Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13706g8.261ON58458428280.0
Kwal_56.238048.261ON57858320660.0
SAKL0H17050g8.261ON58456318350.0
AGR087C8.261ON57757717250.0
Ecym_43098.261ON57756417050.0
TDEL0F038808.261ON57956616880.0
KLLA0F19118g8.261ON57856616770.0
TBLA0F030808.261ON58356816350.0
YLR088W (GAA1)8.261ON61460116290.0
NCAS0B038608.261ON58356816090.0
Kpol_543.378.261ON57856515660.0
Smik_12.1478.261ON61360015640.0
ZYRO0C01672g8.261ON56956415520.0
Suva_10.1728.261ON61460015480.0
Skud_12.1568.261ON61259815480.0
CAGL0L12232g8.261ON59158115000.0
NDAI0J013908.261ON58358314870.0
KNAG0H032508.261ON58557914860.0
TPHA0A018208.261ON58158314460.0
KAFR0B055508.261ON55555214060.0
Kwal_26.71547.86ON121344733.5
ZYRO0D08492g6.329ON584114706.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13706g
         (584 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...  1093   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   800   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   711   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   669   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   661   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   654   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   650   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   634   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   632   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   624   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   607   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   607   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   602   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   600   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   600   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   582   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   577   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   577   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   561   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   546   0.0  
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    33   3.5  
ZYRO0D08492g Chr4 complement(733481..735235) [1755 bp, 584 aa] {...    32   6.1  

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/584 (91%), Positives = 535/584 (91%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           VAVHITEHEGMKVSLNGVSEEEMEKRNYFS            ALSGVQSCYGNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            TLDCVLKSGASNTPAFSVHNLSAVIGFTV             HWQYS
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLLA 480
           SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAF            INFALAFGIGLLA
Sbjct: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLLA 480

Query: 481 FPLILVKAPMTSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGC 540
           FPLILVKAPMTSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGC
Sbjct: 481 FPLILVKAPMTSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGC 540

Query: 541 WTWSVVCIGWLPSWLLVACSGIPMPYQPVGGPSQRLGSSTKKTQ 584
           WTWSVVCIGWLPSWLLVACSGIPMPYQPVGGPSQRLGSSTKKTQ
Sbjct: 541 WTWSVVCIGWLPSWLLVACSGIPMPYQPVGGPSQRLGSSTKKTQ 584

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/583 (68%), Positives = 456/583 (78%), Gaps = 6/583 (1%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MALIE+LQR++IDLGLLPRIVRFLPKLS+LCGI+GI W+TLLLPLEGQYRHTYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRETEWNILRGYRTQIQ LE KSS ERNE++ SW QEFG KTA YED+  GNT
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YGVLHAPRGDGTEAMVL+APW+NGDGE+N GG AL  AL+R+FSRWPVWSKNII+VFSD
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           DP+ASLRSWV AYHTSLDLTGGSIESAVVLDYPG NDFFKYVEIYYAGLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           VA+H+TEHEGMKVSLNG+ E+EM+ R+YF+            ALSGVQ CYGNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQA+VLRARG  GPFDITTFGR+PEA FRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P             LD VL  GAS + +  + N++AV+GFTV              + + 
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLLA 480
            +LIS + + A+ P +  R  I++S++++ K+VA+            +NFALAFGIGLLA
Sbjct: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLLA 480

Query: 481 FPLILVKAPMTSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGC 540
           FPLILVK   T R   KN++LL+LSNPFIST LF   FEP L GLQ+  +LVQAW + GC
Sbjct: 481 FPLILVKNSTTPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGC 540

Query: 541 WTWSVVCIGWLPSWLLVACSGIPMPYQPVGGPSQRLGSSTKKT 583
           WTW VVCIGWLPSWLL+A S +      +   S  L S+ KK+
Sbjct: 541 WTWCVVCIGWLPSWLLIAYSSM------ITDVSTLLNSAEKKS 577

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/563 (60%), Positives = 422/563 (74%), Gaps = 1/563 (0%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MAL+EKL RR ID+GLLP+ +  LP LSI C ++G+ WL L +P +GQ+R TYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRETEWN+LRGYRTQI++ ++ S+ ERNE V+SW Q+FGAKTA Y ++ +G T
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YG+LHAPRGDGTEAMVLAAPWYN + +YN GG ALA +LSRFFSRWPVWSKNIIIV S+
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           DP+A+LRSWV AYHTSLDLTGGSIE+AVV+D+PGSNDFFKYVEI++ GLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           VAVHITEHEGMKVSL+G+SEEE+ K ++FS            ALSG++  +GNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           I ++ L+A GTDGPFDITTFGRIPEA FRSVNNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            +L+ +L +  ++ P  S +N+ A++GF V             +    
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLLA 480
            LL+S N ++ ++P IF R  I    SY+ KS A+            +NF+LAFG+G LA
Sbjct: 421 ELLLSLNVLLLLMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480

