: 534  FDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFI 593
            F N   +HFV+ EIR+SVNHDILL ++  ++   +GYPLGWN KA W+ +  S Q + F+
Sbjct: 540  FQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFL 599

Query: 594  LKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXX 653
            L++HITL+ D +SDF +GEPTPYELFRPF Y  NW   GYSIYL                
Sbjct: 600  LREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNE 659

Query: 654  XCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVG 713
             CYLS HGD L ++  VP+E+I G  T I+YE+ TP+FR+ +NTP WNTL+EFMK KEVG
Sbjct: 660  NCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVG 719

Query: 714  RSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHF 773
            R+ +F++ GSYL +S+LD+DN+DT++IEC S ST L CYG+V+RY   VKMNYFG+F +F
Sbjct: 720  RAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNF 779

Query: 774  KTTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSS-QREQHIKDPLTAKKTSLKRM 832
             T+EEY   L         T  S  ++        ++SS + E   KDP+  K++ LKR 
Sbjct: 780  VTSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPV--KRSDLKRT 837

Query: 833  VNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIR 892
             NE D+WFTF V +G  ILPE +Y  D C AL F  L +D R  NYYMD+ A L+   I+
Sbjct: 838  TNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIK 897

Query: 893  RLIDCGCEEVFEQKGR-ALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLD 951
            R +     EVF+   R     E   G LS L IH HRMFGLPP E TYFC+WD +LG L 
Sbjct: 898  RHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLT 957

Query: 952  LSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDET 1011
            + SD+ F  GF N++ K+GFG+ D ENI+ Y    + DMTS+T+  + I    +    ++
Sbjct: 958  IDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKS 1017

Query: 1012 AIQLNAQDISAKFADLENSLYSSRVDLDVANLTASI--IDKNKSNKAIASFMTSIKISNF 1069
               + A+ +     D EN  YS R+D+ +  L  S+  +  +  + +   F T ++ +NF
Sbjct: 1018 QSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNF 1077

Query: 1070 CQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVP 1129
             Q +D+     +Q+ +I ++D+P+HRCPFL+PL  Q+S  Y+ L+G I P  SIP+L +P
Sbjct: 1078 EQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLP 1137

Query: 1130 -------LQTENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILD 1182
                      E++   +   L+  N  KD      P     ++ SS+  D   +  P+  
Sbjct: 1138 TLPDTIDFIIEDIVGEYATLLETTNPFKDIFAE-TPSTVEPSRASSTEDDNDERADPLEF 1196

Query: 1183 DNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELD 1242
               + +        +    V+++    L + P  +    + +++ + + + Q +D+IE+ 
Sbjct: 1197 KPIAFTEG---RNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIG 1253

Query: 1243 VVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKG 1302
            +V     +     +  NI V +  ++++++   +E       ++    ++ SL+ +    
Sbjct: 1254 IVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSK 1313

Query: 1303 LKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNG 1362
            L          +  +L +I+++ + V  K  +    +E D   A    ++  E WS    
Sbjct: 1314 LL---------EVATLARIKTVRVTVNQK--RNPDLSE-DRPPALSLGLEGFEVWSSTED 1361

Query: 1363 IADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRIS 1422
               +SL L S + ++   +  WL ++     N  ++ +N           ++ E   +++
Sbjct: 1362 RQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLT 1421

Query: 1423 KASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDL 1482
             AS+ YQI+HDP VITKPA+I RL   HVRE+RSWKI+TRLRHIL YLP     +I   L
Sbjct: 1422 AASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVL 1481

Query: 1483 KNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESS-----TK 1537
            K  +Y     A+  F+ +FS W NW++SDV + Y+Y ++F+    D   H+ +      K
Sbjct: 1482 KERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSV---DNAEHKQNLMKKLLK 1538

Query: 1538 IETGTFMLNFFDSINTGSDSVIL--KNLKAQRT-----LEACKDEAAEKRSNMSNAEDDL 1590
               G+F L  +        + ++   NL    T     L   ++E  E    + + +   
Sbjct: 1539 CTMGSFYLTVYGEGYEVEHNFVIADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKF 1598

Query: 1591 EERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEKLPAFQQY----TALVD 1646
             +RL        + L D  LI L++        A     K + K    +Q+      LVD
Sbjct: 1599 SDRL--------LKLQD--LIPLVA--------AVGGGDKSDAKAELSKQFKMNTVLLVD 1640

Query: 1647 RCDIQLLCGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWSWFEFGIRHRNTILLDA 1705
            + +IQL+    +   ++ G  ++++ EN K   + A S        E  ++H + IL +A
Sbjct: 1641 KSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEA 1700

Query: 1706 FSRSSAVGA--HGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFIDSLEESWNNLRLALG 1763
              R  ++ A    +S K +   ++ +      +  S ++   T I  + ES     L + 
Sbjct: 1701 QLRDFSILATTEAWSHKPTIL-INNQCADLHFRAMSTTEQTVTVITEIRES----VLKIK 1755

Query: 1764 PNTGFLEKPHSAA-TEKVAPQ--FALNXXXXXXXXXXXXXXXXXXXKNFKKLTLAYEQSA 1820
                F  KP S   ++ V P+    L+                      K+L + + +  
Sbjct: 1756 DRIKF--KPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFG 1813

Query: 1821 SSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDSNITKLKL 1880
            S+ + L+    D  + S +T +QYL+ S  +I        K + S   V +  ++ KL  
Sbjct: 1814 SNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIK-GGISKEDYSLINVDISISMIKLTF 1872

Query: 1881 YDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLN 1940
             +PR I     +D   A   +  L S    L T        +         +W     + 
Sbjct: 1873 SEPRRIVNSFLQDEKLASQGINLLSSLKSLLFTSGLPKKKKKKAPARMI--NWTLDTSIT 1930

Query: 1941 YVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLP 2000
            Y G+L+P+ ST ++ EL+ +   +T    TN      +  + G  S  +I FLI +R LP
Sbjct: 1931 YFGILVPVASTYFVFELHMLLLSLTN---TNNGMLPEEAKVTGQFSIENILFLIKERSLP 1987

Query: 2001 EALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQK 2060
              LS+++DF++ +   + + +  +S Q+ES +FR+ LSP SL+R+++  ++L  L     
Sbjct: 1988 IGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYS 2047

Query: 2061 RQTVGKL------------PESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPG 2108
            R+    +            P+ + +         FRS+ +LSY FC+GW+F      +PG
Sbjct: 2048 RRHAPNIWDIKMFTGKSDKPKEIPIN--------FRSIHILSYKFCIGWLFQYGAGSDPG 2099

Query: 2109 LIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYW 2168
            L+ GY RLF+A+EK +GK T++DA+FS+A G+ S  F++  N  +  NRSFLP+MQI YW
Sbjct: 2100 LMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYW 2159

Query: 2169 IESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFK-SVANPK 2227
             +  G   + F R +GE LDV F+   +DV    ++S+  F ELKK  +D  + S     
Sbjct: 2160 FKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDD 2219

Query: 2228 RPSATSTF-----SKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSVE 2282
             P ATS+      S  P L  I+ V+   +Y GGVFR+Y+ DD++ ++ PSF+++SP V 
Sbjct: 2220 NPYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVT 2279

Query: 2283 ILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQEAS 2342
            I   Y+   +    H +R  + V  + NT++  C P+L E +  +++++K  +   + + 
Sbjct: 2280 INCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSF 2339

Query: 2343 HKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLD 2402
             K  SQ ++DY+  L   D++  +   KQQ+S SCEPKAKVQAD+GFE     + TN+ D
Sbjct: 2340 TKPSSQ-NVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFD 2398

Query: 2403 MSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDV 2462
              +PL  S+ + +  A  RHIFSREVSTS ++  +    + THPD I  YG   + ++ V
Sbjct: 2399 SEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSV 2458

Query: 2463 YFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFPWN 2522
            +FN+KQLQ+L +F++IW+  S + T+P   S       S     +     V      PW 
Sbjct: 2459 FFNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSS----LTSTNYVDVGAEIPWC 2514

Query: 2523 FILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGT 2582
            F LI + + GD+DLG SLGV+SL T R W  TDHYS+  Q L    + + L+S+GRL G 
Sbjct: 2515 FTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGL 2574

Query: 2583 LLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFN 2642
              + N SW+S ++W + +     PLV+  + +D+  +K +FDYH+ LI ++  ++ +L N
Sbjct: 2575 FEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHN 2634

Query: 2643 KRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNT 2702
            ++D +GI  +LL V+ SS+   L  TAL  ANILD+YNTI+RMR+DN+ SY ETL DSN 
Sbjct: 2635 EKDAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNP 2694

Query: 2703 KDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEG 2762
             +++     KDIL SL  LRT+L +++  + +QI P  LFD+EVL  + K+   +S+   
Sbjct: 2695 GESKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHS 2754

Query: 2763 DEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIG 2822
             +KLKT L+ Q+  V  ALS  K +L E+  + I + +YI +A K  GGTI+ IP + + 
Sbjct: 2755 GKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVH 2814

Query: 2823 MTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGF 2882
            MTT  +  TN +E L++ SF  KI ++WNLG +NF++EMW THV+A+A+R+S        
Sbjct: 2815 MTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFG 2874

Query: 2883 FEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQ 2942
              +E LEE ++  +   ++ Y+ LEEP I++PQ +DLG+ATPP+EWFGVNRK+FP  THQ
Sbjct: 2875 QTEEELEESIKTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQ 2934

Query: 2943 AMIVPLQKLAHIAETEWARIL 2963
              ++P+QKL ++AE ++ +IL
Sbjct: 2935 TAVIPVQKLVYLAEKQYVKIL 2955

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 1906 bits (4937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1090/3022 (36%), Positives = 1723/3022 (57%), Gaps = 131/3022 (4%)

Query: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62
            SQF+R+ L+  +DFSWVFLVDW+LIL V+L   FY  R   Y ++F+LEW  WKR  VKI
Sbjct: 5    SQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRSNVKI 64

Query: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFA------KASE 116
            +I+S++IS LGGR+FFKN+ ++ Q+ T SFL+ ++TWRYWLLN RK+ +       KAS 
Sbjct: 65   NIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPDKASA 124

Query: 117  NIDKSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTDE 176
            N   SV KLPCRF +E +GLE F+YN+  A+DNI+    +E+  +F+ F  +    ++  
Sbjct: 125  N---SV-KLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKA 180

Query: 177  CSVDEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPDST-PPFLKLLPLEYSVQKGAVVI 235
               + +S  +    E             NDR FQ   S  P FL  LP+++ V  G+++I
Sbjct: 181  EVSNSESNSEEDTFESAGTFKSDSSTT-NDRVFQEELSERPQFLDFLPIDFKVSHGSLII 239

Query: 236  GNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLK 295
            GNK + S+M+ S     G++D C P  K+DLYK++   +F+ F I +K N+    E  +K
Sbjct: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299

Query: 296  SFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPL-KRWRGLGLYWKE---ED 351
              + R+++SK+W +  ++     S    +   S K    +P  ++WRGL LY      + 
Sbjct: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKS 359

Query: 352  AAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSG 411
                +   FD + HEYA+++ +++    +  +  D PGIVPHGA PT    DGPDVGNSG
Sbjct: 360  NDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSG 419

Query: 412  PPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRL 471
             PP++S++IQISG S+ +GPW+  ++  L +L SP+ SR+++P ++LTPG  RIYT+ + 
Sbjct: 420  APPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKT 479

Query: 472  SILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTA 531
            +I    E+ WRIPTRE+SKD EFL+ +RET +E RPFGW+++  S+ + +   +A CPT 
Sbjct: 480  TISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTK 539

Query: 532  TGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQI 591
             GF NTLD+H    EIR+SVNHDILL  ++ +    +G+PLGWN++A W  D  S Q + 
Sbjct: 540  EGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEA 599

Query: 592  FILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXXXXXX 651
            FIL++HITL+ D ++DF SGEPTPYELFRPF Y  NW   GYS+YL              
Sbjct: 600  FILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDF 659

Query: 652  XXXCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKE 711
               CYLSFHGD L+++  VP+  ++   T+++Y ++TP+FRL +NTP WNTL+EFMK+KE
Sbjct: 660  NENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKE 719

Query: 712  VGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFV 771
            VGRS +F ++GSYL +S+LD+DN+DTIIIEC S+ST L+CYG+V+RY   VKMNYFGDF 
Sbjct: 720  VGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFF 779

Query: 772  HFKTTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMD--EDSSQREQHIKDPLTAKKTSL 829
            HF T+EEY  E+R      + T     E + +    +  E SS R++   D    K++ L
Sbjct: 780  HFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSVRKEQTGDS-KIKRSDL 838

Query: 830  KRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPL 889
            KR  NE D+WFTF V +G  +LPE +Y+CD C  L F  L ID R  NYYMD+ A+++ +
Sbjct: 839  KRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDI 898

Query: 890  RIRRLIDCGCEEVFEQ-KGRALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLG 948
             +RR I     E++E  +    CG    G LS + IH HRM+GLPP E TYFC+WDFSLG
Sbjct: 899  SLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLG 958

Query: 949  TLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIK 1008
            TLDL+ D+ F  GFI ++ K+ FG  D ENI+ Y+   I DMTS+T+ +  I     + +
Sbjct: 959  TLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESE 1018

Query: 1009 DETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASIIDKNKSNK-AIASFMTSIKIS 1067
             +T +   A+++     + EN  Y +R+DL +      +   N + K  +  F T + +S
Sbjct: 1019 MDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLFEFETKVNLS 1078

Query: 1068 NFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSL- 1126
            NF +  D+  H  +Q+ +I  +DAP+HRC F++P +LQ+S  Y+ LFG I P  S+P L 
Sbjct: 1079 NFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSLPPLP 1138

Query: 1127 ------AVPLQTENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKG--QLQ 1178
                   +    +++   F   L++EN    F   + P    K  N     D +   +L 
Sbjct: 1139 IPLLPATIDYIVDDLLGCFPEILESENP---FRIPFSPATSPKLGNPFEGSDTESDEELD 1195

Query: 1179 PILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDN 1238
            P+        +S    TF  +  V+++    LSI+P  +  + N  E    + I Q +D+
Sbjct: 1196 PL---EFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDD 1252

Query: 1239 IELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWS 1298
            IE+ +V H   +    +  +NI++ +  LD+ +   +++N       + +  +++ L+  
Sbjct: 1253 IEIGIVNHLSDLQEGIETARNIKLQILYLDLFWG--DRQN-----AGISLYLDRIDLEMC 1305

Query: 1299 LKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDEN-IAFGCSVKELEAW 1357
             K  +    ++    + T L KI S    V   +++ +   + DE   A    ++  E W
Sbjct: 1306 QK--MLEENNETKITEVTFLNKIRS----VRATINEASSVGKADERPPALSLVIEGSEIW 1359

Query: 1358 SYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEF 1417
            S +     +SL + S + ++   + +WL  ++ K    S+++ + L           ++ 
Sbjct: 1360 SCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQL 1419

Query: 1418 FYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPT---TL 1474
              +++ AS+ YQI+HDP VITKPA+ITRL   HVRE+RSWKI+TRLRHIL YLP     +
Sbjct: 1420 VSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRV 1479

Query: 1475 ISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFT--NTLDDTVAH 1532
            I ++ N   +   P    A   F+ +FSNW NW++SD+ + Y+YR +F+  ++     + 
Sbjct: 1480 IDEMRNQQDSHTLPDPGNA---FISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSM 1536

Query: 1533 ESSTKIETGTFMLNFFDSINTGSDS----VILKNLKAQRTLEACKDEA--AEKRSNMSNA 1586
            E+S K++  +    FF   +TG +     ++ +      TL A  D +   EK  N++ +
Sbjct: 1537 ENSIKLKLASL---FFTVYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGS 1593

Query: 1587 EDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEK-----LPAFQ-Q 1640
               ++ + S                KL+++++L        ++K+N K     L  F+  
Sbjct: 1594 LGTIKGKTSH---------------KLINLKKLLP----ELSMKKNLKPSTPFLRCFKLN 1634

Query: 1641 YTALVDRCDIQLLCGANRANLKSFGNTLTIVRENKSEDAD-AFSTAFAWSWFEFGIRHRN 1699
               L +R ++Q + GA++   + FG  L+++ E+  + A  A S        E  ++H N
Sbjct: 1635 MLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHN 1694

Query: 1700 TILLDAFSR--SSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFIDSLEESWNN 1757
             IL ++  R  S  + A  +S K +   ++L+      +  + +      +  + E+   
Sbjct: 1695 IILAESQMREFSIIITAESWSYKPTVL-VNLQCTDIHFRAMTATDVLAKSVGEIIENIKE 1753

Query: 1758 L-RLALGPNTGFLEKPHSAATEKVAPQFALNXXXXXXXXXXXXXXXXXXXKNFKKLTLAY 1816
            L +L    +   +++       +      L                     N K+L + +
Sbjct: 1754 LEKLFYSDSDSGIQQISQYPVMEQKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYF 1813

Query: 1817 EQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPP--TVKLD-- 1872
             +  S+ L L+    D+ + S  T ++Y + S  NI       K N    P  T+ +D  
Sbjct: 1814 NRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQL-----KGNILENPNYTINIDVS 1868

Query: 1873 SNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSAS 1932
            ++I KL L D R +     +D    K  + SL+  F  L     K   +    K   + +
Sbjct: 1869 ASIVKLTLGDIRRLIPSFLQD---EKILIESLEQ-FSSLKLFQRKK-PAPSTEKSGRTVT 1923

Query: 1933 WIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIAF 1992
            W  +  +NY GLL+P+ ST +I EL+ +   ++ ++    +S+     L G  S  ++ F
Sbjct: 1924 WSLESNINYFGLLVPISSTYFILELHML--LMSLNKIQGISSK--YNGLSGQFSIDNVCF 1979

Query: 1993 LINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNE- 2051
            L+ ++ LP  LS+++DF++ +   ++ +   RS QIESP+FR+ LSP SL  +L+  N+ 
Sbjct: 1980 LLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQA 2039

Query: 2052 LSRLSELQKRQTVG--KLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGL 2109
            L+ +   ++  +V   K+        +   +  F S  VLSYNFC+GW+F      EPGL
Sbjct: 2040 LTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDNEPGL 2099

Query: 2110 IWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWI 2169
            I GY RLF+A+EK +GKLTL+DAYFS+A G TSD F++  +  +  NRS+LP+MQI YW+
Sbjct: 2100 IIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWL 2159

Query: 2170 ESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFKSVANPKRP 2229
            +++GL  ++++R +GE LDV FL+  IDV    ++S+  F ELK+  V    + +N K  
Sbjct: 2160 KNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVG---TASNIKEQ 2216

Query: 2230 SATSTFSKF----PGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEILF 2285
            + ++T        P  + I+ ++C+ QY GGVF+++S  +  N   PSF+++SP+V I  
Sbjct: 2217 TQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDM 2276

Query: 2286 DYRRMVHGKHSHI-LRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQEASHK 2344
            +Y+       +   +R  + + S+HNT+F  C P++ E +  I++++K  + S +E S  
Sbjct: 2277 NYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVKR-HSSDREPSGT 2335

Query: 2345 SVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDMS 2404
            ++S++++DY+  L   D++  +   KQ +S  CEP+AKVQAD+GF+     V TND D  
Sbjct: 2336 NISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPE 2395

Query: 2405 EPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVYF 2464
            EPL  ++ + +  A  +HIFSRE STS  +D +    + THP++I+  G   I ++ V+F
Sbjct: 2396 EPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFF 2455

Query: 2465 NIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFPWNFI 2524
            N+KQLQ+L +F++IWK  + + ++P  +   SR   ++ K L +   K + +T  PW F 
Sbjct: 2456 NVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSR---TDLKSLSSVQSKDTDST-IPWCFT 2511

Query: 2525 LIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGTLL 2584
            LI S I GD+DLG +LGVLSL   R W  TDHY    + L    + I L+S GRL G L 
Sbjct: 2512 LIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILE 2571

Query: 2585 LRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFNKR 2644
            L   SW+S + WP+ E + + PLV++ + +D  + K++FDYH+ L+ ++  + + + +++
Sbjct: 2572 LDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEK 2631

Query: 2645 DPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNTKD 2704
            D  GI  +LL V +   + +L  TAL  ANILD+YNT++R+R+DN+ SY ETL +SNT +
Sbjct: 2632 DINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETLKESNTSE 2691

