Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13684g8.262ON50850825500.0
Kwal_56.237998.262ON48841116590.0
SAKL0H17028g8.262ON55054910861e-142
Ecym_43088.262ON5293568741e-111
TDEL0F038908.262ON4763738071e-102
AGR086C8.262ON5344877832e-97
KLLA0F19140g8.262ON5273927804e-97
KAFR0B055408.262ON5194607673e-95
ZYRO0C01650g8.262ON5863727411e-90
NDAI0J013808.262ON6243767082e-85
Smik_4.3568.262ON5763616922e-83
YDR110W (FOB1)8.262ON5663476893e-83
Skud_4.3718.262ON5803376895e-83
Kpol_392.68.262ON4573576797e-83
NCAS0B038508.262ON5884766888e-83
Suva_2.2708.262ON6323476858e-82
CAGL0B01771g8.262ON5363905984e-70
Kpol_543.388.262ON4423705854e-69
TBLA0E044308.262ON4813604852e-54
KNAG0H032408.262ON5193834752e-52
TPHA0J007408.262ON4083384262e-46
TBLA0F030708.262ON4453963966e-42
TPHA0A018108.262ON4573653932e-41
NDAI0D03010na 1ON778142970.003
TBLA0B082503.92ON134736820.23
TDEL0E038105.245ON82040790.49
KLTH0E13442g8.581ON44784780.61
Suva_3.91.409ON28729760.80
NDAI0K019902.515ON65948770.86
KAFR0B06620singletonON1185217770.97
KNAG0I014701.375ON702104751.5
NDAI0E007308.758ON151791742.4
NDAI0B06160singletonON140348732.7
NDAI0G00550singletonON41248723.3
TPHA0C020308.442ON88746723.5
TBLA0B00800singletonON74030714.1
TDEL0E00260singletonON124849715.0
TDEL0H04520singletonON61249705.6
TDEL0B063101.375ON70271697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13684g
         (508 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   986   0.0  
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   643   0.0  
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   422   e-142
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   341   e-111
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   315   e-102
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   306   2e-97
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   305   4e-97
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   300   3e-95
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   290   1e-90
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   277   2e-85
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   271   2e-83
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   270   3e-83
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   270   5e-83
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   266   7e-83
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   269   8e-83
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   268   8e-82
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   234   4e-70
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   229   4e-69
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   191   2e-54
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   187   2e-52
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   168   2e-46
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   157   6e-42
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   155   2e-41
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    42   0.003
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    36   0.23 
TDEL0E03810 Chr5 (718114..720576) [2463 bp, 820 aa] {ON} Anc_5.2...    35   0.49 
KLTH0E13442g Chr5 complement(1192885..1194228) [1344 bp, 447 aa]...    35   0.61 
Suva_3.9 Chr3 complement(13689..14552) [864 bp, 287 aa] {ON} YCL...    34   0.80 
NDAI0K01990 Chr11 (448695..450674) [1980 bp, 659 aa] {ON} Anc_2....    34   0.86 
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    34   0.97 
KNAG0I01470 Chr9 (282849..284957) [2109 bp, 702 aa] {ON} Anc_1.3...    33   1.5  
NDAI0E00730 Chr5 complement(148162..152715) [4554 bp, 1517 aa] {...    33   2.4  
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            33   2.7  
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    32   3.3  
TPHA0C02030 Chr3 complement(455550..458213) [2664 bp, 887 aa] {O...    32   3.5  
TBLA0B00800 Chr2 complement(173024..175246) [2223 bp, 740 aa] {O...    32   4.1  
TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,...    32   5.0  
TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {O...    32   5.6  
TDEL0B06310 Chr2 (1116175..1118283) [2109 bp, 702 aa] {ON} Anc_1...    31   7.4  

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/508 (93%), Positives = 477/508 (93%)

Query: 1   MTKLEKSXXXXXXXXXXEFDMPAVGEPIEKYHXXXXXXXXXXXXXDFIKYQESVKGQLTQ 60
           MTKLEKS          EFDMPAVGEPIEKYH             DFIKYQESVKGQLTQ
Sbjct: 1   MTKLEKSRVDKRRRDKVEFDMPAVGEPIEKYHNGLNLELLERGRLDFIKYQESVKGQLTQ 60

Query: 61  DQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEP 120
           DQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEP
Sbjct: 61  DQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEP 120

Query: 121 ELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKF 180
           ELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKF
Sbjct: 121 ELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKF 180

Query: 181 RHTNIYSGLLPLERVHVEIISPFSEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITK 240
           RHTNIYSGLLPLERVHVEIISPFSEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITK
Sbjct: 181 RHTNIYSGLLPLERVHVEIISPFSEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITK 240