Query: 481 FPLILVKAPMTS-RQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLG 539
           FP+ LV+    + R R+KN +LL++SNPFI+  LF    + +L G+Q+F+ L  AW+ LG
Sbjct: 481 FPMTLVRTTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLG 540

Query: 540 CWTWSVVCIGWLPSWLLVACSGI 562
           CWTW V+CIGWLPSWLLVA SGI
Sbjct: 541 CWTWFVICIGWLPSWLLVAYSGI 563

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/577 (55%), Positives = 417/577 (72%), Gaps = 4/577 (0%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MA++EKL R+++D+GL+P+I+  L K+S +  +L + WLTL LP+EGQYR TYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRE+EWNILRGYR++I  +   ++ ERN +VASW +E+GAK A Y DD HG T
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +Y VLHA RGDGTEAMVLAAPW   +G+YN GG ALA A+ R+FSRWPVWSKNIIIV S+
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           DP ASLRSWV AYHT LDLTGGSIE+A+VLDYPG+ND+F++VEI Y GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           VAVHITEHEGMKV+L+G   EE+    YFS            ALSG++   GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ++ L+ARGT+G FDITTFGR+PEA FRSVNNLLEKFHQSFFFYLLLAPRYFVSI SYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P              D VL +  ++ P  S++N+ A++ F+V             +    
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLLA 480
           +LL++ N V++ +P    +  I+   S++FK+ A+            +NF LAF +GLLA
Sbjct: 421 ALLLAFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480

Query: 481 FPLILVKAPM--TSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKL 538
           FP+  V+  +  + RQ++KN++LL+LSNPFIS  +FV+ FEP+L+G  +F+ L+ AW  L
Sbjct: 481 FPMTFVRTTVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDAWNDL 540

Query: 539 GCWTWSVVCIGWLPSWLLVACSGIPMPYQPVGGPSQR 575
           GCWTW V+C+GW P+W++VA S I     P+  P+++
Sbjct: 541 GCWTWYVLCLGWYPAWIMVAYSSIDS--VPIAAPAKK 575

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/564 (55%), Positives = 401/564 (71%), Gaps = 2/564 (0%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MA++EKL RRI+D+GL+PRI+  LPK+SI C +L I WLTL LPLEGQYR TYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRE+EWNILRGYR +++ L++    ERN +VASW +E+GAKT+   ++ +G T
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YG++H  RGDGTEAMVLAAPW   DG YN GGAALA +L+R+F+RWPVWSKNII+V S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           DP+ASLR+WV AYHT LDLTGGSIESAVVLDYPG+ND+FKY+EI Y GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
            AVHI+EHEGMKVSL+G+   E+ +  Y               L+G+++  G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ++ L+A G DGPFD+TTFGR+PEA FRSVNNLLEKFHQSFFFYLLL+PR FVSI SYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            + D +L +  S  P  S++N+ A+  F V             +    
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLLA 480
           SLL++ N  ++ +     +  I+   SY+FK+ A             +NFALA  +G+LA
Sbjct: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVLA 480

Query: 481 FPLILVKAPM--TSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKL 538
           FP+ L K     T +Q+++N++LL+ SNPFI++ +    FE QL+G  LFH L+ AW +L
Sbjct: 481 FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL 540

Query: 539 GCWTWSVVCIGWLPSWLLVACSGI 562
           GCWTW V+CIGW PSW+LVA S I
Sbjct: 541 GCWTWYVLCIGWYPSWILVAYSSI 564

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/566 (56%), Positives = 407/566 (71%), Gaps = 6/566 (1%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           M+LI KL RR+IDLGL+P+IV  LP LS+L  ++ + WL LL PLEG+YR TYISENAL+
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALL-PLEGRYRRTYISENALL 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRETEWN LRGYRTQI+ L   +S+ERNE VA W +EFG KTA Y+D+ HG+T
Sbjct: 60  PSQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDT 119

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YGVLHA RGDGTEA++LAAPW N DG  N+ G ++  AL+RFFSRWPVWSKNII+V S+
Sbjct: 120 LYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSE 179

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P+ S+RSWV AYHTSLDLTGGSIE+AVVLDYPG ND+F +VEI+Y GLNGE PNLDLVN
Sbjct: 180 NPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           +A+ ITEHEGMKVSL+GVS +++   +++S            ALSG++   GNEAFSGWR
Sbjct: 240 IAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWR 299

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQA+ L+A GT+G  D+TTFGRIPEA FRS+NNLLEKFHQSFFFY+LLAPRYFVSI+SYL
Sbjct: 300 IQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            +LD ++ +     P  S +NL ++  + +              +   
Sbjct: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419