Query: 2705 TRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEGDE 2764
             R A   KDIL SL+ ++T++ V +  ++IQI P  LFD E+L    ++   +S+     
Sbjct: 2692 PRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISARSETHAGN 2751

Query: 2765 KLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIGMT 2824
            KLKT L+ Q++   +ALS  K +L E   + I V++Y+ +A +  GG I+  P +LI MT
Sbjct: 2752 KLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMT 2811

Query: 2825 TWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGFFE 2884
            T+    ++ +E LY+ SFG KI +RWNLG +NF++EMWATHVRAMA+RRS      G   
Sbjct: 2812 TYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVS 2871

Query: 2885 DEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAM 2944
            +E + ++++  +    ++YVPLEEP I++PQ +DLG+ATPP+EWFG+NRK+FP  THQ  
Sbjct: 2872 EEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTA 2931

Query: 2945 IVPLQKLAHIAETEWARILGRA 2966
            ++ +QKL H AE E+  ILG +
Sbjct: 2932 VILVQKLVHTAEKEYGSILGHS 2953

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 1857 bits (4810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1069/3052 (35%), Positives = 1682/3052 (55%), Gaps = 165/3052 (5%)

Query: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61
            ++ F+  SL    +FSWVFLVDW+L + ++L   FY  R F Y +TF+LEWL WK+ KVK
Sbjct: 7    SAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVK 66

Query: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAF-----AKASE 116
            +SI +L+IS L GR+FFKNLT++ +++T + L+GSITWRYWL+ +RK+ +     A AS 
Sbjct: 67   VSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASA 126

Query: 117  NIDKSVE---------------KLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLER 161
                + E               KLPCRF  EC+G E FIYN+T A+DNI+N L + + E+
Sbjct: 127  GSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREK 186

Query: 162  FKDFFQDNS-----DKNTDECSVDEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQ--SPDS 214
            F+ F  +N         + +  ++E S+   S  E             NDR+FQ  +  +
Sbjct: 187  FEKFMAENDFLDPSSDGSSDDKIEETSSATNSTDEETIA---------NDRTFQNDTRKT 237

Query: 215  TPPFLKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNE 274
             P +L+ LP+E  + KG+++IGNK +  V++LS+E    + D     SK+DLY++K    
Sbjct: 238  LPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVR 297

Query: 275  FRKFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTR 334
             +   I +K N+  ++E        + KLS+LWHR  ++F     P   N     +    
Sbjct: 298  LKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSN--RRKEQPHD 355

Query: 335  NPLKRWRGLGLYWKEEDAAWD--DRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVP 392
            N +++W+GL +Y  +    +D  D  +FD+S HEYA++T ++K   + + + +D PG VP
Sbjct: 356  NFMQKWKGLSMYRNDMFGEFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVP 415

Query: 393  HGALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDS 452
            HGA P     DGPDVGN+  PP Y  +I I G ++ YGPW+  +   LQ L SP VSR +
Sbjct: 416  HGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTA 475

Query: 453  QPVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLE 512
            +P+++L PGSKRIYT L+L+I  + +  WRIPTRE+SKD+EFL  ++ET D+ RPFGW++
Sbjct: 476  KPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWID 535

Query: 513  VSLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPL 572
            + +S  S   F++AMCPT+ GF NT+D+  V  EIR+SVNHDI L +++ S +  +GYPL
Sbjct: 536  IKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPL 595

Query: 573  GWNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTG 632
            GWN +A W     SNQ ++F+L++H+TL+ D ++DF SGEP PYELFRPF Y   WN  G
Sbjct: 596  GWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKG 655

Query: 633  YSIYLXXXXXXXXXXXXXXXXXCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFR 692
            YS YL                 CYLS HGDDL +N  VP++ I    T + Y+++TP+FR
Sbjct: 656  YSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFR 715

Query: 693  LNMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCY 752
            L +NTP WNTL+EFM++KEVGRS +F L GSYL +S+LD+DN+DT+ +EC S+ T L  Y
Sbjct: 716  LLLNTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIY 775

Query: 753  GYVLRYFLGVKMNYFGDFVHFKTTEEYMEELRGT---NAVTKTTHDSETEIQEAPKQMDE 809
            G+V+RY + VKMNYFG+F HF T+EEY    R T   N +++   D +    E+  ++  
Sbjct: 776  GFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISS 835

Query: 810  DSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSL 869
            +SS +    K   + KK+ LKR  NE D+WFTF V DG  ILPE +Y+ D C AL F  L
Sbjct: 836  NSSDKNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAEL 895

Query: 870  DIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFE----QKGRALCGELVAGRLSRLHIH 925
             +DLR  NYYMD+ A    + ++R +    +E++E      G+      V G LS ++IH
Sbjct: 896  IVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGK---DHEVHGTLSDIYIH 952

Query: 926  THRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVA 985
             HRM+GLPP E TYFC+WD   G L++ S++ F  G   A+ K+GFG++D ENI+ Y+  
Sbjct: 953  GHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETE 1012

Query: 986  PILDMTSVTLAIDAIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTA 1045
             I DMTS+T+ I+ I    + +       L  +       D EN  YS R+D+ + +L  
Sbjct: 1013 IIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEF 1072

Query: 1046 SIIDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQ 1105
            +I     ++ ++ +F   +  +NF Q QD   H + Q+ +I  NDAP+HRC FL+P + Q
Sbjct: 1073 NIFSNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQ 1132

Query: 1106 NSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRW---FPVNE- 1161
             S  Y  LFG I P  S+P L +PL  + ++ V +  L      +D++  +   + + E 
Sbjct: 1133 KSRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLL------EDYMGLFEGNYDIKES 1186

Query: 1162 -VKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVI 1220
             V+N   S+++  +       +   S   + SD   E +  VV +E+  + I+P  Y  I
Sbjct: 1187 SVENLELSAIEATRAITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTTI 1246

Query: 1221 GNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTY 1280
               ++  + +   Q ID IE+ +V     +        N++V +   ++ +     +N  
Sbjct: 1247 EKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDN-- 1304

Query: 1281 DVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAE 1340
                   V+     +D++L +      S+ +  + T L KI+++ L V   + +      
Sbjct: 1305 -------VSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTV---VQQPGLIPT 1354

Query: 1341 MDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKA---FNDSK 1397
             +   A    V+  E WS       +S+ + S + +V   +  W   ++ +    F D  
Sbjct: 1355 QERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDML 1414

Query: 1398 QLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSW 1457
            Q  NR+        ++++E   R++ AS+ YQI+HDP VITKPA+I RL   HVRE++SW
Sbjct: 1415 QSYNRIQ---NNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSW 1471

Query: 1458 KIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYM 1517
            KI+TRLRHIL YLP     ++   L++ ++ P   A   F+ IFSNW +W++SDV + Y+
Sbjct: 1472 KIITRLRHILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYI 1531

Query: 1518 YRRVFTNTLDDTVAHESST----KIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACK 1573
            Y ++F N  D     + S     K+  G F +  + +      S+++ N K    L    
Sbjct: 1532 YGKLFLN--DHAEKKKQSLQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKL---LLELT 1586

Query: 1574 DEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVK-EN 1632
              + E + N    E+ ++   +  + K ++S     L+KL  +  + T  +E   VK   
Sbjct: 1587 PSSTEPKENSLQREELIDISGTVDVIKGKLSTK---LLKLQKLIPILTEGSEKQPVKPPQ 1643

Query: 1633 EKLP-AFQQYTA-LVDRCDIQLLCGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWS 1689
            + +P  F+   A +V+ CDIQL+  A + N+      ++++ EN +   A A S      
Sbjct: 1644 DTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSK 1703

Query: 1690 WFEFGIRHRNTILLDAFSRSSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTF-- 1747
              E  ++H N++L  A  R S   A   +   ++R   L   K      S S H+ T   
Sbjct: 1704 HTELVLKHINSVL--AEGRVSNFYATFTTDTWAQRPTYLIHSK------SSSIHFRTMAK 1755

Query: 1748 IDSLEESWNNLRLALGPNTGFLE-----KPHSAATEKVAPQFALNXXXXXXXXXXXXXXX 1802
             + L E+  +++L +   +  LE       H    +        +               
Sbjct: 1756 TERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYDPNKSNVIASCLFSNVSMDIMPVSP 1815

Query: 1803 XXXXKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKIS----QSNISFSLHR 1858
                 + K++   Y +  S +  +  +  D  + S +T +QY+++S    Q  ++ S  +
Sbjct: 1816 FALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSK 1875

Query: 1859 PKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKD---IAQAKACLASLKSCFGKLNTKN 1915
            PK  +     + L +N+ KL   +P++I     KD    +++   L +LK  F   + K 
Sbjct: 1876 PKLVD-----INLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKE 1930

Query: 1916 DKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASE 1975
                  Q  T++     W     ++Y G+LIP+ ST Y+ E +   +++++    N A  
Sbjct: 1931 STPQSYQEKTEY----LWSLDSSIDYFGILIPMTSTYYVMEFH---SYVSSISNANGAPS 1983

Query: 1976 NSQGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRI 2035
             +   + G +S  +I FLI +  LP+ LS+V+D AV++   +  ++  RS+Q+ES + RI
Sbjct: 1984 GNLD-ITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARI 2042

Query: 2036 ALSPFSLVRILFLVNELSRLSE-------------LQKRQTVGKLPESVEVRETFRFRRA 2082
             LSP SL+R+L+  N+  +LSE               K     +   S++  ET  F  +
Sbjct: 2043 CLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNET-SFFSS 2101

Query: 2083 FRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTS 2142
              S+  LSYN C+GW+F+    P  GLI GY RLF+A+E   GKLT++D+YF+ A+G+TS
Sbjct: 2102 INSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTS 2161

Query: 2143 DDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGL 2202
              FY   N  E  NR +LP+MQI +W +      ++++R  GE LDV++LS  +      
Sbjct: 2162 STFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIEST 2221

Query: 2203 MKSLNMFDELKKQYV--DPFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRL 2260
            + S+ MF +LKK+ +   P + V + K     ++ +    L  I+ V+C  +Y GG + +
Sbjct: 2222 LHSIKMFQKLKKELIVETPKREVVHIKEDKPVNSSNNI--LKNIKSVNCHFKYDGGTYSV 2279

Query: 2261 YSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVL 2320
            +++ D      P+ +++SP + +   Y+        H +R  + +  +HN ++ TC P++
Sbjct: 2280 FNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLV 2339

Query: 2321 NEMARDIRQLLKGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPK 2380
                 D+R +   +    + +     S +++DY   L   D++  +   KQQ+S SCEPK
Sbjct: 2340 KNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPK 2399

Query: 2381 AKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWI 2440
            AKVQAD+GFE L V + TN  D+ EPL+ S  I +  A  +H+FSRE STS  +  L   
Sbjct: 2400 AKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLT 2459

Query: 2441 FILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALT 2500
             + TH + I+TYG   I +ID+YFN+KQLQ+L +F++IW+            SE    +T
Sbjct: 2460 LLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQL-----------SELLNPVT 2508

Query: 2501 SEEKPLVAKFKK------VSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAIT 2554
            S ++ ++ K KK      + + +  PW F LI + +KGDIDLG SLG++SL   R W  T
Sbjct: 2509 SSQEQVIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLAT 2568

Query: 2555 DHYSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLL 2614
            DH+S   Q L   ++ +LL S+GRL G + +   SW+S + W         PLV L +  
Sbjct: 2569 DHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNT 2628

Query: 2615 DEFDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPAN 2674
            D+ ++K +FDYH+ LI +V  +  +L ++RD  G++ +LL V+ S    +L  TAL  AN
Sbjct: 2629 DKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAAN 2688

Query: 2675 ILDVYNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHI 2734
            ILD+YNTI+RMR+D + SY ETL DSN +  +     +DIL SL  LRT+L VS+  + +
Sbjct: 2689 ILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQL 2748

Query: 2735 QIYPSKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAAS 2794
            QI P  LFD+EV+         +S+   + KL T L  +++   ++LS  K +L E A S
Sbjct: 2749 QISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALS 2808

Query: 2795 QIGVKEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGS 2854
            +I V +Y+ +A K  GGTI+ IP + + MTTW +  ++ +E LYS  F  K+ +RWNLG 
Sbjct: 2809 KITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGP 2868

Query: 2855 INFLREMWATHVRAMALRRSHNGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIP 2914
            +NF++EMW THV+A+A+RRS          ++ +E+++++ +   +  YVP+EEP I++P
Sbjct: 2869 VNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMP 2928

Query: 2915 QTKDLGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966
            Q KDLG+ATPPVEWFGVNRK+FP  THQ  +VP+Q L ++A+ ++A+ LGR+
Sbjct: 2929 QIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 1849 bits (4789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1080/3061 (35%), Positives = 1676/3061 (54%), Gaps = 185/3061 (6%)

Query: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61
            +S+F+ V +S  ++FSWVFL+DW+L++ + L   FY GR   Y  + +LEWL WKR  +K
Sbjct: 4    SSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRAHIK 63

Query: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENID-- 119
            ++I+SL+IS LGGRIFFKN+T++ ++ T S LQG++TWRYWLL +RK ++   S++ +  
Sbjct: 64   VNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDSNGV 123

Query: 120  --KSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDF-----FQDNSDK 172
              K  E+LPCRF + C+G E F+YN+T ++DNI+N   +E+  +F+ F     F D+S  
Sbjct: 124  TMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDHSSY 183

Query: 173  NTDECSVDEDSAGQRSH--------LEXXXXXXXXXXXXLNDRSFQSP--DSTPPFLKLL 222
            ++   +    S G+ +                        NDR F     D    FL+  
Sbjct: 184  SSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFLQTF 243

Query: 223  PLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISL 282
            P+E  V + ++  GNK + S++++S E   G++D C P  K+DLYK+K+  E   F +++
Sbjct: 244  PVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFAVTV 303

Query: 283  KPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP-----L 337
            KPN+  + E  LK  + R KLS+LW R    F       ++    + +   RN      +
Sbjct: 304  KPNIGYKEEMLLKFKIDRGKLSRLWKR----FTPITGIITRPLGLTQRKKKRNEPPDLFI 359

Query: 338  KRWRGLGLYWKE--EDAAWD-DRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHG 394
            ++W+GL LY     E    D D  QFD   HEYA+++ V+KC   +  Y +D PG VPHG
Sbjct: 360  QKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHG 419

Query: 395  ALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQP 454
            A PT   +DGPDVGN+G PP +S+DIQI G S+ YGPW+  ++  +  + +P VSR   P
Sbjct: 420  AHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESP 479

Query: 455  VEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVS 514
            V++  PGS RIYT  +LSI I+ ++ WRI TRE SKD  FLK ++ET D+ RPFGW+++ 
Sbjct: 480  VKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLR 539

Query: 515  LSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGW 574
             S+ S   F  A+ PT  GF N +++H  + EIR+SVNHDIL+  +       + YPL W
Sbjct: 540  FSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVW 599

Query: 575  NKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYS 634
            N +A W  D  SNQ + F+L++HITL+ D ++DF SGEPTPYELFRP     NW    Y 
Sbjct: 600  NDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYF 659

Query: 635  IYLXXXXXXXXXXXXXXXXXCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLN 694
            IYL                 CYLS HGDDL +N  +P E+I     +I Y + TP+FRL 
Sbjct: 660  IYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRLL 719

Query: 695  MNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGY 754
            +NTP WNTL+EFMK KEVGRS +FS  GSYL +S+LDVDN+DTI I C S+ TTL+CYG+
Sbjct: 720  LNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGF 779

Query: 755  VLRYFLGVKMNYFGDFVHFKTTEEYMEELRG----TNAVTKTTHDSETE---IQEAPKQM 807
            V+RY   VKMNYFGDF +F T+EEY    R        ++    D+E       +    M
Sbjct: 780  VIRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSDNEDNGDVYSDGESGM 839

Query: 808  DEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFD 867
            D+  SQ    I +  T K++ L+R  NE D++ TF V DG  ILPE +Y+CD+C AL+F 
Sbjct: 840  DDAISQE---IPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFG 896

Query: 868  SLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFE---QKGRALCGELVAGRLSRLHI 924
             L IDLR  NYYMD+ A+L    + R  +    ++F+      R        G LS L I
Sbjct: 897  ELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRE--SSEAQGFLSDLSI 954

Query: 925  HTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKV 984
            H HRMFGLPP E TYFCKWDF +G L+++S+  F  GF+ ++ ++GFGF+D ENI+ Y  
Sbjct: 955  HGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSK 1014

Query: 985  APILDMTSVTLAIDAIVFCTDKIKDETA---IQLNAQDISAKFADLENSLYSSRVDLDVA 1041
              I DMTS+T+    I   +  +K+E +   + L  Q ++    D E++ YSSR+DL + 
Sbjct: 1015 EVINDMTSLTVNAQEI---SVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIP 1071

Query: 1042 NLTASI--IDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFL 1099
            +L  S+  +D +     + +F T + +++F Q ++   H   Q+ +I  NDA FHR  FL
Sbjct: 1072 SLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFL 1131

Query: 1100 IPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRW--- 1156
            +P + Q    Y  L+G I P  S+P LA+P+  + V  + + +L    +  D  DR    
Sbjct: 1132 LPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLD--DRTIFR 1189

Query: 1157 FPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPEC 1216
             P       N +S    +  + P+   N+++S   ++  ++ + LV+++E   + I+P  
Sbjct: 1190 MPFGSTNTPNQASTHH-EEDMDPLEFSNSTVS---TEKNYQCDNLVIDIEYISVEINPSI 1245

Query: 1217 YEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNK 1276
               I +     +++ I Q ID+IE++ +           +  NI++ +   D+    + +
Sbjct: 1246 STYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIY---WGE 1302

Query: 1277 ENTYDVE---GQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLD 1333
             + Y +E    ++    +Q +++   +KGL          + T L K  S+   +  +  
Sbjct: 1303 RDRYGIELYLDKLDFEMSQRNIEKDREKGLL---------EITMLAKTRSIRASISEEGS 1353

Query: 1334 KKTKFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAF 1393
             K    E +   A    V+  E WS       +S+   S + ++   +  WL  F+ +  
Sbjct: 1354 TKN---EKERPPALSLVVEGCELWSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQN 1410

Query: 1394 NDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRE 1453
             + + +I  L+    +   + ++   +++ A+D YQI+HDP VITKPA+ITRL   HVRE
Sbjct: 1411 QNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRE 1470

Query: 1454 SRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVE 1513
            +RSWKI+TRLRHIL Y+P+   S + N LK      +  A++ F+ +FSNW NW++SDV 
Sbjct: 1471 NRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVA 1530

Query: 1514 KCYMYRRVF-TNTLDDTVAHESST----KIETGTFMLNFFDSINTGSDSVILKNLKAQRT 1568
            + Y+Y R+F TN  +    H+ S     K+   +F L  + +      + +L N      
Sbjct: 1531 RSYIYGRLFLTNQAE---KHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFE 1587

Query: 1569 LEACKDEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAA 1628
                  EA   R  + N        L+  I   + + SD    +LL ++EL         
Sbjct: 1588 QTPPFTEAGVSREKLIN--------LTGSIGSVKGNFSD----ELLRLKELIPL-----L 1630

Query: 1629 VKENEKL---PAFQ----------QYTALVDRCDIQLLCGANRANLKSFGNTLTIVRENK 1675
             KE EK+   P+FQ              L ++ ++QL+ G ++   +     ++++ ++ 
Sbjct: 1631 NKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRILNGKVSLLLDHP 1690

Query: 1676 SED-ADAFSTAFAWSWFEFGIRHRNTILLDAFSRSSAVGA--HGFSGKNSRRKLDLRAKK 1732
             E  + A S        E  I HRNT L++   R  ++ A    +S K +   +  +   
Sbjct: 1691 KEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKPTVL-VSTQCAH 1749

Query: 1733 FRLKLPSESKHYCTFIDSLEESWNNL--------RLALGPNTGFLEKPHSAATEKVAPQF 1784
            F +K  +++      +  + ++  N+        RLA G N    +K      E V    
Sbjct: 1750 FHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPKKKLKDVEIEVVC--- 1806

Query: 1785 ALNXXXXXXXXXXXXXXXXXXXKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQY 1844
                                     KK  L ++Q  S  + +     D  + S  T QQY
Sbjct: 1807 ----QLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQY 1862

Query: 1845 LKISQSNISFSLHRPKKNNASPPTVKLDSNIT----KLKLYDPRDITLPLGKDIAQAKAC 1900
             +     ISF   +   N      + +D+N++    KL   +P  I     +D   A   
Sbjct: 1863 FR-----ISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASES 1917

Query: 1901 LASLKSCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEI 1960
               LK+    L  + +   +    TK      W+    + Y G+L+P+ +T ++ E + +
Sbjct: 1918 FKLLKALKPFLLPQTEGR-LQPATTK---EMRWLLDTDIKYFGILVPISTTYFVFETHAL 1973

Query: 1961 ---SAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAK 2017
                + I  +++T K    SQ      +S  ++ FLI DR +P ALSR++DF++S    +
Sbjct: 1974 VLSMSDIDTEKYTEKDETQSQ------VSIENVVFLIKDRGIPSALSRMLDFSISFSTIQ 2027

Query: 2018 ESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQKRQ------TVGKLPESV 2071
            +  E+  S Q+ES +FRI LSP+SLVR+++   +   L+   K Q       +       
Sbjct: 2028 KMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIKASKLKK 2087

Query: 2072 EVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLD 2131
            E + +        S  VLSYNFC+GW+F   ++  PG++ G+ RLF+A+E  YGKLTL+D
Sbjct: 2088 EKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVD 2147

Query: 2132 AYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRF 2191
            A+FS+A G+TS  FY  ++  E+ NRS+LP+MQI YW++  GL  ++FIR +GE LDV F
Sbjct: 2148 AFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSF 2207

Query: 2192 LSKSIDVAGGLMKSLNMFDELKKQYVDPFKSVA-NPKRPSATSTFSKFPGLSTIQRVDCK 2250
            L+  I V   +++S  +F ELK   + P  S   N   P   S     P LS I+ V+C+
Sbjct: 2208 LTTFITVIESMLQSFQVFQELKTSLIQPNTSTTENNTEPKIKSL---APFLSNIKSVNCQ 2264

Query: 2251 VQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHN 2310
             +Y GGVF+++S +D+++   PSF+L++P V I F+Y+  +     H +RA + + S+HN
Sbjct: 2265 FKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHN 2324

Query: 2311 TIFPTCVPVLNEMARDIRQLLKGFNRSPQEASHKSVS-------QESLDYRSFLRGTDIS 2363
            T+F  C P++ E    I +++K   +      H+S++        +++DY+  L G DI+
Sbjct: 2325 TLFAVCAPLIAEFLEHIHEMVK---KHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIA 2381

Query: 2364 FLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHI 2423
            F +   +Q++S SCEPKAKVQAD+GF+   + + TN+LD +EPL+ S+ I +  A  +HI
Sbjct: 2382 FKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHI 2441

Query: 2424 FSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDS 2483
            FS+E STS  +D +   F+ THPD I+ YG   I  +D+YFN+KQLQ+L +F++IWK  S
Sbjct: 2442 FSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSS 2501

Query: 2484 YVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVL 2543
            ++   P+  S + +    E K L    +  +     PW+F LI + I G  DLG SLGVL
Sbjct: 2502 FIRPGPKGKSNNGK---RENKHLTLP-QPSNLYGEIPWSFTLIFTNINGSADLGPSLGVL 2557

Query: 2544 SLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVF 2603
            SL   R W  +DHY D  Q +    + +   S GRL G   L   SWMS + WP  +   
Sbjct: 2558 SLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTH 2617

Query: 2604 ESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNST 2663
              PLV + V +D   LK +FDYH+ LI ++   K  L +++D  G   +LL V  +    
Sbjct: 2618 NYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMI 2677

Query: 2664 QLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNTKDTR-SASTSKDILNSLSFLR 2722
             +  TAL  ANILD+YNT++RMR+DN+  Y ETL +S+T +TR +    +DIL SL+ L+
Sbjct: 2678 NICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQ 2737

Query: 2723 TELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALS 2782
            T++  ++  + +Q+ P  LFD+EVL    ++   ++     EKLKT L+ +++   +ALS
Sbjct: 2738 TDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALS 2797

Query: 2783 RFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSF 2842
              K ++ E   S I V +Y+E+A K  GGTI+ +P + I MT+W +  ++ +E LY  +F
Sbjct: 2798 TSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTF 2857

Query: 2843 GGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGFFEDEHLEEKLRDVDLGDEYE 2902
              KI ++WNLG +NF++EMW THV+A+A+RRS N        DE +++++++ +   + +
Sbjct: 2858 EDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLK 2917

Query: 2903 YVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARI 2962
            YVP+EEP I++PQ +DLG+ATPP+EWFGVNRK+ P  THQ ++VP+QKL H AE ++A +
Sbjct: 2918 YVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASL 2977

Query: 2963 L 2963
            L
Sbjct: 2978 L 2978

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 1759 bits (4557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1066/3091 (34%), Positives = 1661/3091 (53%), Gaps = 216/3091 (6%)

Query: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62
            S F++VSL    +FSWVFLVDWVL   V+L   FY GR+FG+ LTF+LEW+ WKR KVKI
Sbjct: 5    SPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKI 64

Query: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKSV 122
            +I+SL+I+ LGG I F+NL ++ ++ T S L+G+I WRYWL NSRK+ +    EN+D   
Sbjct: 65   NIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQY---QENLDNEE 121

Query: 123  EKL--------------PCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQD 168
            E+L              PCRF + C+GLE F+YNKT +++NI++   +E+  +F+ F  D
Sbjct: 122  ERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVDD 181

Query: 169  NS-----DKNTDECSVDEDSAGQRSHLEXXXXXXXXXXXXL------------------- 204
             +     +++  E  V  +S      +E                                
Sbjct: 182  QTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPNNL 241

Query: 205  -NDRSF--QSPDSTPPFLKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPD 261
             ND  F  Q  +    +++ LP++ S ++ ++V+GN+ + S++V+S +   G++D C P 
Sbjct: 242  ENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPPK 301

Query: 262  SKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFF-KTDSP 320
             K+DL+KIK+  E      S+K N+  + +        R +LSKLW +  ++F   T  P
Sbjct: 302  EKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPTLGP 361

Query: 321  SSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRFQFDLSKHEYARYTKVMKCDNML 380
                   + +D T    + W+GL LY +  +    +   FD + HEYAR   ++K   ++
Sbjct: 362  KH---LQTQEDITFR--ENWKGLSLYRQNMEEDELENVDFDFANHEYARVISILKSAKIV 416

Query: 381  LEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPL 440
              Y +D PG+VP     T Q   GP+VGNSG PP++ +DIQ+ GA++ YGPW+  ++  L
Sbjct: 417  FTYEYDIPGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYL 473

Query: 441  QKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRE 500
            + L SPVVSR  +P++ LTPGS+RIYT  + SI I+ ES WRIPTRE SKD EFL+ + E
Sbjct: 474  RALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVE 533

Query: 501  TEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQ 560
            T++E RPFGW+++   + S    +  +CPT  G  N ++ HF   EIRTSVNH++LL A+
Sbjct: 534  TKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAK 593

Query: 561  THSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFR 620
            +    A MGYPLGWN +A W  +  S Q +IFIL++HITL+ D+ +DF SG+PTPYELFR
Sbjct: 594  SFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFR 653

Query: 621  PFSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXXXCYLSFHGDDLRLNFEVPQENIAGNST 680
            PF Y  NWN  GYSIYL                 CYLS HGD L  + ++P++ +A   T
Sbjct: 654  PFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCT 713

Query: 681  KINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIII 740
            +I Y + TP+FRL +NTP WNTL+EFMK+KEVGRS NF ++G Y   S+LD+DN+DTI +
Sbjct: 714  EITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISV 773

Query: 741  ECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEY-----MEELRGTNAVTK---- 791
            EC S  TTL CYG+V+RY + VKMNYFGDF HF T EEY      EE +  N   +    
Sbjct: 774  ECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDEHSGF 833

Query: 792  ---TTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGC 848
               +T D ET+      + + +     + I  P   K++ LKR  NE D+WF F V +G 
Sbjct: 834  NISSTEDVETD------RTNPEGRPANKGIPMP---KRSELKRTENEMDIWFVFSVWEGA 884

Query: 849  FILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFE---- 904
             ILPE +Y+ D C AL F+ L++DLR  NYYMD+ A ++   ++R +     ++FE    
Sbjct: 885  LILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRK 944

Query: 905  QKGRALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFIN 964
              GR    E   G LS L IH HRM+GLPP E TYFC+W   +  L+++SDL F  GF+ 
Sbjct: 945  DNGRQ---EKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLT 1001

Query: 965  AWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETAIQLNAQDISAKF 1024
             + K+GFGF++ ENI+ Y+   + DMTSVT+ +  + F  +     +   L+A+ I+   
Sbjct: 1002 CFSKIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTA 1061

Query: 1025 ADLENSLYSSRVDL---DVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQ 1081
             D EN  YS RVD    D+  L   + +  K  + +    T +  ++F Q Q    H  +
Sbjct: 1062 IDFENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYR 1121

Query: 1082 QKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQG 1141
            Q+ +I  +D+ ++RC FL+P   Q S  YK L G I P  ++P L +P+  E +  + + 
Sbjct: 1122 QREYITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIE- 1180

Query: 1142 YLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDNTSL--SSSFSDPTFEH- 1198
                     D +  + P   VK  +SSS    +GQ  P+ +++T    +S F  P   H 
Sbjct: 1181 ---------DCLGEYAPT--VKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHN 1229

Query: 1199 --------NTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKM 1250
                    N  V+++E   L + P    V+ N +++ + +     ID  E+ +V     +
Sbjct: 1230 PPNNRDRYNNYVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNL 1289

Query: 1251 ASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDN 1310
                      R+ +  L  L         YD E    V     S D+ L++       + 
Sbjct: 1290 QYGASFVTTSRLHVKDLHFL---------YDFEEGSGVELALNSFDFDLRRKTIENEDEK 1340

Query: 1311 DPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGIADSSLYL 1370
               + T    I +L + +   L+       M +  A   S+++LE WS       +S+ +
Sbjct: 1341 VILEKTMFSNIHTLRISL---LEAHPSSISM-KPAALQLSIEDLELWSSTVDENVNSVNV 1396

Query: 1371 KSINASVALDKFNWL-------IDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISK 1423
             S   ++   +   +       I  +R     +K+L N         +K +++    ++ 
Sbjct: 1397 TSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLR-------KKTQKDLICDLTS 1449

Query: 1424 ASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTL-ISDIFNDL 1482
            AS+ YQI+HDP VITKPA+I RL   HVRE+RSW+I+TRLRHIL YLP     +D    +
Sbjct: 1450 ASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTV 1509

Query: 1483 KNSEYP--PRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESST--KI 1538
            ++SE P  P+   E+ F+ +FSNW NWD SD+ + Y+Y+++F    +D+   E  T  KI
Sbjct: 1510 QDSENPNVPQRD-EDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTVLKI 1568

Query: 1539 ETGTFMLNFF-----------------------DSINTGSDSVIL--KNLKAQRTLEACK 1573
               +F                             S+NT S+++    K +     + A K
Sbjct: 1569 NFQSFFFTVLISGYEVARSTIFTRTNIIVDVLPPSVNTSSENLFKQEKVITLTANMGAIK 1628

Query: 1574 DEAAEKR-------SNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEH 1626
             E  E+        S  S  E D    L  I   A IS     + +L S R         
Sbjct: 1629 GEWGEEVFKLKELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSR--------- 1679

Query: 1627 AAVKENEKLPAFQQYTALV-DRCDIQLLCGANRANLKSFGNTLTIVRENKSEDA-DAFST 1684
             A    ++    + +  ++ +RCD+  + G  R   +      +++ EN  E+   A S 
Sbjct: 1680 -ASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPALSA 1738

Query: 1685 AFAWSWFEFGIRHRNTILLDAFSRSSAVGAHGFSGKNSRRKLDLRA-KKFRLKLPSESKH 1743
             F     E  ++H   +L +   +   V A    G      L+ +A   F   +PS    
Sbjct: 1739 VFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQLGVIPFVSLNCQATNSFIRAMPST--- 1795

Query: 1744 YCTFIDSLEESWNNLRLALGPNTGFLEKPHSAATEKVAP----QFALNXXXXXXXXXXXX 1799
                 +S+E+    + + L P     E  +S+A  K  P    +F +             
Sbjct: 1796 -VVLRNSVEKIKRQVEV-LIPQFKSHEVKNSSAVTKKTPRIPIKFDIRFNFTDMSSEIML 1853

Query: 1800 XXXXXXXKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRP 1859
                   ++ K+L +      +  L L F   D+ + S  +++Q+ K S +++ F     
Sbjct: 1854 LSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCE-- 1911

Query: 1860 KKNNASPPT-VKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKD 1918
              +   P   V++ +++ KL L +PR     L +D       +  ++  +  L + +  +
Sbjct: 1912 VADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGGN 1971

Query: 1919 IMSQG-NTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENS 1977
              S   NT+      W     L Y GLL+P+ S  YI EL+ + A +T     N+  E  
Sbjct: 1972 DRSPSRNTR------WALDANLKYFGLLVPVSSICYIFELHSLFASLTN---ANEQYEEY 2022

Query: 1978 QGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIAL 2037
                 G +   S   L+ +  LP  LS+V+DF++    +++    ++S QIES YFR+ L
Sbjct: 2023 DRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCL 2082

Query: 2038 SPFSLVRILFLVNELSRLSELQKRQTVGKLP-ESVEVRETFRFRRAFRSVQVLSYNFCLG 2096
             P  LV IL+ V+ L  L    K+     LP  S +  ++      FRS+ +LSYNFC+G
Sbjct: 2083 FPELLVDILWSVHYLQSLLNHFKKHHTPWLPYSSNKTAKSGESTLDFRSIHILSYNFCVG 2142

Query: 2097 WIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPN 2156
            W+F+V D+ EPGLI GY RLF+A+EK +GKLTL+D Y S+A G+TSD FY+ K+  ++  
Sbjct: 2143 WLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYT 2202

Query: 2157 RSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQY 2216
            R++L +MQI YW++ + L  +LF+R +GE +DVRFLS S  +    + S+  F+E+KK  
Sbjct: 2203 RTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAK 2262

Query: 2217 VDPFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQL 2276
            +    S    K     ++ +  P L+ I+ ++ ++ +AGGVF++YS  ++ ++A P  ++
Sbjct: 2263 IKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEI 2322

Query: 2277 ESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNR 2336
            +SP V++  +Y      + SH +R +  +  +HN +F  C P+L++   +I+ +++  N 
Sbjct: 2323 KSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIR--NL 2380

Query: 2337 SPQEASHKSVS-QESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVK 2395
            S ++ SH S    +S+DY+S L   DI+F I  GKQ++SFSCEPKAKVQ D GF     +
Sbjct: 2381 SSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFR 2440

Query: 2396 VFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIM 2455
            V T+ +D  EP ++S  + +I +  RHIFSR+ S +  +D +  + + T+P+    YG+ 
Sbjct: 2441 VTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPN---VYGVA 2497

Query: 2456 HIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSS 2515
             + ++++Y N+KQ Q+LNIF++IW+  +   T+P  +    ++   +            S
Sbjct: 2498 LVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKSLSPPFSPSSNDS 2557

Query: 2516 TTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSS 2575
               FPW+F +I + + G +DLG SLGVL+L  +++W  T H  D  +        I ++S
Sbjct: 2558 RKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNS 2617

Query: 2576 DGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEV 2635
            +GRL G   L   S +S I WP  + +   PL+++ + ++   +K +FDYH+ LI S++ 
Sbjct: 2618 EGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKS 2677

Query: 2636 LKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFE 2695
            +K+ L N+ D   I  +LL V++   S  L  TAL  AN LD+YNTI+RM++DNR SY E
Sbjct: 2678 VKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTIMRMQQDNRISYIE 2737

Query: 2696 TLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFL 2755
            TL +SN   + ++   +++LNSL+ LRT++ V +K + + I P  LFD EVL    +D  
Sbjct: 2738 TLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVN 2797

Query: 2756 TQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILV 2815
             +S+ +  EKLKT L+ QI  V  +LS  K +L E+  S+I V +Y+ +A K  GGTI+ 
Sbjct: 2798 ARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYMLYASKFSGGTIIK 2857

Query: 2816 IPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSH 2875
            +P +L+ MTTW   ++  +E L++  F  KI ++WNLG +NF++EMWATHVR++A+RR+ 
Sbjct: 2858 LPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQ 2917

Query: 2876 NGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQ 2935
             G      E E   E  ++  +  ++ YVPL+EP+IE+PQ KDLG+ATPP+EWFGV+RK 
Sbjct: 2918 LGNSSP--ELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKN 2975

Query: 2936 FPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966
             P  THQ  ++ +QKL H AE E+A++  RA
Sbjct: 2976 LPAATHQTAVLLIQKLVHTAEKEYAKLQQRA 3006

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 1742 bits (4511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1042/3040 (34%), Positives = 1640/3040 (53%), Gaps = 181/3040 (5%)

Query: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62
            SQF+RVSLS   +FSWVFLVDWVL+  V+L   FY GR+F Y +T +LEW  WK +KVKI
Sbjct: 5    SQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKI 64

Query: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENID--- 119
            S++SL+I+ L G I F+NL ++ ++QT S L+GS+ WRY LL +R++ + +AS   D   
Sbjct: 65   SVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQKDGLG 124

Query: 120  ---------KSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS 170
                     K++  LPCRF + C+G E FIYN+T A++NI+    RE+  +F+ F     
Sbjct: 125  VGEEDVNSMKNI-TLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMSKQE 183

Query: 171  DKNTDECSVDEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPDSTPP--FLKLLPLEYSV 228
                  C    + +  +   +            +NDR F    +     F++ LP+E  +
Sbjct: 184  MSELFHCH--SERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMELQL 241

Query: 229  QKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSL 288
             +G++V+GNK + S+++ S     GV+D C P  K+DLYK+  + +F    IS++ N+  
Sbjct: 242  SRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIEY 301

Query: 289  ESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP-LKRWRGLGLYW 347
               N  K+  K  KLS++W      F K       N +++ K     P + +W+GLGLY 
Sbjct: 302  ---NRKKATFKNGKLSRMW----ATFVKVLHIPFYNKSHNNKGTESEPFMTKWKGLGLYK 354

Query: 348  K---EEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDG 404
                + D    D   FD + HEYA+ + ++K    +L Y++D PG+VPHGA PT +   G
Sbjct: 355  GLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTLE---G 411

Query: 405  PDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKR 464
            P+VGN+G PP++ ID+Q  G ++ YGPW+  EI  L ++ SP V+R S P++ L+PGS+R
Sbjct: 412  PEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSRR 471

Query: 465  IYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFN 524
            IYT  + +  ++  S WRIPTRE SKD EFLK+F+ T +E RPFGWL++  +  S     
Sbjct: 472  IYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVT 531

Query: 525  IAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDS 584
              +CP   GF N + +HF + E  +SVNHD++L      +   +GYPLGWN  A W  + 
Sbjct: 532  TVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINL 591

Query: 585  VSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXX 644
             S Q + F+L++H+TL+ DI +DF SGEPTPYELFRPF Y  NW   GYSIYL       
Sbjct: 592  HSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNI 651

Query: 645  XXXXXXXXXXCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLH 704
                      CYLS HG++L ++   P ++I G    + Y++ TP+FRL +NTP WNTL+
Sbjct: 652  VNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNTPPWNTLN 711

Query: 705  EFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKM 764
            EFMK+KEVGRS +F++ G Y  +S+LD+DN+DT+ +EC S  TTL CYG+V+RY + VKM
Sbjct: 712  EFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKM 771

Query: 765  NYFGDFVHFKTTEEYMEELRG--TNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPL 822
            NYFGDF HF T+EEY   +R     +V KT  +S   +++    +  DS      + DP 
Sbjct: 772  NYFGDFFHFITSEEYTGVIRAKEKESVGKTEEES---LRDNSTNLSTDSGG----LSDPY 824

Query: 823  T-------AKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRH 875
                      ++ +KR  NE D+WFTF V +G  +LPE +Y+CD C AL F  L +DLR 
Sbjct: 825  VRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRS 884

Query: 876  INYYMDMQAALSPLRIRRLIDCGCEEVFEQ----KGRALCGELVAGRLSRLHIHTHRMFG 931
             NYYMD+ A +S   I+R +     E+FE      GR    E   G L+ L IH HRM+G
Sbjct: 885  CNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRT---EKEHGSLAALTIHGHRMYG 941