Query: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLLA 480
           ++LIS +A+I+ LP +  ++ I    +Y+ KSVAF            +NF LAF +GL A
Sbjct: 420 TILISFSALISFLPLLL-KKKIAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 481 FPLILVKAPMTS----RQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQ 536
           FP+ LV+    +    R ++KN+ILL+LSNPFI++ +F   FEP L G  +F     AW+
Sbjct: 479 FPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538

Query: 537 KLGCWTWSVVCIGWLPSWLLVACSGI 562
           +LGCWTW V+CIGWLPSWL+VA S +
Sbjct: 539 ELGCWTWFVICIGWLPSWLMVALSTL 564

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/566 (54%), Positives = 406/566 (71%), Gaps = 4/566 (0%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MAL+EKL RRII +GL+P+ +  L +LS+LC ++G+ WL  +LP +GQ+R TYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSK-ERNEVVASWFQEFGAKTAFYEDDLHGN 119
           PSQAYSYFRE+EWNILRGYRTQ+ + +  S+  + N  V+ W QEFG KTA Y+D+ +G 
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 120 TMYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFS 179
           T+YG+ HAPRGDGTEAMV+AAPWYN + EYN GGAALA +L RFFSRWPVWSKNIIIV S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 180 DDPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLV 239
           +DP+ASLRSWV AYHTSLDLTGGSIESA+VLDYPG++D F Y+EI+Y GLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 240 NVAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGW 299
           NVAVHI EHEG+KVSL+G+   E+++ +Y S             LSG+++CYGNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 300 RIQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASY 359
           RIQ++ L+A+G DGP DITTFGR+PEA  RSVNNLLEKFHQSFFFYLLLAPRYF+SI +Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 360 LPXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQY 419
           L              L+ +L +     P  S++N+ +++ F +             ++  
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 420 SSLLISCNAVIAVLPAIF-GRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGL 478
             +L+  + + +VLP +   R  I+   SY+FK+ A+            +NF+LA  +GL
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 479 LAFPLILVKAPMTSRQR--VKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQ 536
           LAFP+      + S  R  +KN +LLI+SNPFI+T   VN  EP+LSG ++F+ L++A Q
Sbjct: 481 LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ 540

Query: 537 KLGCWTWSVVCIGWLPSWLLVACSGI 562
           +LGCWTW ++C+GW PSWLLV  + I
Sbjct: 541 QLGCWTWYIICLGWYPSWLLVTYASI 566

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/568 (53%), Positives = 402/568 (70%), Gaps = 7/568 (1%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MAL+  + RR+ID+GL+P+I++ LP +SI    +GI  L L+LP++GQYRHTYISENALM
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRE+EWNILRGYRT+I +     S++RN V+  W +EFG KT+ Y +D +G+T
Sbjct: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDT 119

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YG+ +APRGDGTEA+VLA PWYN DGE+N GGAAL  ALSRFFSRWP+WSKNII+VFS+
Sbjct: 120 LYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSE 179

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P+ +LRSWV AYH SLDLTGGSIE+A+V+DYP S+DFF YVEIYY G+NGELPNLDL+N
Sbjct: 180 NPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLN 239

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           +A+ ITEHEGM+VSL+G+ +E + + NYFS             LSG++  +GNEAFSG+R
Sbjct: 240 IAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFR 299

Query: 301 IQAIVLRARGT--DGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIAS 358
           IQAI L+A+ T  +   DIT+FGRI EA+FRSVNNLLEKFHQSFFFYL+LAP+YFVSI+S
Sbjct: 300 IQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISS 359

Query: 359 YLPXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQ 418
           YLP            +L   + +  S  P FS +NL A + FT+              + 
Sbjct: 360 YLPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFT 419

Query: 419 YSSLLISCNAVIAVLPAIFG-RQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIG 477
              LL+  +  ++VLP + G R  I    SY+ KS+AF            +NF+LAFGIG
Sbjct: 420 EPRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIG 479

Query: 478 LLAFPLILVKAPM---TSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQA 534
           +L F +  VK      + R RV+NT+ L+LSNPF S LLF   F+  + G+++F+  + +
Sbjct: 480 ILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539

Query: 535 WQKLGCWTWSVVCIGWLPSWLLVACSGI 562
           W  L CWTW ++C+GWLP W+LV+ S I
Sbjct: 540 WNTLNCWTWFIICVGWLPPWILVSISSI 567

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/601 (52%), Positives = 398/601 (66%), Gaps = 42/601 (6%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MAL+EKL RRI+D+GL+PRI+  LP +S+LC + G   + +L P++GQYR TYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAIL-PMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRE+EWNILRGYR+QI+ +   +S ERN ++ SW QEFG KTA YE++ +G T
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YGV+HAPRGDGTEAMVLA PW+N D E+NIGGAAL  +L+RFFSRWPVWSKNII+VFS+
Sbjct: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P A+LRSWV AYHTSLDLTGGSIE+AVVLDY  + DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           +A+ ITEHEGMKVSL+G+  +++   N++S            ALSGV+  +GNEAFSGWR
Sbjct: 240 IAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWR 299