Query: 932  LPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMT 991
            LPP E TYFC+W   L  L ++SD  F  GF   +  +GFG+ + EN + Y V    DMT
Sbjct: 942  LPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMT 1001

Query: 992  SVTLAIDAIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASIIDKN 1051
            SVT+ +  +    +   D +   ++  +++    D EN  YS R+DL V +L+  ++   
Sbjct: 1002 SVTVRVRDMNVVVE--NDSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSE 1059

Query: 1052 KSNKAI--ASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSD 1109
              ++ I      T + +++F Q +D   H  +Q+ +I  ND+PF+RC FL+P  LQ S  
Sbjct: 1060 DDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPL 1119

Query: 1110 YKGLFGCIPPGVSIPSLAVPLQTENVKAV-------FQGYLKAENASKDFVD------RW 1156
            YK L G I P  S+P L +PL  E +  +       F   LK +  ++  VD        
Sbjct: 1120 YKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSES 1179

Query: 1157 FPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPEC 1216
            F  ++          D   QL  IL  N         P  +++ ++++++   + + P  
Sbjct: 1180 FDTSQEHEGPDDVRYDRFAQLPKILSPN---------PLEQYDNVIIDVKFLAVDLDPLI 1230

Query: 1217 YEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNK 1276
               +   + +  K      ID IE+ +V    ++     N   + + +  +D+ F  +  
Sbjct: 1231 CSYVDGLLGEFWKVNTVDIIDEIEMSIVK---RLGQLWNNTCVLNLKLYVVDINF-FWGD 1286

Query: 1277 ENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKT 1336
            +N   V+           LD+ L +  +    +    +  +L K+ S+   VF   D+  
Sbjct: 1287 KNAKVVDLYFD------KLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVF---DRSI 1337

Query: 1337 KFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDS 1396
                 +   A   +V+  EA+S++      S+ L S + +V   +  WL  ++ +  +  
Sbjct: 1338 TEGVEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLI 1397

Query: 1397 KQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRS 1456
            K ++   +     ++   ++    I+ AS+ YQI+H+P VITKPA+I RL + HVRE+ S
Sbjct: 1398 KNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPS 1457

Query: 1457 WKIVTRLRHILNYLPTTLISDIFNDLK-NSEYPPRSTAEETFLEIFSNWGNWDYSDVEKC 1515
            W+I+TRLRHIL YLP        N+ + NS      T + T   + S+W  W+ SD+ + 
Sbjct: 1458 WRIITRLRHILTYLP--------NEWRNNSAIQVSPTVDSTDASVASHWRRWEISDITRS 1509

Query: 1516 YMYRRVFTNTLDDTVAHESSTKIETGTFML-----NFFDSINTGSDSVILKNLKAQRTLE 1570
            Y+YR +F       ++ +S T+ ++   ML     +FF +I +    V   N    R   
Sbjct: 1510 YIYRTIF-------LSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVA-HNFVITRANI 1561

Query: 1571 ACKDEAAEKRSNMSNAED-DLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAV 1629
              ++  A + S +  A D D    L+  +   +  L+D    +LL +R +F+     A  
Sbjct: 1562 VGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGELND----QLLKLRNIFSKAQTPALK 1617

Query: 1630 KENEKLPAFQQYTALV----DRCDIQLLCGANRANLKSF-GNTLTIVRENKSEDADAFST 1684
            +    +   + Y   V    DR ++Q + G  R   +   G    ++ + K+  A A S 
Sbjct: 1618 RSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSF 1677

Query: 1685 AFAWSWFEFGIRHRNTILLDAFSR--SSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSESK 1742
             F     E  ++H + +L +A SR  S  + A  +S   S   ++++     ++  + ++
Sbjct: 1678 VFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPS-LSINIQCSNSHIRAMTSTE 1736

Query: 1743 HYCTFIDSLEESWNNLR--LALGPNTGFLEKPHSAATEKVAP--QFALNXXXXXXXXXXX 1798
                 I  + ES + L+   A+   T  ++     +T    P    AL            
Sbjct: 1737 LLVNSIKQIMESISELKRHFAMEKTTPNVQ---GTSTNLSIPLQNTALTVSFSDVTAELM 1793

Query: 1799 XXXXXXXXKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHR 1858
                       K+L L   +  S+ + ++    +I + S +TT+QY   +  ++    + 
Sbjct: 1794 PLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNL 1853

Query: 1859 PKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKD---IAQAKACLASLKSCFGKLNTKN 1915
            P +++A    V L +++ KL L +PR I     +D   I ++   +  L   F  L    
Sbjct: 1854 PTESSAI-LNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPL---- 1908

Query: 1916 DKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASE 1975
                    N   + +  W     LNY G+L+P+ ST ++    EI   + A    +   +
Sbjct: 1909 ------ARNKTQSSALRWSLDANLNYFGILVPMASTFFVF---EIHMLLAAMNNASDGQD 1959

Query: 1976 NSQGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRI 2035
                 + G +S  +   LI +  LP  LS+++DF++ +  +++     +S QIES +FR+
Sbjct: 1960 EGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRV 2019

Query: 2036 ALSPFSLVRILFLVNELSRLSEL---QKRQTVGKLPESVEVRETFRFRRA-FRSVQVLSY 2091
             LSP SLV++L+  ++L  L E     ++Q     P S+        R+  FRS+ +LSY
Sbjct: 2020 CLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQIDFRSIHILSY 2079

Query: 2092 NFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNS 2151
            N C+GW+F + D  + GLI G+ RLF+A+EK YGKLTL+D YFS+A G ++D FY+  + 
Sbjct: 2080 NLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSE 2139

Query: 2152 FENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDE 2211
             +  NRSFL ++QI YW++      +LFIR+NGE L+V  LS S D+    + S+  F  
Sbjct: 2140 KQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQT 2199

Query: 2212 LKKQYVDPFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAG 2271
            LKK+ +    S    K     ++ +  P LS I+ +DC+ +Y GGV ++YSLDD+    G
Sbjct: 2200 LKKERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEG 2259

Query: 2272 PSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLL 2331
            PS +++SP V I   Y      +  H +R  + +  +HN ++  CVP+LN++    ++++
Sbjct: 2260 PSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMV 2319

Query: 2332 KGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEK 2391
            +    SP E   +  S +S+DY+S L   DI+F +  G+QQ+S SCEP+AKVQAD+GF+ 
Sbjct: 2320 Q--KHSPDETPLE--SSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDS 2375

Query: 2392 LAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHT 2451
                V TNDL    P  +S+ + +I +  RHIFSRE S S  +D + +  I THPD    
Sbjct: 2376 FTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPD---V 2432

Query: 2452 YGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFK 2511
            +G+  + +I+V+FN+KQLQ+LN+F++IW+ +  +  +     +  +  T      +   K
Sbjct: 2433 FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKS----MTLSK 2488

Query: 2512 KVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKI 2571
            + S+ TS  W+F LI + +KGD+DLG SLGVLSL   R W  TDHY    + L    +++
Sbjct: 2489 RTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADEL 2548

Query: 2572 LLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIA 2631
             + S+GRL G   L+N +W+S + +P    +  S  ++L + +    +K +FDYH+ LI 
Sbjct: 2549 SIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIG 2608

Query: 2632 SVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRK 2691
            +++ +K  L ++ D  GI  +LL VA+S        TAL  ANILD+YNTI RMR+DNR 
Sbjct: 2609 TIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQDNRI 2668

Query: 2692 SYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKA 2751
            SY ETL +SN+ + R      DIL SL+ LRT+L   +     QI P  LFD+EVL    
Sbjct: 2669 SYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVLVLNI 2728

Query: 2752 KDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGG 2811
             +   +S+ +  EKLKT L  Q+   K++LS  K +L E+  ++I +++Y+ +A K  GG
Sbjct: 2729 DNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASKISGG 2788

Query: 2812 TILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMAL 2871
            TI+ +P +L+ MTTW    ++ +E L++  F  ++ ++WNLG INF++EMW+TH++++A+
Sbjct: 2789 TIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAV 2848

Query: 2872 RRSHNGQPRGFFEDEHLEEKLRDVDLGDEYE------YVPLEEPHIEIPQTKDLGEATPP 2925
            R++ +        ++ + EK +  DL  E E      YVPL+EP+IE+PQ KDLG+ATPP
Sbjct: 2849 RQTQS--------NKTMSEKDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGDATPP 2900

Query: 2926 VEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILGR 2965
            +EWFGV+RK+ P  THQ  IV +QKL H AE E+A++ GR
Sbjct: 2901 MEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 1717 bits (4446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1046/3072 (34%), Positives = 1674/3072 (54%), Gaps = 193/3072 (6%)

Query: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62
            SQF  +SL   + FSWVFL  WVL    SL   FY  RVFG   TF+L W  WK+YKVKI
Sbjct: 5    SQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKVKI 64

Query: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAF----------- 111
            +I+S+++SFLGG +F KN++++ Q+ T SFL+  I WRYWLLNSR+  +           
Sbjct: 65   NIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLSSEQS 124

Query: 112  ----AKASENIDKSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQ 167
                A  S  I+K+  KLPC   +EC+G E F+YN+  A++N+L    +E+ E+F  F  
Sbjct: 125  QGSDASNSMTIEKN-SKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSSFLN 183

Query: 168  DNS-----DKNTDECSVDEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQ-SPDSTPPFL-K 220
            ++       ++T+  S+D+D      + E            +NDR+++ + D     L  
Sbjct: 184  EHDLGDIVSEDTNVNSMDKD------YFESVTTENSSESTVINDRTYKKNKDERKSILFN 237

Query: 221  LLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHI 280
             LP++  +  GAV +GN+ + S++V SYE  +GVLD    + KIDLYK KV  +F+  +I
Sbjct: 238  FLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNI 297

Query: 281  SLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP---- 336
            S+KPNL+ +SE   +  + + KLS++W+    +     +P +K      K    +     
Sbjct: 298  SVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMF 357

Query: 337  LKRWRGLGLY---WKEEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPH 393
            + +WRGL LY    ++      D   +D    EYA+++ ++KC N  L Y  D+PGIVPH
Sbjct: 358  VNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPH 417

Query: 394  GALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQ 453
            GA  T    DGPD+GNSG PP++ +D+Q+S AS+YYGPW++ ++  L ++ SPVVS++  
Sbjct: 418  GAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQI 477

Query: 454  PVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEV 513
            P+++L PGS+RI+T  ++S+ I+ ES WRIPTRE SKD EF+K+F +T D+ RPFGWL+ 
Sbjct: 478  PIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDF 537

Query: 514  SLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLG 573
            +L++G++  FN ++ PT  G  N  D+HF+  E+ TSVNHDILL ++   + A +GYPLG
Sbjct: 538  NLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLG 597

Query: 574  WNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGY 633
            WN +A+W FD ++ Q + F+LK+HI+L  D+ SDF S +PTPYELFRPF+Y+ NW+  GY
Sbjct: 598  WNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGY 657

Query: 634  SIYLXXXXXXXXXXXXXXXXXCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRL 693
            SIYL                 CYLS HGD+L ++  +P   I+   T+I + ++TP+FRL
Sbjct: 658  SIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRL 717

Query: 694  NMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYG 753
             +NTP WNTL EFMKDKEVGR+ +F + GSYL +S LD+DN+DTI +EC S+STTL CYG
Sbjct: 718  LLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYG 777

Query: 754  YVLRYFLGVKMNYFGDFVHFKTTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSSQ 813
             V+RY + V+ NYFGDFVHF T+EEY E L+  N   K ++D +     +     ++SS 
Sbjct: 778  VVIRYLMNVQANYFGDFVHFITSEEYSEILQKNN---KRSNDEQGSFTYSTTSSVQNSSS 834

Query: 814  -------REQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEF 866
                   +EQ +  P   ++  + R  NE D+WFTF V DG  ILPE LY+ + C +L F
Sbjct: 835  DDTVLYTKEQDLSKP-HVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLF 893

Query: 867  DSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFEQ-KGRALCGELVAGRLSRLHIH 925
              L I  R  NYYMD    L  ++I R ++   +E+F   +       +V G LS + IH
Sbjct: 894  SELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIH 953

Query: 926  THRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVA 985
             HRMFGLPP + TYFC+W    G+L + S++ F   F   + KLGFG+ + EN + YKV 
Sbjct: 954  AHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVE 1013

Query: 986  PILDMTSVTLAIDAI-VFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLT 1044
               DMT +TL  + + +  +D +  + A  L    +     D +N  YS R++L +   +
Sbjct: 1014 SSDDMTLLTLYGEKVLILVSDDVSQKQA-SLEILKLKLNSIDFQNERYSKRINLKIPEFS 1072

Query: 1045 ASIID-KNKSNKAI-ASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPL 1102
             SI D +N + K I   F T I  +NF   +D       Q+ +I  +D+P+HRC F++P 
Sbjct: 1073 ISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPT 1132

Query: 1103 TLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRWFPVNEV 1162
              Q S  Y  L+G I P  SIP L +P+    +  + + +LK    S    + +  +  +
Sbjct: 1133 MYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKE--YSDLLENPFLNIRSI 1190

Query: 1163 KNKNSSSLKDFKGQLQPILDDNTSLSSSFS---------DPTFEHNTLVVNLENSRLSIS 1213
             N ++SSL +     +  +D   S  + F          DP +E++  ++N+E  R+ I+
Sbjct: 1191 NNLDTSSLFN-----EYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDIN 1245

Query: 1214 PECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQK---NYKNIRVLMPTLDVL 1270
            P   + I +   + +    E  +D I+   ++   ++ S +K      N+++ +  +D+ 
Sbjct: 1246 PLFSDFIDSMSTKLYS---ENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIF 1302

Query: 1271 FETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFN 1330
            + + N E        +++  ++  LD+ +++ +    +    E+ T L K++SL      
Sbjct: 1303 WGSRNSEG-------IEIYLDK--LDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSF-- 1351

Query: 1331 KLDKKTKFAEM--DENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDF 1388
                +T++ E+  +   A   +V+ LE WS  N    +S+ + S + +V   + +WLI +
Sbjct: 1352 ---SETQYEEIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKY 1408

Query: 1389 MRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPS 1448
            + K       L   +     +    ++    +++ AS+ YQI HDP VITKPA I RL +
Sbjct: 1409 LNKQVEFFYNLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSN 1468

Query: 1449 QHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWD 1508
             HVRE+RSW+IVTRLRHILNYLP          ++       S  +  FL +FSNW NW+
Sbjct: 1469 SHVRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWE 1528

Query: 1509 YSDVEKCYMYRRVFTNTLDDTVAHESSTKIETGTFMLNFFDSINTGSDSVILKNLKAQRT 1568
             SDV + Y+YRRVF   ++  + + ++TKI   +F    +        ++++  +     
Sbjct: 1529 VSDVARSYIYRRVFLPDIEKNLIN-NTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIID 1587

Query: 1569 LEACKDEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAA 1628
             +   DE  E ++  +N  D + + ++  +   +  L D    +L+ +++L+   +E  A
Sbjct: 1588 -QMLSDE--EPKAATANKNDKIYD-ITGTVGTFKGELGD----QLIRLKKLY---SEDKA 1636

Query: 1629 VKENEK-----LPAFQQ--YTALVDRCDIQLLCGANRANLKSFGNTLTIVRENKSEDADA 1681
               +EK     +P F +     +V++ ++ L     +   +     ++   EN  + A+A
Sbjct: 1637 KIRSEKSTDFSIPKFFKINIVLIVEKGELTLAAANTKLISRIKNGKISGFFENARDVANA 1696

Query: 1682 F-STAFAWSWFEFGIRHRNTILLDAFSRSSAVGAHG-FSGKNSRRKLDLRAKKFRLKLPS 1739
              S  +  +  E  ++H   ILLDA      +        K     +++++   R K   
Sbjct: 1697 SGSIVYYATRTELWLKHNELILLDAHLDDLFISVIAELLVKKPTILVNVKSSHLRFKALP 1756

Query: 1740 ESKHYCTFIDSLEESWNNL--RLALGPNTGFLEKPHSA-----ATEKVAPQFALNXXXXX 1792
             +K+   F+   E   + +  RL    N    +K H++     +T+K+   F +N     
Sbjct: 1757 NTKNLVVFLREFEREISKITGRLTDKDN----KKRHTSTSPIFSTKKIDISFDIN--IFD 1810

Query: 1793 XXXXXXXXXXXXXXKNFKKLTLAYEQSASSALKLAFETLDIDVF--STRTTQQYLKISQS 1850
                           + K+L + + +   +     F  LD D++  S +   QY ++S  
Sbjct: 1811 ISSEIVILSPFTVKHSMKELKIVFNREGDN--DTIFSILDADLYLTSYQNGVQYFRLSYQ 1868

Query: 1851 NISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGK 1910
            +I+        + +   T+ + +++ KL L DP+ IT  L +D    +  L S+K+    
Sbjct: 1869 DINLEAML-TDSKSKLITINIVTSLIKLTLADPKKITNSLLQDEKTFEQSLESIKT-LNT 1926

Query: 1911 LNTKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFT 1970
            L + N +   S  +  + F  ++     L Y GLL P+ ++ +I EL+ + A      F+
Sbjct: 1927 LFSSNREVRTSAVDNPYKFMVNF----DLTYFGLLFPVDTSYFILELHSLLA-----TFS 1977

Query: 1971 NKASENSQ--GALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQI 2028
            N      Q    +  +L+  +  F+I    +   +S+V+DF+V++    +     RS ++
Sbjct: 1978 NVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFEV 2037

Query: 2029 ESPYFRIALSPFSLVRILFLV----------NELSRLSELQKRQTVGKLPESVEVRETFR 2078
            ES +FR+ L+P SL++IL  V           E +RL   + ++    + E++       
Sbjct: 2038 ESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSENLIGAPLIE 2097

Query: 2079 FRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAE 2138
            +     S+  LSYNFC+GWIF+ + S  PGLI GY RLF+A+E  YGKLT++D +FSIA 
Sbjct: 2098 Y-----SIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIAN 2152

Query: 2139 GSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDV 2198
            G +SD FY+  N  E  NRS+LP++QI YW++      +LF+R  GE +DVRFLS    +
Sbjct: 2153 GFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATI 2212

Query: 2199 AGGLMKSLNMFDELKKQYVDPFKSVANPK--RPSATSTFSKFPGLSTIQRVDCKVQYAGG 2256
                ++S+  F  +KK+ V      A  K      ++ FS F   S +QR++C+  Y GG
Sbjct: 2213 INLTIESVQHFQMIKKETVREMNVEAEKKVGEDDISTKFSLF--FSKVQRINCQCIYDGG 2270

Query: 2257 VFRLYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTC 2316
            VF +Y +     +   + ++ +P V I  DY+  +  K  H +R+++ +  ++NT+    
Sbjct: 2271 VFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQF 2330

Query: 2317 VPVLNEMARDIRQLLKGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFS 2376
               L E    + +++  F+   Q  + K+VS   +DY+  L   D+SF I  GKQ++S S
Sbjct: 2331 ASFLTEFGESVHEMVAKFSPKEQPPAPKTVSP-PIDYKRILEDFDVSFSISAGKQKVSLS 2389

Query: 2377 CEPKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQ 2436
            CEP AKV A++GFE     + TND D +EPLS S+ + +I     H FS E + S  +D 
Sbjct: 2390 CEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDF 2449

Query: 2437 LSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHS 2496
            +    + THPD    YG   I ++ +YFNIKQLQ+L +F++IW     +  +P    + S
Sbjct: 2450 VDITTLFTHPD---IYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRP----QKS 2502

Query: 2497 RALTSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDH 2556
              +   E  + +  K  S+TT  PW+F +II+ I GDI LG SLG LSL   + W  T+H
Sbjct: 2503 VPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDIHLGPSLGNLSLKLKKNWISTNH 2562

Query: 2557 YSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDE 2616
            + D  + L    + + L+S GRLGG + + N SW+  +R+   E + +SPLV + + ++ 
Sbjct: 2563 FQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVEN 2622

Query: 2617 FDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANIL 2676
              +K +FDYH+ LI  V  +   L +++D  G   +LL + +  +   +  TAL  +NIL
Sbjct: 2623 VAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNIL 2682

Query: 2677 DVYNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQI 2736
            D+ NTI R R+D+R SY ETL +SN    +S+ +  DIL SL+ LRT++ + +  + +QI
Sbjct: 2683 DISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQI 2742

Query: 2737 YPSKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQI 2796
             P  LFD+EV+    ++   +S  +  EKL T L+ +I+   ++LS+   +L E+A S+I
Sbjct: 2743 SPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEI 2802

Query: 2797 GVKEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSIN 2856
             V +Y+ +A K  GG IL IP + +GMTTW    +  +E L++  F  KI +RWNLG +N
Sbjct: 2803 SVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVN 2862

Query: 2857 FLREMWATHVRAMALRRSH-------------NGQPRGFFEDEHLEEKLR---------- 2893
            F++E+WATHV+++A+RR+               G+P      E L E LR          
Sbjct: 2863 FIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPSPLVSSEEL-EMLRSESSNADNDN 2921

Query: 2894 -DVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLA 2952
             +    D++ YVPL+EP IE+P+ KDL +ATPP+EWFGVNRK+FP +THQ  I+ +QK+ 
Sbjct: 2922 NEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIV 2981

Query: 2953 HIAETEWARILG 2964
            H+A+ E+A++LG
Sbjct: 2982 HVAQKEYAKVLG 2993

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 1476 bits (3822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 933/2952 (31%), Positives = 1545/2952 (52%), Gaps = 197/2952 (6%)

Query: 123  EKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDF---------FQDNSD-- 171
            +KL   F + C G E F+YN+ +A++ I+ +  +E+  +F DF         F++ S   
Sbjct: 182  KKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEI 241

Query: 172  KNTDE----------------CSVDEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPDST 215
            KN +E                C  D++SA   S                N     +    
Sbjct: 242  KNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIMR 301

Query: 216  PPFLKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEF 275
               L +LPL+ ++ KGA+ IGNK + S++V+++ +  G+LD  LPDSK+D++K KV  E 
Sbjct: 302  KLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEI 361

Query: 276  RKFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSK-----NPANSAK 330
                +S+K N+    E   +   +   L+++W  SY        P+ +           +
Sbjct: 362  NDIDMSIKRNIGYNPELASRFNFRAGVLTRIW--SYLQLVLNLIPTGRLKTWYESLRYKE 419

Query: 331  DGTRNPLKRWRGLGLY---WKEEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDA 387
            D T   +K+W GL LY    K       D   FD + HEYA+ +   K   ++     D 
Sbjct: 420  DTTF--VKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDI 477

Query: 388  PGIVPHGALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPV 447
            PGIVPHG+ P      GPD+GN   PP + ID+Q+S AS+Y+G W +  I+ L+ L  PV
Sbjct: 478  PGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPV 537

Query: 448  VSRDSQPVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRP 507
            +S+D +P+ +L PG  R+++    S+ ++ +S  R+PTRE SKD +FLK++ ET+D+ R 
Sbjct: 538  ISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRA 597

Query: 508  FGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHAT 567
            FGW+++S  +GSE   NI M PT+ GF+NTL   F + E+ TSVNH++L  + + ++ A 
Sbjct: 598  FGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAAN 657

Query: 568  MGYPLGWNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFN 627
            +GYPLGWN    W+F+  S Q  IF+L++HITLL D+I DF + EPTPYELFR F+Y  N
Sbjct: 658  IGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLN 717

Query: 628  WNFTGYSIYLXXXXXXXXXXXXXXXXXCYLSFHGDDLRLNFEVPQENIAGNSTKINYELF 687
                GYS Y                  CYLSFHGD       +P  ++A     I+YE+F
Sbjct: 718  LKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIF 777

Query: 688  TPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKST 747
            TP+FRL +NTPSWNTL EFM++KE+GRS +F +SG+YL +S+LD+DN+D++ I+  S ST
Sbjct: 778  TPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNST 837

Query: 748  TLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEYMEELR-GTNAVTKTTHDSETEIQEAPKQ 806
             L C+G+V++Y +  + NYFG F+ F TTEEY E +R   N    + + ++    E  ++
Sbjct: 838  VLYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINTNDLTSIEGLQK 897

Query: 807  MDEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEF 866
            MD  ++  E    +  T K++ L R  NE D+W  F V DG  ILPE LY+ DSC +L F
Sbjct: 898  MDSITNDVED--INQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSF 955

Query: 867  DSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFEQKGRALCGELVAGRLSRLHIHT 926
              L I++R  NYYMD+   L    + R       E+FE          V G +S + IH 
Sbjct: 956  GELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVEGNISDITIHG 1015

Query: 927  HRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAP 986
            HRM+GLPP E TYFC+W  ++GT  + SD+ F L FI +  K+GF   + EN + Y+   
Sbjct: 1016 HRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDT 1075

Query: 987  ILDMTSVTLAIDAI-VFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTA 1045
            + DMT +++ ++++ V  +D + +  A ++ A  I  +  D EN  Y+ R+D++ +    
Sbjct: 1076 VNDMTLLSVDVESLKVILSDPLLEARA-EIGASSIIIRNIDFENEKYTKRLDVNASEFYF 1134

Query: 1046 SI----IDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIP 1101
            S+    ID  K N  I    T + I+NF +  + + H   Q+  I  +D+P+HRC FL+P
Sbjct: 1135 SLDSLKIDSGKKN--ILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLP 1192

Query: 1102 LTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLK--AENASKDFVDRWFPV 1159
               Q SS YK L+G I P  S+P L +P        + +G L   +E    D  ++    
Sbjct: 1193 EKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSIN 1252

Query: 1160 NEVKNKNSSSLKD-FKGQL---QPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPE 1215
             E+ + +++ LKD F  Q+   Q IL        +  DP +E +  VVN++   ++++P+
Sbjct: 1253 AELNSVDTTPLKDSFDMQITNFQNIL--------TTEDP-YETDNFVVNVKYLTVTVNPD 1303

Query: 1216 CYEVIGNAVEQCHKKL-IEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDV----- 1269
                I     + +KK  +   ID IE+ +V     +     +  N+ + +  +D      
Sbjct: 1304 IVFTIEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHR 1363

Query: 1270 ---LFETY--------NKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSL 1318
                  TY        ++E+TY+  G              L+K L L G           
Sbjct: 1364 DVCFIGTYINMLKFELSQESTYNNNG-------------GLQKDLTLLG----------- 1399

Query: 1319 LKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVA 1378
             K  S+ + + N       F++ D        ++  EAWS       ++L L S + +V 
Sbjct: 1400 -KFRSVRIIIQNH--SYNSFSD-DRPPGLSLMLEGFEAWSSTTTKQLTTLNLTSFDITVD 1455

Query: 1379 LDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVIT 1438
              + +WLI +++       ++ + +     +    ++ F   +  A ++YQI HDP VIT
Sbjct: 1456 EYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPYVIT 1515

Query: 1439 KPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEE--- 1495
            KPA + RL + H+RE+RSW+IVT+LRHIL YLP     D  + L   +   RS  E+   
Sbjct: 1516 KPATVLRLSAWHIRENRSWRIVTKLRHILTYLP----EDWEDRLDEEDLIKRSGLEKEAA 1571

Query: 1496 -TFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESSTKIETGTFMLNFFDSINTG 1554
             TFL +FSNW NW+ SD+EK Y+YR +F   +   +  ++S K+   TF    + S N  
Sbjct: 1572 STFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKRIL-QNSIKVFLETFYFTIY-SRNYS 1629

Query: 1555 SDSVILKNLKAQRTLEACKDEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLL 1614
            +D   L   KA   +    D+  E   ++   ++++ + ++  I   +   ++  L    
Sbjct: 1630 ADQNFLIT-KANILINNEADQVNE--VDLIRKQEEIVDVVTK-IGSIKFEFTEAILKLKR 1685

Query: 1615 SVRELFTFEAEHAAVKENEKLPAFQQYTA----LVDRCDIQLLCGANRANLKSFGNTLTI 1670
             + ++     +  +  E +KL   + +      + D  D         ++LKS  + + I
Sbjct: 1686 DIEQIIKTSVDSKS--EGDKLSITKFFKVNLSFIFDHIDFN--GQFYNSSLKSRMSNVNI 1741

Query: 1671 VR--ENKSEDADAFSTAFAWSWFEFGI--RHRNTILLDAFSRS--SAVGAHGFSGKNSRR 1724
            +   EN  E +   S +F +     GI  +H N IL+D   R+  ++  A   S  NS  
Sbjct: 1742 LSYFENNIESSTP-SGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLM 1800

Query: 1725 KLDLRAKKFRLKLPSESKHYCTFIDSLEESWNNLRLALGPNTGFLEKPHSAATEKVAPQF 1784
             ++ R      K   +++ +   I +++     L   +    G  +  ++  T  V  + 
Sbjct: 1801 -INFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKN 1859

Query: 1785 ALNXXXXXXXXXXXXXXXXXXXKNFKKLTL---AYEQSASSALKLAFETLDIDVF----- 1836
             +                     +  ++TL    Y +  ++++ +++ T++ID       
Sbjct: 1860 KMQKAKPNSKNNITLSATFTNVSS--EITLLHPIYLKHETNSVNISYNTINIDELLVQVL 1917

Query: 1837 -------STRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRDITLP 1889
                   S+ T +QY ++S   +  +   P   N     +++ S+I KL   DPR +   
Sbjct: 1918 DTDLYLNSSHTKEQYARLSYDKLELTTFLPDL-NEKLIDLEISSSILKLTTSDPRRMLFS 1976

Query: 1890 LGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLG 1949
              +D  + K  L  L+S    L + N K       T F+ S  WI   +  Y+G+L+P+ 
Sbjct: 1977 FLQDEKELKNSLTFLRS----LESLNRKANSEDSETLFS-SYEWIVNFKSKYMGVLLPIQ 2031

Query: 1950 STSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLPEALSRVVDF 2009
            +T Y+ EL++  + ++  E   + S        GDLS   I FLI D+ +P   S+++DF
Sbjct: 2032 ATYYVFELHDALSTVSNKE---EPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDF 2088

Query: 2010 AVSIKIAKESEEVIRSLQIESPYFRIALSPFSLV-------RILFLVNELSRLSELQ--- 2059
            ++ +   +      RS +IES +FR+ L+PFSL+       ++L+L+N     S +    
Sbjct: 2089 SIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYYDQSTVNFFV 2148

Query: 2060 -KRQTVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFA 2118
                 +     S E    F    + RS  +LSYNF +GW++  +D+  PGLI GY RLF+
Sbjct: 2149 FNDNNIDGATNS-EKENVF----SVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFS 2203

Query: 2119 AHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDEL 2178
             +E  +GKLTL+D +FS+A GS+ D FY+  +     NRS+LP++QI YWI+       L
Sbjct: 2204 TYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHL 2263

Query: 2179 FIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFKSVANPKRPSATS---TF 2235
            FI+ +GE LDV F    +++    ++S+++F  LK++ ++P    A P+R   ++   T 
Sbjct: 2264 FIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVK-AKPERDEKSNSALTN 2322

Query: 2236 SKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKH 2295
             K P    +++V+C+  Y GG+FRL+S   + N+  P+  ++SP V+I+  Y        
Sbjct: 2323 IKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELK 2382

Query: 2296 SHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQEASHKSVSQESLDYRS 2355
             H +   + +  + N +   CVP L++    I+ +++  + + +E    +V ++ ++  S
Sbjct: 2383 KHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNV-KDPINITS 2441

Query: 2356 FLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYE 2415
             L   DI F +  G Q ++  CEPKAK+  D+GF      + T  L+  +PL +S+ I +
Sbjct: 2442 LLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKIND 2501

Query: 2416 ITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIF 2475
            I    +H FS E S S ++ +L  I I THP+    +G   + ++ ++FN+KQ Q+++IF
Sbjct: 2502 IKTSVKHQFSNEASASFEVSKLDVILIFTHPE---VFGTGLVDDVKLHFNLKQFQNISIF 2558

Query: 2476 VNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDID 2535
            ++IW  D    T+ +L  + S  L   +   +A  + + ++++ PW+F+ I + I GDI+
Sbjct: 2559 LDIW--DVSKSTEKKLFKKDSNTLVDAKSSPIA--QTIVNSSTLPWSFVFIATNINGDIN 2614

Query: 2536 LGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIR 2595
            +G +LG L+L   R W  TDH+ +  Q L L  + + +SS+GRLGG + + + +W   + 
Sbjct: 2615 MGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVN 2674

Query: 2596 WPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLS 2655
            +  +     SPLV L   + +  +K++FDYH+ LI++V+ LK  + +++D   I  +LL+
Sbjct: 2675 YVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLT 2734

Query: 2656 VAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDIL 2715
            V ++ +  ++  TAL  +NILD+YNTI+R R+DN+ SY ETL +SN    +     +DIL
Sbjct: 2735 VNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDIL 2794

Query: 2716 NSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIH 2775
             SL+ L+T L  ++  +++QI PS L+D EV+  + +D  + ++    EK+KT L+ +++
Sbjct: 2795 KSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVY 2854

Query: 2776 GVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVE 2835
               ++L+ F  +L E+  +++  + YI +A     G I  IP + I MTT+ +     ++
Sbjct: 2855 NATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQ 2914

Query: 2836 LLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSH-NGQPRGFFEDEHLEEKLRD 2894
              YS SF GK+ + WNLG INF++E+WATHVR++ +R     G      E+E   ++   
Sbjct: 2915 YTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENEGDTDE--S 2972

Query: 2895 VDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHI 2954
            V +    EY+ LEEP+IE+PQ KDL +ATPP+EWFG+NRK FP  THQ++IVP+QKL ++
Sbjct: 2973 VKVLSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNV 3032

Query: 2955 AETEWARILGRA 2966
            A+ E+A++LG +
Sbjct: 3033 AQKEYAKVLGSS 3044

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (70%), Gaps = 3/117 (2%)

Query: 1   MASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKV 60
           + ++F  VSLS    FSWVFLV W+L++  +    FY  +++G+ LTF  EWL WK   +
Sbjct: 4   LGTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNI 63

Query: 61  KISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAF---AKA 114
           K++I+S+++SFL G IFFKN+ ++ Q++T S L+ S+TWRYWLLN+RK+ +   AKA
Sbjct: 64  KVTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKA 120

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 1428 bits (3697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 871/2611 (33%), Positives = 1381/2611 (52%), Gaps = 107/2611 (4%)

Query: 409  NSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTR 468
            N   PP+ +++ Q+  AS+ YGPW+H  IM +Q++FSP+VSR  +      PG  R YT 
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 469  LRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMC 528
             ++S+ I+ +S WR+PTRE SKD +FLKR+ +T D +R FGW +++ S  SE  F I+  
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 529  PTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQ 588
            P   G+ N L+L F   E+R+SVNHDI   ++++ + + +GYPLGWN +  W F   S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 589  CQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXXX 648
             + F L++H+ L+ D  SDF SGEPTPYE FRP  Y  +WNF GYS YL           
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 649  XXXXXXCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMK 708
                  CY+S HGDD  +  E+P+  I    T I +++ TP+FRL +NTP WNTL+EFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 709  DKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFG 768
            +KE+GR  +F+  GSY+ +S LD+DN+D++ IEC ++  TL  YG+V+ Y L V+MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 769  DFVHFKTTEEYMEELRGT-NAVTKTTHD----SETEI--QEAPKQMDEDSSQREQHIKDP 821
            +F HF T EEY + +RG  N +  T  D    SET      +  Q + D+S +  +I DP
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSK-SNIIDP 1008

Query: 822  L---TAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINY 878
            L     +K  +KR VNE D+WFTF V +G  +LPE LY+ D C AL F  L ID R+ +Y
Sbjct: 1009 LYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDY 1068

Query: 879  YMDMQAALSPLRIRRLIDCGCEEVFE-QKGRALCGELVAGRLSRLHIHTHRMFGLPPAEE 937
            Y+D+ A L+    +R I     ++FE     A+      G +S + IH HRM+G PP   
Sbjct: 1069 YLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSP 1128

Query: 938  TYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAI 997
            +YF  W   +  L ++SD+ F  GFI+   K+GF F + +NI+ Y  + + +MTSVT+  
Sbjct: 1129 SYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHG 1188

Query: 998  DAIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASIIDKNKS--NK 1055
              I            + LN   I+    +  N  YSSR+DL V  L  +  D   S    
Sbjct: 1189 TGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKT 1248

Query: 1056 AIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFG 1115
             +  F T I  +NF Q++D   HS++Q+  IA ND+ FHRC FL+   +Q S  Y  L+G
Sbjct: 1249 CLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYG 1308

Query: 1116 CIPPGVSIPSLAVPLQTENVKAVFQGYLKAENA-SKDFVDRWFPVNEVKNKNSSSLKDFK 1174
             I P  S+P L +P+Q E +  +   +L      S + +        + + N        
Sbjct: 1309 GITPSSSVPPLPIPVQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHSSNKPLKPPSS 1368

Query: 1175 GQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQ 1234
              + PI    + L  S S     H   ++++    L I+P  +    N +++ + + I +
Sbjct: 1369 SVIHPIESMQSHLVPSQS---VTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENIIE 1425

Query: 1235 FIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVS 1294
             ID IE+ +V      +    +  NI++ +  LD  F   N E        +++  +Q+ 
Sbjct: 1426 TIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEG-------LELYVDQID 1478

Query: 1295 LDWSLKKGLKLPGSDNDPEDTTSLLKIESLD--LEVFNKLDKKTKFAEMDENI-AFGCSV 1351
            L+ S K   K        + T  L +I  L   L +   +++K    + DE   A   ++
Sbjct: 1479 LEVSQKTFQK--------KSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLAL 1530

Query: 1352 KELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFR 1411
            +  E WS       +SL + S + +V   +  WLID++ +      +L+N L     +  
Sbjct: 1531 EGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSN 1590

Query: 1412 KAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLP 1471
              +++    ++ AS+ YQI+HDP VITKPAY+ R+   HVR++RSW+IVTRLRHI  YLP
Sbjct: 1591 GIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLP 1650

Query: 1472 TTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVA 1531
                  +  +++  +    S + + FL +FSNW NW+ SDV + Y+Y+++F +  D+T +
Sbjct: 1651 DDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSN-DETTS 1709

Query: 1532 H---ESSTKIETGTFMLNFFDSINTGSDSVILKN--LKAQRTLEACKDEAAEKRS-NMSN 1585
                +++ K+   +     + +      ++IL    +  + T E       EK   NM+ 
Sbjct: 1710 EKKLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILNMTG 1769

Query: 1586 AEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKEN-----EKLPAFQQ 1640
            +   ++   S               ++LL +   F+ E +  ++ EN     EK P F  
Sbjct: 1770 SLGSIKGEFS------------DKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTI 1817

Query: 1641 YTALV-DRCDIQLLCG-ANRANLKSFGNTLTIVRENKSEDADAFSTAFAWSWFEFGIRHR 1698
            +  L+ +   +QL  G    +N  + G    ++ ++      ++S A+     E  ++H 
Sbjct: 1818 HLFLLFENGGLQLTMGDTTLSNNVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHN 1877

Query: 1699 NTILLD-AFSRSSAVGAHGFSGKNSRRKLDLRAKKFRLK-LPSESKHYCTFIDSLEESWN 1756
              I+ +        +    ++       ++LR+     K L S  K   T  D  E S +
Sbjct: 1878 KDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVH 1937

Query: 1757 -----NLRLALGPNTGFLEKPHSAATEKVAPQFALNXXXXXXXXXXXXXXXXXXXKNFKK 1811
                 +LR      T   +KP     EK+     +                       K+
Sbjct: 1938 LYKHYDLRKYTTKPTKVDQKP-----EKINFDVRVACNLSKVSAELTLISPFYLRYETKQ 1992

Query: 1812 LTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKL 1871
            L L + Q+    + L+    DI V S  T +QY + S  +I  + + P         V L
Sbjct: 1993 LDLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCN-PMSEKNKVLVVSL 2051

Query: 1872 DSNITKLKLYDPRDITLPLGKD---IAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFN 1928
             +++ KL   +PR I     +D     ++   L  LK  F   N KN K  ++    K +
Sbjct: 2052 SASLVKLTFSEPRRIFASFLQDERITIESFQELKKLKKIFFS-NAKNVKK-LNNDVPKED 2109

Query: 1929 FSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAA 1988
                W  ++ +NY G+L+P+ ST ++ EL+ +   +T    T +  +     + G +S  
Sbjct: 2110 TPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTN---TTEEIQEVNNQISGQISLE 2166

Query: 1989 SIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFL 2048
            +I FLINDR LP  LS++VDF++ I   +++     SLQIES +FR+  SP SLV +L+ 
Sbjct: 2167 NILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWG 2226