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ++ L+A G  G  DITTFGRIPEA FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            +L+  + +  +N   FS +NL A++ + V                 S
Sbjct: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418

Query: 421 SLLISCNAVIAVLPAIFGRQ-GIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLL 479
            LL++ +     LP I  R+  I    SY+ K+VAF            INFA+A  IG L
Sbjct: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 480 AFPLILVK---------------------------------------APMTSRQRVKNTI 500
           AFP+  VK                                        P   +Q++KN +
Sbjct: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLV 538

Query: 501 LLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGCWTWSVVCIGWLPSWLLVACS 560
           LLIL+NPFIS  LF   F+ +  G  + ++LV AW  L CW+W V+CIGWLP WLL+  S
Sbjct: 539 LLILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598

Query: 561 G 561
            
Sbjct: 599 S 599

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/568 (53%), Positives = 402/568 (70%), Gaps = 7/568 (1%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           M L E++QR++I  GL+P+++  LP +S LC +LGI  +  +LP EGQYR+TYISENALM
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIV-IIGILPFEGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRE+EWNI+RGYR+QI  L   S+ ERN +++ W Q+FG KT  Y++   G+T
Sbjct: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDT 119

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YGV HAPRGDGTE+MVLA PW+N DGE+N+ GAAL  AL+R+FSRWPVWSKNII+VF++
Sbjct: 120 LYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTE 179

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P+A+LRSWV AYHTSLDLTGGSIE+A+VLD+ G  D F Y+EIYY GLNGELPNLD+VN
Sbjct: 180 NPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVN 239

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           + V   EHEGMKVSL+G   +++++   FS            ALSGV+  YGNEAFSGWR
Sbjct: 240 IGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWR 299

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ++ LRARG +GPFD+T+FGR+PEA FRS+NNLLEKFHQSFFFYL+LAPR+FVSI+SYL
Sbjct: 300 IQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            +L+    +     P FS++ L +++ + V             +  + 
Sbjct: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419

Query: 421 SLLISCNAVIAVLPAIF-GRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLL 479
           ++L++ N +I + PAI  G   ++   SY+ +S AF            +NF LAFG+GLL
Sbjct: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLL 479

Query: 480 AFPLILVK-----APMTSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQA 534
           +FP+  VK      P  SR RVKN++LL++SNPFI+T LF    + + SGL +F RLV A
Sbjct: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539

Query: 535 WQKLGCWTWSVVCIGWLPSWLLVACSGI 562
            ++LGCWTW V+C+GW   WLLVA S +
Sbjct: 540 SRELGCWTWLVLCVGWWTPWLLVAISAL 567

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/565 (52%), Positives = 393/565 (69%), Gaps = 5/565 (0%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           M+++E LQRR+ID GLLP+ +  LPKLS+L   + +  L L LP++GQ+R TYISENALM
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVM-LMLYLPMDGQFRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRETEWNILRGYR +I+VL   SS ERN +++SW +EFG KT+ Y++  +G++
Sbjct: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDS 119

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YGV +APRGDGTE+MVLA PWYN + E+N+ GAAL  +L+RF SRWPVWSKNII+VFS+
Sbjct: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P  +LRSWV AYHTSLDLTGGSIE+AVVLDYPG +D+F+Y+E++Y G NG LPNLDLVN
Sbjct: 180 NPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           +A+ I EHEG+KVSL+G++ +EM   +Y+S            AL+GV+  YGNEAFSGWR
Sbjct: 240 IAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWR 299

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQA+ L+ARG D   D+TTFGR+ EA FRS+NNLLEKFHQSFFFY LLAPRYFVSI SYL
Sbjct: 300 IQALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            ++D  + +   +    S +NL + I + V             ++   
Sbjct: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418

Query: 421 SLLISCNAVIAVLPAIFGRQ-GIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLL 479
            LL+  N VI+ +P    +   I    +Y+ K+++F            +NF LAFG+GL 
Sbjct: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478

Query: 480 AFPLILVKAPMTSRQRVK--NTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQK 537
           A+P+ LV    T   R+K  N+ILL +SNPFI+  LF+   E +L G++  + LV AW K
Sbjct: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538

Query: 538 LGCWTWSVVCIGWLPSWLLVACSGI 562
           LG WTW + CIGW PSW+LVA S +
Sbjct: 539 LGSWTWFIFCIGWFPSWILVAISAL 563

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/600 (52%), Positives = 402/600 (67%), Gaps = 41/600 (6%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MAL+EKL RRI+D+GL+PRI+  LP +S++C + G   + +L P++GQYR TYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAIL-PMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRE+EWNILRGYR+QI+ +   +S ERN ++ SW QEFG KTA YE++ +G T
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YGV+HAPRGDGTEAMVLA PW+N D ++N+GGAAL  +L+RFFSRWPVWSKNIIIVFS+
Sbjct: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSE 179