Query: 2049 VNELSRLSEL-----QKRQ-TVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVN 2102
            V +L    E       KRQ  +       +   +      FRS+ +LSYNFC+GW+   N
Sbjct: 2227 VKQLQNELEYYKDHKTKRQWNLSSHKTGTKSSTSESPLNYFRSIHILSYNFCIGWMLPEN 2286

Query: 2103 DSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPS 2162
                PG ++GY RLF+A+EK YGKLTL++ Y S+   ++S+DF++        NRSFLPS
Sbjct: 2287 QKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPS 2346

Query: 2163 MQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKK----QYVD 2218
            MQI YW++      +LFIR++G+ LDV  LS  +++   + KS  +F++ +K    Q ++
Sbjct: 2347 MQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIE 2406

Query: 2219 PFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLES 2278
              K   + K  +AT     F  LS I  ++C+ +Y GG  R++S+DDV+ ++ PS +L +
Sbjct: 2407 KQKHHEHIKSENATEFVPTF--LSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNA 2464

Query: 2279 PSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSP 2338
            P V I  +Y+        H LR  + ++SSHN ++  C P + E    I+++L+     P
Sbjct: 2465 PKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEP 2524

Query: 2339 QEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFT 2398
            +++  K ++  +  Y+  L   DI+F I   KQ +SFSCEP AKVQA++G +     + T
Sbjct: 2525 KQSVSK-IATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGIST 2583

Query: 2399 NDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIP 2458
                + +PLSL++ I +I+   +HIFS+E S S  ++ +   FI T P T++  G+  I 
Sbjct: 2584 GGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQP-TLYCVGL--IS 2640

Query: 2459 NIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEK-PLVAKFKKVSSTT 2517
            +ID++FN+KQ Q+L +F++IW     +  +P       +      + P   +  K+    
Sbjct: 2641 DIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNRKKRKHKKHKGHTQIPETPQPGKI---- 2696

Query: 2518 SFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDG 2577
              PWNF +I + +  DI LG +LG++S   ++ W I+D Y D  Q L L  + ++L S G
Sbjct: 2697 -IPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRG 2755

Query: 2578 RLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLK 2637
            RL G L + N  W   + +   E  + SP+V + + +    LK +FDYH+ +I+ V  + 
Sbjct: 2756 RLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIH 2815

Query: 2638 LKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETL 2697
             +L ++RDP G   +LL   +      +  T L  +NILD+YNTI+R R+D + SYFETL
Sbjct: 2816 FRLHSERDPEGKLPDLLLTTLLCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETL 2875

Query: 2698 GDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQ 2757
             +SN +DTR+     DIL SL+ LRT++++ +  + +QI P  LFD EVL     +   +
Sbjct: 2876 MESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSAR 2935

Query: 2758 SQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIP 2817
            S+    +KLKT L+ Q+    +ALS  K +L E++ ++I V +Y+ +A K  GGTIL+IP
Sbjct: 2936 SETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIP 2995

Query: 2818 AILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNG 2877
             +L+GMTTW  V +NT+E  ++  F GK+ +RWNLG +NF++EMWATHV+++A+R++   
Sbjct: 2996 KLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARIE 3055

Query: 2878 QP--RGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQ 2935
            +P      E E   E +       ++ YV L EP IE+PQ KDL +ATPP+EWFG+NRK+
Sbjct: 3056 EPVEYSSEELESSPESIYLEPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKK 3115

Query: 2936 FPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966
            FP  THQ  ++ +QKL H  E E+A+I+G +
Sbjct: 3116 FPSFTHQTAVIVVQKLVHAVEKEYAKIIGHS 3146

 Score =  164 bits (416), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 121/187 (64%), Gaps = 11/187 (5%)

Query: 4   QFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKIS 63
           +F  VSLS  + FSWVFLV W+L   + LL  FY  RVF Y+LTF+L+WL W+ YKVKI 
Sbjct: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65

Query: 64  IQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENID---- 119
            +S+++S L  RI FKNL ++T+N T S L+G I W+YWLLN+R +A+    +  +    
Sbjct: 66  CESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYI 125

Query: 120 ------KSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKN 173
                 K+++ LPC+F  +C+G E F+YNKT A++NI++S   ++  ++K+F   +   +
Sbjct: 126 TPGSGFKNIQ-LPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKHFRFS 184

Query: 174 TDECSVD 180
            D+  ++
Sbjct: 185 KDDTPIE 191

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 108/195 (55%), Gaps = 26/195 (13%)

Query: 219 LKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLP--DSKIDLYKIKVRNEFR 276
           L   P    + KG+++ GNK + S++++SY+  +G++D  LP  + ++DLYK+K++ +F+
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVD-VLPATNPRVDLYKMKMKLDFQ 356

Query: 277 KFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP 336
            F I +KPN+S E ++  K+F   S LS+LW +   LF    +P S+    S     +N 
Sbjct: 357 NFEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLH--KNS 414

Query: 337 L-------------KRWRGLGLYWKEEDAAW-----DDRFQFDLSKHEYARYTKVMKCDN 378
           L             K+W+GL LY   +DAA      ++  +FD   HEYARY  ++K   
Sbjct: 415 LFLEDNIFEDEDFEKKWKGLSLY---KDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPR 471

Query: 379 MLLEYAFDAPGIVPH 393
           ++    +D PGIVP+
Sbjct: 472 LIFTNEYDIPGIVPY 486

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 1103 bits (2852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/1568 (38%), Positives = 900/1568 (57%), Gaps = 86/1568 (5%)

Query: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61
             SQF  +SL   +DFSWVFLVDW+L L +S+   FY GR   + ++F+ EWL WKRY++K
Sbjct: 5    VSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLK 64

Query: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKA--SENID 119
            ++I+SL++S LGGRIFFKNLT++ ++ T SFL G I+WRYWL   R   F     +E+ D
Sbjct: 65   VNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDD 124

Query: 120  KSV----EKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTD 175
             +     EKL CR  +EC+G+E F+YN+T A+DN +    +E+  +F++F   N    TD
Sbjct: 125  GASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFL--NEHVFTD 182

Query: 176  ECSVD------------EDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPDSTPP-FLKLL 222
              S +            +D    +S+ E             NDR F   ++    FL  L
Sbjct: 183  RASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMA-NDRIFHDEETGKNLFLNYL 241

Query: 223  PLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISL 282
            PL+  V   + V+GNK + S++++S +  +GV+D C P  K+D+YK K+  + +   +SL
Sbjct: 242  PLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSL 301

Query: 283  KPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTR-----NPL 337
            K N+    E  LK  +   KLSKLW      F K  +   K    S K   R     N  
Sbjct: 302  KQNIGYNEEVLLKFKLTTGKLSKLWDN----FVKATAFVRKPLGLSRKKKNRPSVTANFH 357

Query: 338  KRWRGLGLY--WKEEDAAWD-DRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHG 394
            ++WRGL LY  +  ED   D D  +FDL+ HEYA++T ++KC   +L Y FD PG VPHG
Sbjct: 358  QKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHG 417

Query: 395  ALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQP 454
            A PT  ++DGPD+GN+G PP + ++IQ+ G SL YGPW+  ++  +Q L +P +SRD +P
Sbjct: 418  AHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKP 477

Query: 455  VEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVS 514
            V+ L PG +R+YT  +L I++  +  WRIPTRE+SKD EFL+ ++ T ++ RPFGWL++ 
Sbjct: 478  VKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLK 537

Query: 515  LSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGW 574
             S+ S   FN A+C TA G  NT+ +H    EIR+SVNHDI + +++      +G+PLGW
Sbjct: 538  FSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGW 597

Query: 575  NKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYS 634
            N+KA+W  +  S+Q + F+L++HITL+ D +SDF +GEPTPYELFRPF YT NW   GYS
Sbjct: 598  NEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYS 657

Query: 635  IYLXXXXXXXXXXXXXXXXXCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLN 694
            IYL                 CYLSFHGD L ++  VP++ I   +T I+Y ++TP+FRL 
Sbjct: 658  IYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLM 717

Query: 695  MNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGY 754
            +N P WNTL+EFMK KEVGR+ +F  +G+YL +++LDVDN+D I I C SKST L CYG+
Sbjct: 718  LNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGF 777

Query: 755  VLRYFLGVKMNYFGDFVHFKTTEEYMEELRGT-----NAVTKTTHDSETEIQEAPKQMDE 809
            V+RY + +KMNYFGDF HF T+EEY E++        +   K + D+ T + +  K  +E
Sbjct: 778  VIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKNNEE 837

Query: 810  DSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSL 869
            D       +K P       ++R  NE D+W TF + +G  +LPE +Y+CD C AL F  L
Sbjct: 838  DDK-----VKVP--RGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGEL 890

Query: 870  DIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFEQKGRALCGELVAGR--LSRLHIHTH 927
             ID+R  NYYMD+ A+L  + +R+  +    E+FE   R   G  V G   +S ++IH H
Sbjct: 891  AIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENV-RQCNGRDVKGHSYISNINIHGH 949

Query: 928  RMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPI 987
            RM+GLPP E TYFCKWDF LGT+ L S++ F  G + +++K+GFGF D EN++ Y+   +
Sbjct: 950  RMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVV 1009

Query: 988  LDMTSVTLAID--AIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTA 1045
             DMT+VT+ +    I+    ++     + LN         D EN  YS+R+D+ +  L  
Sbjct: 1010 DDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCN--IDFENEKYSTRMDIRIPLLKL 1067

Query: 1046 SIIDKN-KSNKAIA--SFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPL 1102
            S+   N +++K ++  +F T I  +NFC  ++ + H   Q+ +I  NDAPFHRC F++P 
Sbjct: 1068 SLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPA 1127

Query: 1103 TLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRWFPVNEV 1162
            + QNS  Y+ L+G I P  S+P L +PL  E  + + Q +L   N + D +    P  + 
Sbjct: 1128 SYQNSVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDCIILNLPYPDS 1187

Query: 1163 KNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGN 1222
             N NS S   +       L D     S    P  E +  V++     +SI PE +  I  
Sbjct: 1188 TNLNSDSFNSYPDTAPHTLSDTIIRKSPL--PEDERDNYVIDFRYISISIDPELFFYIEK 1245

Query: 1223 AVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDV 1282
             +   +     Q ID+IE+ +V           +  N ++ +   DV    + + +T  +
Sbjct: 1246 LLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVF---WGQRDTGGI 1302

Query: 1283 E---GQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDK-KTKF 1338
            E     +    N+ S++ + +K L          + T+L+K+ S+   V  K  + KT+ 
Sbjct: 1303 ELYLDTLDFEMNEKSIEKNREKSLT---------EVTTLMKLNSIRASVNAKYSRGKTE- 1352

Query: 1339 AEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQ 1398
                +  A    V+ ++ WS       +S+ L SI+A++   +  WL +F    F D K+
Sbjct: 1353 ---GQPPALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNF----FGDQKE 1405

Query: 1399 LINRLSYCTGQFRK----AEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRES 1454
            LI  +     + +K    + +E   R++ AS+ YQI+HDP VITKPA+ITRL   HVRE+
Sbjct: 1406 LIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVREN 1465

Query: 1455 RSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEK 1514
            RSWKI+TRLRHI+ YLP      +   LK  +Y     A+  F+ +FS+W NW++SDV +
Sbjct: 1466 RSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVAR 1525

Query: 1515 CYMYRRVF 1522
             Y+Y +VF
Sbjct: 1526 SYIYNKVF 1533

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1187 (35%), Positives = 667/1187 (56%), Gaps = 50/1187 (4%)

Query: 1814 LAYEQSASSALKLAFETLDIDVF--STRTTQQYLKISQSNISFSLHRPKKNNASPPTVKL 1871
            + ++ S+       F   D D++  S  T QQY ++S  NI       +  N +   + +
Sbjct: 1827 MEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVN-TIHNLDV 1885

Query: 1872 DSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSA 1931
             ++I KL   +P  +     +D  +    +  L+      +++ + + +  G        
Sbjct: 1886 SASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFSSEPEINTIPAGA-----KI 1940

Query: 1932 SWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIA 1991
             W     + Y+G+LIP+ +T ++ E++ + A +   ++     E  + +  G +S  +I 
Sbjct: 1941 DWRLNADIKYLGILIPVSTTFFVFEMHTLLASLADVDYGEIYREADEAS--GQVSVDNIL 1998

Query: 1992 FLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNE 2051
            FLI DR +P  LSR++D +  I   ++  E   S QIESP+ R   SP+SLVRIL+  ++
Sbjct: 1999 FLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQ 2058

Query: 2052 LSRLSELQKRQTVGKL---------PESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVN 2102
            L  L    +R     L             +   +F     F S  +LSYNFC+GW+F  N
Sbjct: 2059 LLALHSHYRRHHSKNLWDFLPKKEKKVEEDKTTSFFSTLTFGSCHILSYNFCVGWLFQNN 2118

Query: 2103 DSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPS 2162
               + GLI GY RLF+A+EK  GKLTL+DA+FS++ G TSD FY+  N  +  NRSFLP+
Sbjct: 2119 GDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPN 2178

Query: 2163 MQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFK- 2221
            +QI YW+++     ++FIR++GE LDV FLS  + +    ++S+ +F ELKK  V+P   
Sbjct: 2179 LQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQ 2238

Query: 2222 -------------------SVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYS 2262
                               +V   ++          P LS I++V+C+ +Y GG+F++YS
Sbjct: 2239 SEARSEEEEEESEEHNRRETVPGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYS 2298

Query: 2263 LDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNE 2322
             +D+++   PSF++ SP V I  DY+  +     H++R  + V S+HN +F  C P+L  
Sbjct: 2299 FEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMA 2358

Query: 2323 MARDIRQLLKGFN--RSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPK 2380
            +++DI+ ++K  +  + P+     S   +++DY+  L   DI F I   +Q++S SCEPK
Sbjct: 2359 LSQDIQHMVKKHSSKKKPEPKQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPK 2418

Query: 2381 AKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWI 2440
            AKVQA++GF+     + TNDLD SEPLS ++ +    +  RHIFSRE S S  +D +   
Sbjct: 2419 AKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVT 2478

Query: 2441 FILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSE-HSRAL 2499
            F+ THP+ I+ +G   I +++VYFN+KQLQ+L +F++IWK  + +  +P    E H  A+
Sbjct: 2479 FMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAI 2538

Query: 2500 TSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSD 2559
             +           +      PW F LI + I G +DLG SLG+LSL+  + W  +DHY  
Sbjct: 2539 DAPPS------SPMDVGNIIPWCFTLIFANINGKVDLGPSLGLLSLSMRKAWFASDHYES 2592

Query: 2560 WTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDL 2619
              Q L   +++I L++ GRL G + L    W + + WP  +  +  PLV L  ++    L
Sbjct: 2593 KRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWPKYDDPY--PLVALSFVISNISL 2650

Query: 2620 KLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVY 2679
            K++FDYH+ LI +V      L ++RD  G   +LL V ++     +  TAL  AN+LD+Y
Sbjct: 2651 KVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLY 2710

Query: 2680 NTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPS 2739
            NTI+RMR+D   SY ETL +SNT DT+     KDIL  L+ ++T++ V +  +++QI P 
Sbjct: 2711 NTIMRMRQDTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPI 2770

Query: 2740 KLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVK 2799
             LFD+EVL     +     +    EKL+T+L  Q++    +LS  K ++ E   S+I V+
Sbjct: 2771 SLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVE 2830

Query: 2800 EYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLR 2859
            +Y+ +A K  GGTI  IP + I M T+    ++ +E  Y ++FG KI +RWNLG +NF++
Sbjct: 2831 DYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIK 2890

Query: 2860 EMWATHVRAMALRRSHNGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDL 2919
            EMW TH++A+A+RRS +       E+  +E+++RD +   +  Y+ +EEP I+ PQ KDL
Sbjct: 2891 EMWTTHIKALAVRRSQSLVGTTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDL 2950

Query: 2920 GEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966
            G+ATP +EWFG+NRK+FP  THQ +IVP+QKL H AE E+A I+G +
Sbjct: 2951 GDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHS 2997

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 1091 bits (2821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/1740 (36%), Positives = 957/1740 (55%), Gaps = 84/1740 (4%)

Query: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61
             SQF+ V L+   +FSW+FLV W+L + +SL   FY GR   Y +TF+LEWL WK  KVK
Sbjct: 4    VSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVK 63

Query: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKS 121
            ++IQSL+IS LGGRIFFKN+T++ ++ T S L+G+ITWRYWL N+RK  F +AS  +D++
Sbjct: 64   VNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEAS--VDET 121

Query: 122  VEK--------LPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKN 173
              K        LPCRF V  +GLE F+YNKT A+DNI+    +E+  +F+ F  +    +
Sbjct: 122  QTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILSD 181

Query: 174  TDECSVDEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPDS-TPPFLKLLPLEYSVQKGA 232
            +      +DS    S                NDR FQ  ++ T  FL+ LP+++ V +G+
Sbjct: 182  SATVKSMDDSQFDTSE---STSTDKSESSATNDRVFQEEETDTSSFLRFLPIQFLVTRGS 238

Query: 233  VVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESEN 292
            +++GNK + S++++S +  D ++D   P  K+DLYK K+  E      +LK N+  + + 
Sbjct: 239  LILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDV 298

Query: 293  PLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPLK-RWRGLGLY----W 347
             +K  + R K+S++W+   ++      P      +  K+   +  + +WRGL LY     
Sbjct: 299  SMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKGTGL 358

Query: 348  KEEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDV 407
             E     DD  +FD + HEYA+++ ++K   +      D PGIVPHGA PT   +DGPDV
Sbjct: 359  GERRNDIDD-IEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGPDV 417

Query: 408  GNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYT 467
            GNSG PPDYS+DIQI G S+ +GPW+  +   L KL SPVVSR ++PV++LTPG +RIYT
Sbjct: 418  GNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIYT 477

Query: 468  RLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAM 527
              ++ + I+ ++ WRIPTRE+SKD EFL+ +RET  E RPFGW+++  S+ + V    A+
Sbjct: 478  YGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFAL 537

Query: 528  CPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSN 587
            CPT  GF N + +H  + E R+SVNHDILL  +         +PLGWN +A W  +  S+
Sbjct: 538  CPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNSS 597

Query: 588  QCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXX 647
            Q + FIL++HITL+ D ++DF SGEPTPYELFRPF Y+ NW   GYS+YL          
Sbjct: 598  QMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVNN 657

Query: 648  XXXXXXXCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFM 707
                   CYLSFHGD+L L+F +P+ +I    T I+Y + TP+FRL +NTP WNTL+EFM
Sbjct: 658  PLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNTLNEFM 717

Query: 708  KDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYF 767
            K KEVGRS +F + GSYL +S LD+DN+DTI+++C SK TTL+CYG+V+RY + VKMNYF
Sbjct: 718  KHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNYF 777

Query: 768  GDFVHFKTTEEYMEELRGT----NAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLT 823
            GDF HF T+EEY   +R         +++  D  +       Q ++   +R  H +    
Sbjct: 778  GDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQGNDAPGRRRLHTE---- 833

Query: 824  AKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQ 883
             +++ LKR  NE D+WFTF V +G  +LPE +Y+CD C  L F  L IDLR  NYYMD+ 
Sbjct: 834  LQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLL 893

Query: 884  AALSPLRIRRLIDCGCEEVFEQKGRALCGEL-VAGRLSRLHIHTHRMFGLPPAEETYFCK 942
            A ++ + I+R +     E+FE   +    E    G LS L IH HRM+GLPP E TYFC+
Sbjct: 894  ANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQ 953

Query: 943  WDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVF 1002
            WDF LGTLD++SD+ F  GF +++ ++GFG+ D ENI+ Y+     DMTSVT+ ++ +  
Sbjct: 954  WDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSV 1013

Query: 1003 CTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTAS--IIDKNKSNKAIASF 1060
               + K       +  ++   F D EN  YS+R+DL +  L  S  I +++ + K + + 
Sbjct: 1014 MLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTL 1073

Query: 1061 MTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIP-- 1118
             T +KI+NF Q QD   H + Q+ +I  +DAP+HRC F++P   Q++  Y+ LFG I   
Sbjct: 1074 ETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAPS 1133

Query: 1119 -----PGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDF 1173
                   V +         E++   FQ  L+  +  +       P ++       S  + 
Sbjct: 1134 SSLPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFR------MPFSDQDYATDVSDDET 1187

Query: 1174 KGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIE 1233
            +  + P L+ NT  S +  +   E ++ ++++    + I P+  + IG  +     + I 
Sbjct: 1188 EEDIDP-LEFNTP-SEAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTENIV 1245

Query: 1234 QFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQV 1293
            Q ID+IE+  V     +        N+++ +  LD+ + +           ++     + 
Sbjct: 1246 QIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEK 1305

Query: 1294 SLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKE 1353
            +++ + +K L          + T L KI S+   V N+    +K  E     A    ++ 
Sbjct: 1306 TVEENKEKKLI---------ELTVLNKIRSVRGTV-NQTAANSKNEERPP--ALSLVIEG 1353

Query: 1354 LEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYC-TGQFRK 1412
             E WS       +SL + S + +V   +  WL  +     N   Q+ + +    T Q RK
Sbjct: 1354 WEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFD---NQGLQIQDMIKTSDTIQKRK 1410

Query: 1413 AE--QEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYL 1470
             E  +E    ++ AS+ YQI+HDP VITKPA+ITRL   HVRE+RSWKI+TRLRHIL YL
Sbjct: 1411 IESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYL 1470

Query: 1471 PTTLISDIFNDLKNSEYPPRST-AEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDT 1529
            P    S I   L  S+    +  A+  F+ +FSNW NW++SD+ + Y+YR++F N   + 
Sbjct: 1471 PEDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQ 1530

Query: 1530 VAHES--STKIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAAEKRSNMSNAE 1587
              H +  S  I+  +F +  + +      + I+          +   +++  R  + N  
Sbjct: 1531 EIHTTKKSITIKIASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFN-- 1588

Query: 1588 DDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEKLPAFQQYT----A 1643
                  ++  +  A+  LSD    K++ ++ L          K  E     + +      
Sbjct: 1589 ------ITGTLGTAKGKLSD----KIIMIKNLLPSLKITDGGKSKETFDFVKSFKLNTLI 1638

Query: 1644 LVDRCDIQLLCGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWSWFEFGIRHRNTIL 1702
            L +R ++Q+  G  R   + FG  L+++ E+ K   + A S A      E  ++H N  L
Sbjct: 1639 LCERGELQIDIGNTRLVSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATL 1698

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1180 (37%), Positives = 694/1180 (58%), Gaps = 58/1180 (4%)

Query: 1810 KKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPP-- 1867
            K+L + + +  S+ + L+    DI + S  T QQY + S  ++       K N  + P  
Sbjct: 1808 KQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQL-----KGNMVNDPYH 1862

Query: 1868 -TVKLDSNITKLKLYDPRDITLPLGKD---IAQAKACLASLKSCFGKLNTKNDKDIMSQG 1923
              + L ++I KL + D + +     +D   + ++     +L   FG   +KN K    + 
Sbjct: 1863 INLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITL-DLFGL--SKNQKSKPEKD 1919

Query: 1924 NTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRG 1983
            N KF    SW     +NY GLL P+GS  ++ EL  + A +T       +   +Q  + G
Sbjct: 1920 NNKF----SWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTK----MGSDIPNQSDISG 1971

Query: 1984 DLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLV 2043
              S  ++ F I +R LP  LS+++DF++ +   ++ +    + QIES +FR+ LSP SLV
Sbjct: 1972 QFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLV 2031

Query: 2044 RILFLVNELSRLSELQK----------RQTVGKLPESVEVRETFRFRRAFRSVQVLSYNF 2093
            R+L+  N++S   +  K          R  +  +P++ ++           S  +LSYNF
Sbjct: 2032 RLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLP------LNVPSFHILSYNF 2085

Query: 2094 CLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFE 2153
            C+GW+F V+   EPGLI GY RLF+A+EK  GKLTL+D +FSIA G++SD+F++     +
Sbjct: 2086 CVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKD 2145

Query: 2154 NPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELK 2213
              NRS+LP+MQI YW +  G   +LF+R +GE LDV FLS  +DV    + S+  F ELK
Sbjct: 2146 KYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELK 2205

Query: 2214 KQYVD--PFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAG 2271
            K  +   P K   N  +    +T S  P L+ I+ + C+ +Y GGVF+++SL+D + ++ 
Sbjct: 2206 KDLIPGLPKKQKVNDDKTLELNTLS--PFLANIRSISCQFKYDGGVFKIFSLEDAETQSE 2263

Query: 2272 PSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLL 2331
            PSF++ SP+V I  +Y+ + +    H +R+ + + S+HN ++  C P+L++    I+ ++
Sbjct: 2264 PSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMV 2323

Query: 2332 KGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEK 2391
            K  + S +E++    S ++LDY+  L   DI+  I   KQQ+S SCEPKAKVQAD+GF+ 
Sbjct: 2324 KK-HSSSEESTLSKPSSQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQS 2382

Query: 2392 LAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHT 2451
                V TNDLD +EPLS S+ + +  A  +HIFSRE STSI +D +    + THPD I+ 
Sbjct: 2383 FIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINV 2442

Query: 2452 YGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFK 2511
            +G   I NI+++FN+KQLQ+L +F++IW+    + ++P  D   ++  +S     +A+  
Sbjct: 2443 HGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLS---IAQLS 2499

Query: 2512 KVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKI 2571
               S    PW F LI + +KGD+DLG SLGV+S+   R W  TDHY +  + L    +  
Sbjct: 2500 DPESI--IPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGT 2557

Query: 2572 LLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIA 2631
             LSS GRL G   L+  SW+S + WP    +   PLV++ + +DE   K +FDYH+ LI 
Sbjct: 2558 SLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIG 2617

Query: 2632 SVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRK 2691
            ++   ++ L +++D  G+  +LL V     S  L  TAL  ANILD+YNT +RMR+DN+ 
Sbjct: 2618 AINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKI 2677

Query: 2692 SYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKA 2751
            SY ETL +SN  +++      DIL SL+ L+T++ V +  ++IQI P  LFD+EVL    
Sbjct: 2678 SYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITI 2737

Query: 2752 KDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGG 2811
            +    +S+    +KL T L+ Q++   ++LS  K ++ E   S+I VK Y+++A K  GG
Sbjct: 2738 ESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGG 2797

Query: 2812 TILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMAL 2871
            TI+ IP +L+ MTT+ +  ++ +E LY+  F  K+ +RWNLG INF++EMW TH+RA+A+
Sbjct: 2798 TIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAV 2857

Query: 2872 RRSH-----NGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPV 2926
            RRS      +GQ      +E +E+++++ +    ++YV LE P I++PQ +DLG+ATPP+
Sbjct: 2858 RRSQVVGVLDGQ-----SEEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPM 2912

Query: 2927 EWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966
            EWFGVNRK+FP  THQ  +  +QKL + AE E+A ILG +
Sbjct: 2913 EWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILGSS 2952

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  962 bits (2486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1538 (34%), Positives = 815/1538 (52%), Gaps = 48/1538 (3%)

Query: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62
            ++F+ + +     F WVFLV+W  ++ +++   FY  R  GY +T +L W+ WKRYKV I
Sbjct: 5    TEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVVI 64

Query: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKSV 122
            +IQSL  S +GG+++FKN+++  ++QT S L+G+ TWRYWLLN R T    ++ N + S 
Sbjct: 65   NIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNINDENS- 123

Query: 123  EKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTDECSVDED 182
                CRF++EC G+E FIYNK   +++ILN L + D +  + F    +D  +    V  D
Sbjct: 124  ---KCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKF---ATDDESIFGRVKTD 177

Query: 183  SAGQRSHLEXXXXXXXXXXXXLNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIGNKTSSS 242
            S+     L+            LN  S QS  + P +L  LP E  +  GAVV+GNK + S
Sbjct: 178  SSVMFDPLDESSEQSKVGQTILNSVSNQS--AVPLYLDFLPAEVILSSGAVVVGNKHTPS 235

Query: 243  VMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVKRSK 302
            V ++ Y +++G++D   P S +D YK++   E     +S+KPN+S  + +  K      K
Sbjct: 236  VAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDGK 295

Query: 303  LSKLWHRSYQ-LFFKTDSPSSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRFQFD 361
               LW +    L F      +         G    L  W+GL +Y       + D   FD
Sbjct: 296  PFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFSDEIPFD 355

Query: 362  LSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPPDYSIDIQ 421
            L  HEYA+YT ++  D + L Y++D PG++    +  ++  D P      P P+YSID+Q
Sbjct: 356  LQNHEYAKYTTILNADRIKLLYSYDTPGVITETLIKGYENGDIP------PSPEYSIDVQ 409

Query: 422  ISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIVGESVW 481
            +  A+ YYGPW+H ++    K+FSP VSRD     +   G  R +   R  I+I+ +SVW
Sbjct: 410  LYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIMEDSVW 469

Query: 482  RIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDLH 541
            RIPT+E SKD  FL +++ T DE+R FGW+++ L++ + +   + +  +  GF+NT   +
Sbjct: 470  RIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASECGFENTFHAN 529

Query: 542  FVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHITLL 601
             V P I TSVNHD+L +A+ H + A   YP  WN    W    +S+  ++FIL+DH  LL
Sbjct: 530  LVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELFILRDHFNLL 589

Query: 602  GDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXXXCYLSFHG 661
             D+ +DF SG+  PYELFRP  Y F+W+ + YS+YL                 CY+S HG
Sbjct: 590  VDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCYISIHG 649

Query: 662  DDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSLS 721
            +  R+  ++P E I+  S  I+YE++TP F + + TP W+TLHEFM  + VGRS  FS S
Sbjct: 650  NSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLHEFMAQRFVGRSHEFSAS 709

Query: 722  GSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEYME 781
            GSYL ++ +D+DN+DTI +EC +   T   YG++LRY + +K+NYFG+F  F+TTEEY E
Sbjct: 710  GSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSE 769

Query: 782  ELRGTNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAK---KTSLKRMVNEKDV 838
            EL   N V     ++  + Q    ++ E +S  E    D L  K   K SLKR VNEKD+
Sbjct: 770  ELAQRNDVATDIFNNNDDDQTT--ELVEPNSYGESGF-DILHGKKIDKASLKRTVNEKDI 826

Query: 839  WFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLIDCG 898
            W TF  EDGCF+LPE+ YD  SC+ L FD++  D+R+++YY D+  +++   I+R  D  
Sbjct: 827  WVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYIKRYPDVS 886

Query: 899  CEEVFEQKG-RALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLP 957
               VF+  G          G LS  +IH HRMFGLPPAEETY  K D SLG L   SD+ 
Sbjct: 887  SNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYLSFESDIE 946

Query: 958  FTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETAIQLNA 1017
               GFI    K  FGF ++E++++Y++A   D++ ++   D I    + I     I L+ 
Sbjct: 947  ALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTNKFISLSI 1006

Query: 1018 QDISAKFADLENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDLLA 1077
             ++S K  D   S YS R ++D+ N    +   +  N  + +  TSI  + F +  D   
Sbjct: 1007 PNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNIVLGTISTSISFAIFSRNPDFKT 1066

Query: 1078 HSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKA 1137
             +  Q  HI  +DAPF RC FL P   Q S  YK L+  IPP  SIP L  P+   N   
Sbjct: 1067 TNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKLLYASIPPSSSIPLLPEPIGPNNFDT 1126

Query: 1138 VFQGYLKAENASKDFVDR-----------WFPVNEVKNKNSSSLKDFKGQLQPILDDNTS 1186
            +F+  L   +  +D++                ++E K  + +S    K +         +
Sbjct: 1127 IFENLLG--DIYQDYISEGTFDISNDTKLQLNIDEFKKHSENSFSKHKTK---------N 1175

Query: 1187 LSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLH 1246
            L+    D   E  + V  L +  + I  +  EV  +   Q     I   ID + +D+V +
Sbjct: 1176 LTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTISDTIDGLGVDIVNN 1235

Query: 1247 FIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLP 1306
            F K      +    +V+ P +D     Y      DV+       N++ L+  L++     
Sbjct: 1236 FSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDINKLDLNLRLRQEYD-K 1294

Query: 1307 GSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDEN--IAFGCSVKELEAWSYLNGIA 1364
             S N   ++ + L +      +  K+  K  F    E+   ++  + +ELE +++ +   
Sbjct: 1295 ESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSEFSYKSTFEELEGYAFYDDDL 1354

Query: 1365 DSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKA 1424
             +   L+     +  +  + + +F++  +      I  ++      +  ++E   RI++A
Sbjct: 1355 VTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQA 1414

Query: 1425 SDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKN 1484
              +Y I HDPPVITKPA ITRL   HVRESRSW+IVTRLRH+LNYLP         +L+ 
Sbjct: 1415 GQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNYLPQYWYETTSLELQK 1474

Query: 1485 SEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVF 1522
             ++     A+  FL+IF+ W +W+++DVE+C++Y++ +
Sbjct: 1475 GKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTY 1512

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/1160 (40%), Positives = 696/1160 (60%), Gaps = 45/1160 (3%)

Query: 1826 LAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRD 1885
            L+ +   +++ S    + Y+K S S +   +     N  +   + LDS+ +KL +++P+ 
Sbjct: 1810 LSLQDTSVELLSLEFQEPYMKYSHSYLKL-IGMDLGNTDNLGRISLDSSFSKLSIFEPKK 1868

Query: 1886 ITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLN--YVG 1943
                   DI QA   +  L+S    L TK+     S    +F FS     Q+ LN  Y+G
Sbjct: 1869 NMRLFLSDIEQAVKNIEILRSTM--LETKS-----STVQNEFPFSRLIPIQLNLNVEYIG 1921

Query: 1944 LLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLPEAL 2003
            LL+  G+T Y+ E N +    + D+    +S         D S+ SI FLI DR + E L
Sbjct: 1922 LLLDFGTTLYVLEFNNLEFSFSKDK---TSSNPVVPTFSSDYSSESICFLIKDRRVKETL 1978

Query: 2004 SRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQKRQT 2063
            S+V+DF++ IK+ + S   I+SLQIES Y    LSP SLVR+L  VNE S +  +     
Sbjct: 1979 SKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMKSIYHDIK 2038

Query: 2064 VGKLPESVEVRETFRFRR-AFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEK 2122
                P S     T      + +S  +LSYN C+GW+FD+  +   GLIWGY+RLFA ++K
Sbjct: 2039 ----PRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDK 2094

Query: 2123 PYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRI 2182
            PYGKLTLLDAYFS+A G +S  +Y   N     NRS+LPSMQI YW+E +  T +LFIR+
Sbjct: 2095 PYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRV 2154

Query: 2183 NGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFKSVANPKRPSATSTFSKFPGLS 2242
            NGE LDV  L+    +     +SL+ F +LK+  +DP K  +N       +     P  S
Sbjct: 2155 NGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKVTSNDPILGEWNYLDN-PLAS 2213

Query: 2243 TIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAW 2302
            +++ ++C + YAG   +LYS DD+Q+    SF++ SP+  +  DY+     K SH +R  
Sbjct: 2214 SVRSINCIINYAGSSMKLYSRDDIQH-GTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTL 2272

Query: 2303 MIVYSSHNTIFPTCVPVLNEMARDIRQLLKGF-----NRSPQEASHKSVSQESLDYRSFL 2357
              V ++HNT+FP CVP+LNEM      +LK       N +P  AS K+     ++YR  L
Sbjct: 2273 ATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKA----EINYRDLL 2328

Query: 2358 RGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEIT 2417
               DI+ +I++GKQ+IS +CEP AK+QA +GFEK  +K+FTN +   EPL LS+D++ + 
Sbjct: 2329 EAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLM 2388

Query: 2418 AKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVN 2477
            A SRH+FSRE+S+S+ + Q+S +F LTH + IHTYG   I     YFN+KQ++DLN+F+ 
Sbjct: 2389 ASSRHVFSREISSSLSLQQISMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLE 2448

Query: 2478 IWKPDSYVFTQPELDSEHSRALTS---EEKPLVAKFKKVSSTTSFPWNFILIISKIKGDI 2534
            IW  +     Q  ++      +T+   E  P + K ++V    +F W+++LIIS+I  +I
Sbjct: 2449 IWSIEK----QKSVNDIILAPVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEI 2504

Query: 2535 DLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRI 2594
            DLG SLG++ + +D +W ++ H  DWTQKL + M++I +SS GRLGG + +++  W S+I
Sbjct: 2505 DLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKI 2564

Query: 2595 RWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLL 2654
             WP+       PLV L + L  F+ KLSFDYH+  I++++   ++LFN++D RG   +LL
Sbjct: 2565 TWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLL 2624

Query: 2655 SVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDI 2714
            SV++S ++ Q+F+T+LA AN+ D+Y+TI RMR D+ ++  + L  +  K   S   SK +
Sbjct: 2625 SVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLLESNELKKISSFDNSK-M 2683

Query: 2715 LNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEG------DEKLKT 2768
            L SL  LRTEL V+ + +++ I+ + L   EV+  + +  +  ++ E       D K++T
Sbjct: 2684 LASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQT 2743

Query: 2769 HLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIGMTTWHD 2828
             L WQ+  + ++LS FK+QL E    +I V +Y++ A    GG IL  P+I + M TW  
Sbjct: 2744 ELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQS 2803

Query: 2829 VATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGFF--EDE 2886
              +N +ELLYS+SFG  + I WNL  INF+++MW+ H+ AM LR    G        +DE
Sbjct: 2804 QYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDE 2863

Query: 2887 HLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIV 2946
             +E KL  VDLG +Y Y PLEEP+IE+P+ KDLG+ATPPVEWFG+NR +FPGLTHQ ++V
Sbjct: 2864 DIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVV 2923

Query: 2947 PLQKLAHIAETEWARILGRA 2966
            PLQKL+ +AE E+ RILG+ 
Sbjct: 2924 PLQKLSAVAEKEYVRILGKV 2943

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1567 (33%), Positives = 824/1567 (52%), Gaps = 86/1567 (5%)

Query: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61
            +S F+ +S+S  +D S  FLVDW+L + + +L  FY GR+  + LT  L++  W++YK+K
Sbjct: 4    SSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKIK 63

Query: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKS 121
            I++QS+K+SFLGGRIFFKNLTVV+ + T SFL+GS TWRYWLL++R       SE+ D S
Sbjct: 64   INLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDGDAS 123

Query: 122  VE-KLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSD-KNTDECSV 179
               KLPCRF ++C GLE F+YNK   ++++L        + F +  +D  + ++ D+ ++
Sbjct: 124  ENAKLPCRFLLQCDGLEVFVYNKIDVYESVLR-------DHFTNVTKDGQETESNDDITI 176

Query: 180  DEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIGNKT 239
            + + A   S L               D    S  +     KL P++    + A+V+GN+ 
Sbjct: 177  NTEKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKT-----KLFPIQLEANRAAIVLGNRN 231

Query: 240  SSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVK 299
            +  V V  +E+  GV D     S +D Y+ K+  +       L+ NL  +++NP+K+FV 
Sbjct: 232  TRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVV 291

Query: 300  RSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRFQ 359
               + K+W    +           N   +  +  +  +  W+GL LY   +    ++   
Sbjct: 292  EKTMDKIWQTVKKQCISISKLLLPNQGKTI-NNQQAYIDSWKGLDLYHHTKAVQEENVDT 350

Query: 360  FDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGP---PPDY 416
              L + EYARY++VMK + + L Y FD PGIVP  +       D  +  N       P +
Sbjct: 351  TVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPAF 410

Query: 417  SIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIV 476
              DI I  A++YYGPW+H  +  + +LFSP+VSRD     +  PGS RIY   +LS+   
Sbjct: 411  GTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFR 470

Query: 477  GESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDN 536
             +SV  IPTRE+SKD EF+KR++ T D  R FGWL VSL+EG E+ FN+A+C  A    N
Sbjct: 471  DKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPN 530

Query: 537  TLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKD 596
             L +  + PEI++SVNH++L    T ++ A +GYP GWNK+A+W+F+  S   ++F+L+D
Sbjct: 531  ELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRD 590

Query: 597  HITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXXXCY 656
            HI+L+ D+ +DF + +   YELFRPF+Y   W FT Y ++L                 C+
Sbjct: 591  HISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLNVNDANIINNLLDLNENCF 650

Query: 657  LSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSA 716
            LS  GD L  +  +P  +I     +  + L +PL +L+++ P WNTLHEF+ +   G   
Sbjct: 651  LSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECP 710

Query: 717  NFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTT 776
            +FS++G+Y+    +DVDN DTI+I+  S ST    +G+VLRY + +K+NYFGDF HFKTT
Sbjct: 711  DFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTT 770