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P A+LRSWV AYHTSLDLTGGSIE+AVV+DY  + DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 180 NPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           VA+ ITEHEGMKVSL+G+  +++   NY+S            AL+GV++ +GNEAFSGWR
Sbjct: 240 VAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWR 299

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ++ L+A G  G  DITTFGRIPEA FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            +L+  + +  ++   FS +NL A++ + +                 +
Sbjct: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418

Query: 421 SLLISCNAVIAVLPAIFGRQ-GIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLL 479
            LL++ + +   LP I  ++  I    SY+ K+VAF            INFA+A  IG L
Sbjct: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478

Query: 480 AFPLILVKAPMTS--------------------------------------RQRVKNTIL 501
           AFP+ LVK  + S                                      RQ +KN +L
Sbjct: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLL 538

Query: 502 LILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGCWTWSVVCIGWLPSWLLVACSG 561
           L+L+NPFIS  +F + F+ +  G  + ++LV AW  L CW+W V+CIGWLP WLLV  S 
Sbjct: 539 LVLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/564 (53%), Positives = 393/564 (69%), Gaps = 14/564 (2%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MALIE+LQRR++++GL+P+I+  LP +S++C ++   WL  L P+EGQ+R TYISENALM
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATL-PIEGQFRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRE+EWNILRGYR+QI+   E S+ ERNE +A W QEFGAKT+ Y ++ +G++
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDS 119

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YG+LHA RGDGTEA++LA PWYN +G+ N+GGA+L  +LSRFFSRWPVWSKNIIIVFS+
Sbjct: 120 LYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSE 179

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P  +LRSWV AYHTSLDLTGGSIE+A+VLDYPG+ND+F Y EI Y GLNGELPNLDLVN
Sbjct: 180 NPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           +AV ITEHEG+ VSL+G++ E +   +Y+S            A +G++   GNEAFSGWR
Sbjct: 240 IAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWR 299

Query: 301 IQAIVLRARGTD-GPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASY 359
           IQ++ ++A G + G  DITTFGRIPEA FRS+NNLLEKFHQS+FFY+L+APRYFVSI+SY
Sbjct: 300 IQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359

Query: 360 LPXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQY 419
           LP            +L+ +L +  SN   +S +NL A++ + V             +   
Sbjct: 360 LPATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419

Query: 420 SSLLISCNAVIAVLPAIFGRQ-GIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGL 478
           + LL++   V+ +LP   GR   I    S++ +  AF            +NF LAF +G+
Sbjct: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479

Query: 479 LAFPLILVKAPMTSRQ-RVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQK 537
           LAFP+  V    T R    K   LLI+SNP +S   F+    P     QL  +L+ AWQ 
Sbjct: 480 LAFPMTAVG---TQRSLTFKKYALLIISNPLVS--FFIVKPHP-----QLLQKLISAWQD 529

Query: 538 LGCWTWSVVCIGWLPSWLLVACSG 561
           LGCWTW V+C+GWLPSW L+A S 
Sbjct: 530 LGCWTWFVLCLGWLPSWTLIALSA 553

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/600 (51%), Positives = 399/600 (66%), Gaps = 42/600 (7%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MAL+EKL RR++D+GL+PR++  LP +S LC + G   + +L P++GQYR TYISENALM
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAIL-PMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRETEWNILRGYR+QI+     +S ERN ++ SW QEFG KTA YE++ +G T
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YGV+HAPRGDGTEAMVLA PW+N + E+N+GGA+L  +L+RFFSRWPVWSKNII+VFS+
Sbjct: 120 LYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P A+LRSWV AYHTSLDLTGGSIE+AVVLDY  + DFF+YVE+ Y GLNGELPNLDLVN
Sbjct: 180 NPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           VA+ I EHEGMKVSL+G+  E++   ++FS            ALSGV++ +GNEAFSGWR
Sbjct: 240 VAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWR 299

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ++ L+A G  G  DITTFGRIPEA FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            +L+  + +  ++   FS +NL AV+ + +                 +
Sbjct: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418

Query: 421 SLLISCNAVIAVLP-AIFGRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLL 479
            LL++ +  I  LP A+ G+  I    SY+ K+VAF            INFA+A  IG L
Sbjct: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 480 AFPLILVKA--------PMT-------------------------------SRQRVKNTI 500
           AFP+  +K         P T                                RQ++KN +
Sbjct: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLL 538

Query: 501 LLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGCWTWSVVCIGWLPSWLLVACS 560
           LLIL+NPFIS  +F   F+ +  G  + ++LV AW  L CW+W ++C+GWLP WLL+  S
Sbjct: 539 LLILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILAS 598

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/598 (51%), Positives = 393/598 (65%), Gaps = 40/598 (6%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           MAL+EKL RRI+D+GL+PRI+  LP +S LC + G   + +L P++GQYR TYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAIL-PMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRE+EWN+LRGYR+QI+ +E  +S ERN  + SW QEFG KTA YE   +G T
Sbjct: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGET 119

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YGV+HAPRGDGTEAMVLA PW+N D E+N+GGAAL  +L+RFFSRWPVWSKNII+VFS+
Sbjct: 120 LYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P A+LRSWV AYHTSLDLTGGSIE+AVVLDY  + DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           +A+ ITEHEGMKVSL+G+  +++   +++S            ALSGV++ +GNEAFSGWR
Sbjct: 240 IAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWR 299

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ++ L+A G  G  DITTFGRIPEA FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            +L+  + +  ++   FS +NL A++ + +                  
Sbjct: 359 PSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418

Query: 421 SLLISCNAVIAVLPAIFGRQ-GIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLL 479
            LL++ +     LP +   +  I    SY+ K+VAF            INFA+A  IG L
Sbjct: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478

Query: 480 AFPLILVKAPMT-------------------------------------SRQRVKNTILL 502
           AFP+  ++  +                                       RQ++KN +LL
Sbjct: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLL 538

Query: 503 ILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGCWTWSVVCIGWLPSWLLVACS 560
           +L+NPFIS  LF   F+ +  G  + ++L+ AW  L CW W V+CIGWLP WLL+  S
Sbjct: 539 VLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILAS 596

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/581 (52%), Positives = 386/581 (66%), Gaps = 15/581 (2%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           M+L++K+ RR+ + G + ++++ LP++S L  ++ I  L  +LPL+GQYR TYISENALM
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIV-LLAILPLDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRETEWNILRGYR+QI+ LE  S  +RNEVVA W QE G KTA YE +  G T
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKT 119

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YGVLHA RGDGTEAMVLA PW N D ++N+GGAAL  +LS+FF RWPVWSKNII+VFS+
Sbjct: 120 LYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSE 179

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           D  A+LR+WV AYHTSLDLT GSIE+AVVLDYP  +DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 180 DSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           +AV ITEHEGMKVSL+G+   EM   +YF+            ALSGV+  +GNEAFSGWR
Sbjct: 240 IAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWR 299

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ++ LRA G +G  DIT FGRIPEA FRSVNNLLEKFHQS+FFYLLLAPR FVSI++YL
Sbjct: 300 IQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P            +LD  + +   + P  SV+ L   I  +                   
Sbjct: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419

Query: 421 SLLISCNAVIAVLPAIFGRQGIEASH---SYQFKSVAFXXXXXXXXXXXXINFALAFGIG 477
             L+  +  +  LP +  ++ I   +   +Y+ KS+              +NFAL F IG
Sbjct: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIG 479

Query: 478 LLAFPLILVKAPMT------SRQRV-KNTILLILSNPFISTLLFVNTFEPQLSG--LQLF 528
           LLAFPL  +    T      SR+ + KNT +L ++NPFIS  LF  T +   +G    ++
Sbjct: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539

Query: 529 HRLVQAWQKLGCWTWSVVCIGWLPSWLLVACSGIPMPYQPV 569
           +R++ +W  LGCWTW ++C+GWLP WL+   S IP   QP+
Sbjct: 540 NRMITSWDTLGCWTWFIICLGWLPYWLISVISSIPS--QPI 578

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/583 (49%), Positives = 396/583 (67%), Gaps = 10/583 (1%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           M L+E++QR I+  GL+P+I+  LPK+SI+   + I  +  +LP++GQYR+TYISENALM
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISIL-MIAILPMDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120
           PSQAYSYFRETEWNI+RGYR ++  +E  +S+ERN+++ SW  EFG KT  YE+      
Sbjct: 60  PSQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENR-DNEV 118

Query: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180
           +YGV HAPRGDGTEA+VLA PW+N DGE+N  GAA+  AL+R+FSRWPVWSKNII+VFS+
Sbjct: 119 LYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSE 178

Query: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P+++LRSWV AY+TSLDLTGGSIE+A+VLD PG ND+F Y+E+YY GLNGELPNLDLVN
Sbjct: 179 NPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVN 238

Query: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGWR 300
           + ++I EHEGM+VSL+G   +++++ NY++            A SG+   +GNEAFSGWR
Sbjct: 239 IGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWR 298

Query: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ+I L+ +G  GP DIT FGR+PEA FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 299 IQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQYS 420
           P             +D  + + +   P FS + L   I +TV                  
Sbjct: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIP 418

Query: 421 SLLISCNAVIAVLPAIF-GRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFGIGLL 479
           SLL+  N VI++   I   ++  + + S + +S AF            +NF L+F IGL+
Sbjct: 419 SLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLM 478