Query: 777  EEYMEEL---RGTNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMV 833
            EEY  +L     T   TK   +  T   E+      D S +     +  T  K+SL R  
Sbjct: 771  EEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINENTIHKSSLLRTK 830

Query: 834  NEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRR 893
            NE DVW TF V DGC I+PENLYDC   + L F  L+ D+R+ NY+MD+ A  S    R 
Sbjct: 831  NETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFS----RI 886

Query: 894  LIDCGCEEVFEQKGRALCGELV----AGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGT 949
             ++   E  F    R +  E       G L  L++H HRMFG+PP EETY CKWD S+G+
Sbjct: 887  YLNHSNEFSF---NRVVAIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGS 943

Query: 950  LDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKD 1009
            L   SD  F   F+ A +K+GF ++D ENI+ Y +    D+TS+T++I  +     +   
Sbjct: 944  LSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIV-RTNH 1002

Query: 1010 ETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNF 1069
              +  L+  DI+    DL NS YS RVDL VA ++   ID+ K+   + +  T+++++ F
Sbjct: 1003 GGSATLSLNDITINSWDLSNSRYSKRVDLLVAAISVCAIDEKKT--VLFTCDTAVELTKF 1060

Query: 1070 CQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPL-TLQNSSDYKGLFGCIPPGVSIPSLAV 1128
                ++  H   Q+  +  ND+PFHRC FL+    L +S+ Y  L G I P +S+P+L+ 
Sbjct: 1061 VVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLSE 1120

Query: 1129 PLQTENVKAVFQ----GYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDN 1184
            PL  +    +++     Y+   N   D +D          KN +  +    +L P+ +  
Sbjct: 1121 PLTFQTFDNIYERLLGSYINLINFDTDIID---------TKNLTDDRPDDKRLLPLSNTV 1171

Query: 1185 TSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVV 1244
            ++  S      FE     VN+    + ++P+ +    NA         E  +D  E+++V
Sbjct: 1172 SNDLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMSTESIMDYFEMNIV 1231

Query: 1245 LHFIKMASRQKNYKNIRVLMPTLDVLF--ETYNKENTYDVEGQVKVTANQVSLDWSLKKG 1302
              F         + N  V++  + V    ET   +   +   +++++ + +S+   + K 
Sbjct: 1232 NIFSVGHITNGKFFNSSVMLKNVKVNISDETALDKTQLEALDRLELSVSNISV---ISKI 1288

Query: 1303 LKLPG-------SDNDPEDTTSLLKIESLDLEVF----NKLDKKTKFAEMDENIAFGCSV 1351
            LK P        S    +D+T     +SL   +F    N+L K    A   E + F   +
Sbjct: 1289 LKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSKNRLTKVLPIAWF-EILMFNTVL 1347

Query: 1352 KELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCT--GQ 1409
                 +S +  +  S L   SI +++      W ++++ K    +K        C   G+
Sbjct: 1348 -----FSDVGKV--SKLIFGSIKSAILDADVEWTVEYLLKL---AKAFCKEGKSCIELGK 1397

Query: 1410 FRKAE-QEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILN 1468
             R  + +E   R+++      I   P +ITKPAYITRL   HVR++ SWKI+TRLRH+  
Sbjct: 1398 LRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWKIITRLRHVSK 1457

Query: 1469 YLPTTLISDIFNDLKNSEYPPRSTAEE--TFLEIFSNWGNWDYSDVEKCYMYRRVFTNTL 1526
            +  T+ +S+  +   +     R+  ++   FL+IF +W NWD  +VE+  ++  +F+   
Sbjct: 1458 H--TSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQSSLFTLLFSG-- 1513

Query: 1527 DDTVAHE 1533
             ++  HE
Sbjct: 1514 -ESTVHE 1519

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1121 (37%), Positives = 657/1121 (58%), Gaps = 52/1121 (4%)

Query: 1861 KNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIM 1920
            ++N     + LD++I KL L D R     L   +      ++ L   F   N  N+    
Sbjct: 1832 RSNTLLTDIGLDTDIVKLTLSDNRVYIEELTDSL---NGTVSELIKIFKNKNADNEP--- 1885

Query: 1921 SQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGA 1980
                 KF   +   F++   Y+GLL  L +T+Y+ E NE +AF  A         ++   
Sbjct: 1886 --AAPKFKPCS---FKMNAIYIGLLTDLKTTNYVLEFNE-TAFSCASRAEALEETHANDN 1939

Query: 1981 LRG-DLSAASIAFLI-NDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALS 2038
            LR   L   ++  L+ N  +LP  LS++ D   ++K+ ++  ++ ++LQIE+P+ R+ L+
Sbjct: 1940 LREMSLVIQNVCILVLNPEVLP-TLSKIFDIGFALKLIED--DIKKTLQIETPHSRVMLA 1996

Query: 2039 PFSLVRILFLVNELSRLSELQKRQTVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWI 2098
            P +L+ ++F + E +++S LQK +  GK   S    E   +     SV +LS   CLGWI
Sbjct: 1997 PSTLIAVIFFIQE-AKVS-LQKVKQKGKFNSSSNAIEIPPYFETL-SVNILSNKLCLGWI 2053

Query: 2099 FDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRS 2158
            F+  D+ E G++ GY+ LFAA+EKPYGKLT++D Y + A+G  S++F+   N     NRS
Sbjct: 2054 FE-EDTDENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFF-FANGVPELNRS 2111

Query: 2159 FLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVD 2218
             L SMQI +W   + +  +LF+R+N ++LDVR L+ S+++   +  S+  F +       
Sbjct: 2112 HLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQK------- 2164

Query: 2219 PFKSVANPKRPSATSTFSKFPGLS------TIQRVDCKVQYAGGVFRLYSLDDV-QNEAG 2271
                ++N K+ S+ ST +    LS      +I+ ++C  +Y GG+  LY+ DD+ Q+   
Sbjct: 2165 KLAKISNIKK-SSISTHNVAENLSDKVSILSIRSINCIAKYGGGIINLYTPDDIAQDSPK 2223

Query: 2272 PSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLL 2331
             S +L SPS+E+  DY      +  H +R+ + V S+HN +F +CVPVL  +  +I++ +
Sbjct: 2224 SSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQM 2283

Query: 2332 KGFNRSPQEASHKSVSQE------SLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQA 2385
            + FN   ++  HK+  Q       S DY++  +  D + +I++G Q I+ +CEP+AK+QA
Sbjct: 2284 ERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQA 2343

Query: 2386 DLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTH 2445
            DLGF    + +FT+  D SEPLSLS+   EI   +RHIFSRE+S+S  I+++   F+LTH
Sbjct: 2344 DLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTH 2403

Query: 2446 PDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKP 2505
             +TI TYG   I ++  Y N+KQLQ++ +F++IW P +      +L S        + + 
Sbjct: 2404 ENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTK--KAQKLGSGPHSGQKCQPQA 2461

Query: 2506 LVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLS 2565
            L        +T   PW + +I       ID+  SLG ++      W  + H  DW+  +S
Sbjct: 2462 LTE-----FTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVS 2516

Query: 2566 LQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDY 2625
              ++++   SDGRLGG   ++N  + S I WPV++  FE+PL+ L   +     K+ FDY
Sbjct: 2517 FYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDY 2576

Query: 2626 HLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRM 2685
            H  LIA V  L+L + N+RD  G+ ++LL V++S  S  +FLTALA AN+ D+Y T  RM
Sbjct: 2577 HSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARM 2636

Query: 2686 RKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDME 2745
            R +N+KSY +TL +SN + +     S + L +   LRT L   +    + ++PS LFD E
Sbjct: 2637 RIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPSTLFDSE 2696

Query: 2746 VLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHA 2805
            VL  KA     ++  + ++K KT L WQI  + I+L++FKN+L E+  +++ V+EY   A
Sbjct: 2697 VLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQA 2756

Query: 2806 RKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATH 2865
               +G  IL  P++ +G+TTW  +    +E LYS+SFG K+ I+WNL  INF+REMWATH
Sbjct: 2757 ALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATH 2816

Query: 2866 VRAMALRRSHN--GQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEAT 2923
            VRA+++RR H      + FFEDE++ EK++ V+LG +Y+Y+PLEEPHIE+P  +DLG AT
Sbjct: 2817 VRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNAT 2876

Query: 2924 PPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILG 2964
            PP+EWFGVNRK+FPG+ HQ ++VPLQKL ++AE ++ R LG
Sbjct: 2877 PPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/1523 (31%), Positives = 785/1523 (51%), Gaps = 111/1523 (7%)

Query: 32   LLGAFYFGRVFGYTLTFLLEWLAWKRYKVKISIQSLKISFLGGRIFFKNLTVVTQNQTFS 91
            +   FY GRV GY ++     + WK+Y+V +SIQSL  S L G++ FKN++V +Q+Q  S
Sbjct: 3    IFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLIS 62

Query: 92   FLQGSITWRYWLLNS-RKTAFAKASENIDKSVEKLPCRFRVECQGLEHFIYNKTQAFDNI 150
             L+G+ITWRYWL+   R++  A  +           CRF ++ +G E+F+YN+   +D I
Sbjct: 63   VLKGTITWRYWLIGRYRRSGTADGARR---------CRFALKFEGFEYFVYNRNGVYDRI 113

Query: 151  LNSLPREDLERFKDFFQDNSDKNTDECSVDEDSAGQRSHLEXXXXXXXXXXXXLNDRSFQ 210
               L  ED          +++      SV+E  A                   L D    
Sbjct: 114  ARELDGEDT---------SAEPTVSVPSVEEVIA------------------ELQD---- 142

Query: 211  SPDSTPPFLKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIK 270
                 P   + LP+E+   KGA+V+GNK + SV +++YEKL G +   +PD        +
Sbjct: 143  ----DPLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFR 198

Query: 271  VRNEFRKFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAK 330
               +     +++KPN+S E +NP+K +V+  + ++LW + Y+    T   ++ + A   K
Sbjct: 199  TEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLW-KKYKTLLGTVLEATLH-AKRKK 256

Query: 331  DGTRNP--LKRWRGLGLYWKEEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAP 388
            +  + P     WRGL +Y    D   D+  +FD+  HEYA+ T V+K D M + Y++  P
Sbjct: 257  EQHQTPKWYDNWRGLSMYDVNLDEELDEEVKFDIEHHEYAKCTTVLKADQMDVTYSYGMP 316

Query: 389  GIVPHGALPTFQTVDGPDVGN---SGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFS 445
            G        T +  D  +  N     P  D+S+DI +  A+  YGPW++ ++    ++FS
Sbjct: 317  G--------TARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFS 368

Query: 446  PVVSRD------SQPVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFR 499
            P V R+       +  +Q  P +       +LS+ I+ +SV R+P +E+SKD  FL++++
Sbjct: 369  PTVCRNFKLRTPEEIAQQTEPAA------FKLSVTIMEDSVLRVPMKESSKDAAFLEKYK 422

Query: 500  ETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSA 559
            +T DETRPFGW+++ +++ S +   +A  PT  GF+N L  + V   I TSVNHD LL A
Sbjct: 423  QTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKA 482

Query: 560  QTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELF 619
            ++H +     YP GW  KAEW F+  S Q ++F+L+DH+ L+ D+++DF  GE   YE F
Sbjct: 483  KSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQF 542

Query: 620  RPFSYTFNWNFTGYSIYLXXXXXXXXXXXXXXXXXCYLSFHGDDLRLNFEVPQENIAGNS 679
            RPF Y F W+  GYS YL                 CYLS HGDD  + F +P  +I    
Sbjct: 543  RPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKY 602

Query: 680  TKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTII 739
              +++ +FTP F L +N P W+T  E +  KE+GRS NF++ GSY  +S++DVDN+D + 
Sbjct: 603  VTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALN 662

Query: 740  IECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEYMEELRGTNAVTKTT------ 793
            I C +    + CYG +L+  L VK+NYFG+ VHF+TTEEY+EEL+  N    +T      
Sbjct: 663  IACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNS 722

Query: 794  ----HDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCF 849
                HDS+    E+ + +D            P T KK++LKR +NE DVWFTF+ + GCF
Sbjct: 723  DGNVHDSDVVATESNEIIDASFDA----FGGPPTIKKSALKRSINELDVWFTFISKGGCF 778

Query: 850  ILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFEQ-KGR 908
              PEN+Y  D+C    FD+L+  LR +NYY+D   +L  +  +R  D     +F+  +  
Sbjct: 779  FFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDI 838

Query: 909  ALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKK 968
             +  +     LS+     H+M G+ P+EE+Y C++D  + TLD+  DL     F+N  + 
Sbjct: 839  GIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRN 898

Query: 969  LGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKI-KDETA-IQLNAQDISAKFAD 1026
            L FGF+D EN + Y+   + D+  ++  I+ +      + KDE   + LN    +    D
Sbjct: 899  LAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFD 958

Query: 1027 LENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHI 1086
            L N  YS R DL +  L   I   +  +  + +F T + ++ F + +        Q+ HI
Sbjct: 959  LANERYSRRSDLSIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHI 1018

Query: 1087 ASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQ---GYL 1143
              NDAPFHRC F++P   +    Y+ L+GCIPP  S+P    P+  +N + +F+   G +
Sbjct: 1019 LVNDAPFHRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLLGEI 1078

Query: 1144 KAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQ-LQPILDDNTSLSSSFSDPTFEHNTLV 1202
              E AS    D  + + +  +  SS+  D+  Q +   +  ++SL     +     ++ +
Sbjct: 1079 YQEYAS----DSSYQITD--DSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFI 1132

Query: 1203 VNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRV 1262
            V  +     +     E +    +   +  +++ ID++E+ ++  FI+          +RV
Sbjct: 1133 VEFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRV 1192

Query: 1263 LMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIE 1322
            L P + +     NK++ + +    K+++   +LD + +     P    DPE TT   KI+
Sbjct: 1193 LCPNISL--SATNKQSKFSM---FKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKID 1247

Query: 1323 SLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGIA--DSSLYLKSINASVALD 1380
             +     N +           +  F CS++ LE +   + ++  D+++   S+  S   D
Sbjct: 1248 YIRA---NIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTD 1304

Query: 1381 KFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKP 1440
            K   L +F+    +    L   LS        +++EF   I +   +Y+I HDPPVITKP
Sbjct: 1305 KL--LFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKP 1362

Query: 1441 AYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEI 1500
            A ITR  ++H+R + SW+I+ RLRHILNYLP          L   ++     A + FL I
Sbjct: 1363 ANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSI 1422

Query: 1501 FSNWGNWDYSDVEKCYMYRRVFT 1523
            FS+W +W+ +DV+  +++ +VFT
Sbjct: 1423 FSDWRSWEPTDVQGSFVHEKVFT 1445

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1184 (36%), Positives = 673/1184 (56%), Gaps = 70/1184 (5%)

Query: 1824 LKLAFETLDIDVFSTRTTQQYLKISQSNISFSL----HRPKKNNASPPTVKL------DS 1873
             +L  E+ D  +F   + + Y++IS +          H   K + +  + +L      D 
Sbjct: 1732 FELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDI 1791

Query: 1874 NITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSASW 1933
             I KL ++D +     L +DI   KA L S+KS    LN       +SQ +   +   SW
Sbjct: 1792 GILKLSVFDLKTRITDLLQDI---KAALFSMKSLSDILN-------ISQSSPTASAFGSW 1841

Query: 1934 I------FQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSA 1987
                     ++  Y GLL+  G T YI E N   A  T D   +  +   +   + D S 
Sbjct: 1842 FSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKHTRDGLPDAIT--PRPCFKVDHSI 1899

Query: 1988 ASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILF 2047
             S +FLI DR + + L++VVDFAV+  +  +++  I+S+QIES + +I L+P ++VR+L 
Sbjct: 1900 ESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLLS 1959

Query: 2048 LVNELSRLSELQKRQTVGKLPESV-------EVRETFRFRRAFRSVQVLSYNFCLGWIFD 2100
            L+NE   + +    +++   P S        E  E   +R   +S  +LS++F + W+FD
Sbjct: 1960 LINEFGIIRKQFTEESI-YTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFD 2018

Query: 2101 VNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSD-DFYAHKNSFENPNRSF 2159
            + +S   GLI GY RLF+ +EKPYGKLTLL+AYFS A+   S+ DFY+     +  N S+
Sbjct: 2019 IPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSY 2078

Query: 2160 LPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDP 2219
            L  MQ+RYW        +LFIRI+G +L V   ++ + +    ++S+  F+ LKK  VDP
Sbjct: 2079 LSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDP 2138

Query: 2220 FKSVANPKRPSATSTFSKFP-----GLST-IQRVDCKVQYAGGVFRLYSLDDVQNEAGPS 2273
            F++          S  SK P      L+T ++ ++C + YAG   +L+S D  + +A P 
Sbjct: 2139 FRT------KKQDSDISKEPYNWNNQLATGVRSLNCIINYAGVTLKLHSHDG-RGDASP- 2190

Query: 2274 FQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKG 2333
             +L SPS ++  DY+   + + +H  R  +    +HNT + T   +++++     +LLK 
Sbjct: 2191 LELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFSKLLKT 2250

Query: 2334 F---NRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFE 2390
                N+S   ++  S+  E  D  + L   D+  ++++GKQ+++FSCEPKAKVQA +GFE
Sbjct: 2251 SSTENKSSSASTSSSIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGFE 2310

Query: 2391 KLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIH 2450
            K  +K+F N+++  E L L+I+I  +   SRHI+SREV  S+K+  +S +F +       
Sbjct: 2311 KFDIKIFNNNINDEESLCLAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRR 2370

Query: 2451 TYGIMHIPNIDVYFNIKQLQDLNIFVNIWKP-----DSYVFTQPELDSEHSRALTSEEKP 2505
             YG   I +   YFN+KQLQDL +F++ W P     ++  + +  L  + SR++ S    
Sbjct: 2371 IYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQKTPMNTGSYPEGVLVDDISRSIGS---- 2426

Query: 2506 LVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLS 2565
               KF K SS++SF W + +I++    +I+LG SLGVL++T++ +WAI+    DW+Q+L 
Sbjct: 2427 ---KFYKGSSSSSFTWGYSVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLD 2483

Query: 2566 LQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDY 2625
            L M K+ ++S GRLGG  L+RN      ++WP  +  F+ PLV + +  D  D KLSFDY
Sbjct: 2484 LNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDY 2543

Query: 2626 HLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRM 2685
            H   I+S++     LFN+RD  G   +LLSV +S  S  +FLTALA ANI D+ N+I R+
Sbjct: 2544 HTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANISDIKNSITRL 2603

Query: 2686 RKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDME 2745
            +KDN  SY  +   S+ + +        I ++LS LRT+L ++L    +QI P+ LFD +
Sbjct: 2604 KKDNELSYLSSFLASD-QPSDEPEEDGGIFDTLSLLRTQLSLNLGVFRLQISPTSLFDSD 2662

Query: 2746 VLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHA 2805
            VL   A   +  + I+ D K+KT L WQ+  V +AL  F N L E   + + V +YIE +
Sbjct: 2663 VLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELS 2722

Query: 2806 RKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATH 2865
                GG I   P+I++ MTTW +  +N +ELLYS SFGG + IRWNLG I+F+++MW  H
Sbjct: 2723 STIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAH 2782

Query: 2866 VRAMALRRS-HNGQPRGFFEDEHLEEKL--RDVDLGDEYEYVPLEEPHIEIPQTKDLGEA 2922
            + AM LR   ++G          L  K    ++ LG +Y+Y+PL+EP IE+P+ KDLG+A
Sbjct: 2783 MNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDA 2842

Query: 2923 TPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966
            TPP+EWFGVNR +FPG THQ +IVPLQKLA  AE E+ +ILGRA
Sbjct: 2843 TPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKILGRA 2886

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score =  103 bits (258), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 55/62 (88%)

Query: 1  MASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKV 60
          M+S+F+RV +ST +DFSWVFL DWVLILSVSLL AFYFGRV GYT+T +LE+LAWKRY V
Sbjct: 1  MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60

Query: 61 KI 62
          K+
Sbjct: 61 KV 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 316,836,451
Number of extensions: 14420437
Number of successful extensions: 44137
Number of sequences better than 10.0: 49
Number of HSP's gapped: 44599
Number of HSP's successfully gapped: 69
Length of query: 2966
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2838
Effective length of database: 38,804,151
Effective search space: 110126180538
Effective search space used: 110126180538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)