Query: 480 AFPLILVK---APMTSRQRVKNTILLILSNPFISTLLFVNTFEPQ----LSGLQLFHRLV 532
           AFP+  V+   A    + +++N ILL++SNPFI+ +++ N         L GL++ +RL+
Sbjct: 479 AFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538

Query: 533 QAWQKLGCWTWSVVCIGWLPSWLLVACSGIPMPYQPVGGPSQR 575
            AW+ + CWTW V+C+GWLPSW++VA S I    +P     ++
Sbjct: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKK 581

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/579 (52%), Positives = 393/579 (67%), Gaps = 28/579 (4%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           M L E LQR+ + LGLLP+++  LP LS L  ++ +  + L++P+ GQYR+TYISENALM
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVV-MILIIPMNGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEK--SSKERNEVVASWFQEFGAKTAFYEDDLHG 118
           PSQAYSYFRETEWNILRGYRT+I+VL  +  S+ +R ++VA W  EFGAKTA Y ++  G
Sbjct: 60  PSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMG 119

Query: 119 NTMYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVF 178
           +T+YGVLHAPRGDGTEAMVL APW N +GE+NIGG+ALA ALSR+FSRWPVWSKNII+VF
Sbjct: 120 DTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVF 179

Query: 179 SDDPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDL 238
           SD+P  +LRSWV AYHTSLDLTGGSIE+AV+LDYP +ND+F Y EI++ GLNGELPNLDL
Sbjct: 180 SDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDL 239

Query: 239 VNVAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSG 298
           VNVAVHIT+HEGMKVSL+G+   E+EK NY+S             L+G++  +GNE FSG
Sbjct: 240 VNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSG 299

Query: 299 WRIQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIAS 358
           WRIQA+ L+ARG +G  DITTFGRIPEA FRS+NNLLEKFHQSFFFY LL+P  FVSI+S
Sbjct: 300 WRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISS 358

Query: 359 YLPXXXXXXXXXXXXTLDCVLKSGASNTPAFS---VHNLSAVIGFTVXXXXXXXXXXXXX 415
           YLP             +D  + +  ++    +   +  L++VI   V             
Sbjct: 359 YLPSAVLLSITFAIAAVDATVNNAYASALHITYTLLAALASVISLLV--------SFLVA 410

Query: 416 HW-QYSSL----LISCNAVIAVLPAIFGR--QGIEASHSYQFKSVAFXXXXXXXXXXXXI 468
           HW  YS+     LI  + V+AV P +  R    +     Y+ +++ +            +
Sbjct: 411 HWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLML 470

Query: 469 NFALAFGIGLLAFPLILVK-----APMTSRQRVKNTILLILSNPFISTLLFVNTFE-PQL 522
           NF LAF IGL  +P+ LVK     +      +++N++LL++SNPF++T L     E  + 
Sbjct: 471 NFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEF 530

Query: 523 SGLQLFHRLVQAWQKLGCWTWSVVCIGWLPSWLLVACSG 561
             L +F  L  AW+ L CWTW V+C+GWLP+WLLV  S 
Sbjct: 531 PNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSS 569

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/583 (49%), Positives = 383/583 (65%), Gaps = 12/583 (2%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGIC--WLTLLLPLEGQYRHTYISENA 58
           MALIE L RR   LGLLP+++    KLSI+  IL +    L L LPL+GQYR TYISENA
Sbjct: 1   MALIEVLHRRATKLGLLPKVI---GKLSIVSNILVLISIGLILCLPLDGQYRRTYISENA 57

Query: 59  LMPSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHG 118
           L+PSQAYSYFRE+EWNILRGYRT I+ L +K ++ RNEV++SW  +FG K A Y++   G
Sbjct: 58  LLPSQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADG 117

Query: 119 NTMYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVF 178
           +T+YGV ++ RGDGTEA+VLA PWYN D E NIGGAAL  +LSR+FSRWP+WSKNII+V 
Sbjct: 118 DTLYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVI 177

Query: 179 SDDPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDL 238
           S++P  +++SWV AYH SLDLTGGS+E+A+VLD+P  +++F++VE+Y+ G+NGELPNLD+
Sbjct: 178 SENPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDI 237

Query: 239 VNVAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSG 298
           VNVA+ + EHEG+KVSL G++  EM   +YF+            ALSG +  YGNEAFSG
Sbjct: 238 VNVAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSG 297

Query: 299 WRIQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIAS 358
            RIQA+ L+A GT+G  DITTFGRIPEA FRSVNNLLEKFHQSFFFY L+APR+FVSI S
Sbjct: 298 RRIQALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGS 356

Query: 359 YLPXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQ 418
           YLP                 + +     P     ++ A+I F                + 
Sbjct: 357 YLPSAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFL 416

Query: 419 YSSLLISCNAVIAVLPAIFGRQ---GIEASHSYQFKSVAFXXXXXXXXXXXXINFALAFG 475
              L+I    +I+ LP     Q    I+   SY+ KS AF            +NFALAFG
Sbjct: 417 QPHLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFG 476

Query: 476 IGLLAFPLILVKA---PMTSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLV 532
           +GLLAFPL   K+    +T + +V N   L +SNPFI+  +FV+ FE  ++  ++F  L+
Sbjct: 477 MGLLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLI 536

Query: 533 QAWQKLGCWTWSVVCIGWLPSWLLVACSGIPMPYQPVGGPSQR 575
            +++ +G WTW++ CIGW  +W +V  + +  P   + G +++
Sbjct: 537 SSFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKK 579

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/552 (50%), Positives = 373/552 (67%), Gaps = 18/552 (3%)

Query: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60
           M L+E+++R++  +GL+P++ ++LP  S +  ++ +     +LP++GQYR+TYISENALM
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLI-SIAILPIDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGN- 119
           PSQAYSYFRETEWNILRGYRTQ++ + +    ERN+++ +W  + GAKT     D H N 
Sbjct: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKT-----DTHNNS 114

Query: 120 TMYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFS 179
           T+YG+ H+PRGDGTEA+VLA PW+N +G++N GGAAL  +L+RFF RWP+WSKNII+VFS
Sbjct: 115 TIYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFS 174

Query: 180 DDPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLV 239
           +D  ASLRSWV AYHTSLDLTGGSIE+AV+LDY   +DFF YVEI+Y GLNGELPNLDLV
Sbjct: 175 EDTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLV 234

Query: 240 NVAVHITEHEGMKVSLNGVSEEEMEKRNYFSXXXXXXXXXXXXALSGVQSCYGNEAFSGW 299
           N+AV ITEHEGMKVSL+G+  EE+E+R+ +S            +L+G++  +GNEAFSGW
Sbjct: 235 NIAVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGW 294

Query: 300 RIQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASY 359
           RIQA+ L+A G +G  DITTFGRIPEA FRS+NNLLEKFHQSFF+YLLLAPR FVSI+SY
Sbjct: 295 RIQALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSY 353

Query: 360 LPXXXXXXXXXXXXTLDCVLKSGASNTPAFSVHNLSAVIGFTVXXXXXXXXXXXXXHWQY 419
           LP            +L   +     + P  S + L A+I + +              + +
Sbjct: 354 LPAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTF 413

Query: 420 SSLLISCNAVIAVLPAI-----FGRQGIEASHSYQFKSVAFXXXXXXXXXXXXINFALAF 474
             +L+    + + +P I          I  +H  + K+ AF            INF LA 
Sbjct: 414 PVMLMFICILFSFIPLISRGLPLAETKITVAH--RMKAFAFGYFSLVLTSLLMINFPLAL 471

Query: 475 GIGLLAFPLILVKAPM---TSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRL 531
            IG+LAFP+ LVK      TS Q +KN++LL++SNP+IS   F N F+ +L+GL    RL
Sbjct: 472 TIGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRL 531

Query: 532 VQAWQKLGCWTW 543
           + AW  + CWTW
Sbjct: 532 IPAWNDMNCWTW 543

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 208  VVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVNVAVHITEHEGM 251
            ++LD+   +D++ Y+E    G +G +   DL+ +   +TEHE M
Sbjct: 1023 MLLDFFEDDDYY-YIETAVHGTSGSIDLFDLIEMKTDMTEHEAM 1065

>ZYRO0D08492g Chr4 complement(733481..735235) [1755 bp, 584 aa] {ON}
           similar to gnl|GLV|CAGL0K09218g Candida glabrata
           CAGL0K09218g and some similarites with YCR061W
           uniprot|P25639 Saccharomyces cerevisiae YCR061W Protein
           of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 584

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 47/114 (41%), Gaps = 6/114 (5%)

Query: 130 GDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSDDPEASLRSW 189
           G G     L A W  G   + +G  +LA        +   W+ N IIV  D   +   +W
Sbjct: 296 GKGARIFNLLAHWIKGGVFFVLGLVSLARYCG--VGKGHGWAWNKIIVKRDPLRSRSSAW 353

Query: 190 VHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVNVAV 243
              +     +T   IES ++  Y  +N F +++    AG  G     DL +V++
Sbjct: 354 KRFFSPRGTITMEGIESFLIFFYGSTNVFLEHL----AGAGGAWTAKDLQHVSI 403

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,008,468
Number of extensions: 2193023
Number of successful extensions: 4422
Number of sequences better than 10.0: 27
Number of HSP's gapped: 4447
Number of HSP's successfully gapped: 31
Length of query: 584
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 469
Effective length of database: 40,294,809
Effective search space: 18898265421
Effective search space used: 18898265421
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)