Query: 241 GXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLR 300
           G        PRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLR
Sbjct: 241 GLLATLLLLPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLR 300

Query: 301 YLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLI 360
           YLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLI
Sbjct: 301 YLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLI 360

Query: 361 EKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEYISAENETDMNDDDLGFGSATRLT 420
           EKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEYISAENETDMNDDDLGFGSATRLT
Sbjct: 361 EKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEYISAENETDMNDDDLGFGSATRLT 420

Query: 421 TPLTSPGRTPSRTPNRTPGRTPGRTPNEVRKVQGGELENLGAENQKVDDVDSTGTSSELS 480
           TPLTSPGRTPSRTPNRTPGRTPGRTPNEVRKVQGGELENLGAENQKVDDVDSTGTSSELS
Sbjct: 421 TPLTSPGRTPSRTPNRTPGRTPGRTPNEVRKVQGGELENLGAENQKVDDVDSTGTSSELS 480

Query: 481 GPAQKYYPGNSRSTTYTEASNNDFSVEI 508
           GPAQKYYPGNSRSTTYTEASNNDFSVEI
Sbjct: 481 GPAQKYYPGNSRSTTYTEASNNDFSVEI 508

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/411 (73%), Positives = 345/411 (83%), Gaps = 3/411 (0%)

Query: 18  EFDMPAVGEPIEKYHXXXXXXXXXXXXXDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLM 77
           +F MP VGE +EKY              DFIKYQESVKGQLTQ+QFDLVRS +LT +NLM
Sbjct: 18  KFRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLM 77

Query: 78  TTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHL 137
           +TSDKLH+GN+ETKFLLLKRR+YVDADG VRD+KC DTVVCEPE +FDLIMCGHLKNGH+
Sbjct: 78  STSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHI 137

Query: 138 HWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERVHV 197
           HWRRLH YLR  YANTTRAFAQICV+YCS+CNPEE LRPY+KFRHTNIYSGLLPLERVHV
Sbjct: 138 HWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHV 197

Query: 198 EIISPFSEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGXXXXXXXXPRIPIFIE 257
           EII+PF + IEG YSHVL+ RDYYSRFVWMQPL  + V +ITK         PR+PIF+E
Sbjct: 198 EIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVE 257

Query: 258 TSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMC 317
           TST+ RQDLFE CE++A QY L IGLGMS+S+TFQ+NGVERLRYLLQ+NEE CL+SW+MC
Sbjct: 258 TSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMC 317

Query: 318 LKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIKVSGRR 377
           LK+G TNHN+ YNAR+LG+PGNLLHSTV DYGRQFELKRE+LIEKLFA NVVE++  GRR
Sbjct: 318 LKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRR 377

Query: 378 RGIIYLEDETSAFKMPDEEYISAENETDMNDDDLGFGSATRLTTPLTSPGR 428
           RG+IYLEDE+SAFKMPDEEYISAENET+  ++   +G    L TPLTSP R
Sbjct: 378 RGMIYLEDESSAFKMPDEEYISAENETE--NEGFDYGPMVGL-TPLTSPSR 425

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  422 bits (1086), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 235/549 (42%), Positives = 326/549 (59%), Gaps = 49/549 (8%)

Query: 2   TKLEKSXXXXXXXXXXEFDMPAVGEPIEKYHXXXXXXXXXXXXXDFIKYQESVKGQLTQD 61
           T + KS          ++  P +GE    Y              DFIKY ESVKGQLTQ 
Sbjct: 9   TNVPKSKDVCSKPTNNDYVTPKLGESQVTYSTDLNVELLERGGRDFIKYLESVKGQLTQA 68

Query: 62  QFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPE 121
           Q++L+++ +LT + L+  +D L   N E K+L LKRRYYVD+D IVRD+K  DT+VCEPE
Sbjct: 69  QYELIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPE 128

Query: 122 LMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFR 181
           LM++LI+ GHL N HLHWR+LH +L+  Y+N TR F Q+C +YCS+CNP+EE++P+ KF+
Sbjct: 129 LMYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFK 188

Query: 182 HTNIYSGLLPLERVHVEIISPFS--EAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDIT 239
           HTN Y GLLPLER+HVEI  PF   E IE  YSHVL+ RDY+SRFVW+ PL G   +++ 
Sbjct: 189 HTNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELV 248

Query: 240 KGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERL 299
                     PR+PIF+ET+T+DRQD+F+ CE +A +Y L IGLG++ SS F KNG+ER+
Sbjct: 249 PQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERM 308

Query: 300 RYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDL 359
           +YLLQ N+++C + W MCLKYG+ ++N  YN RI+G   +LL + V   G++F+LKRE +
Sbjct: 309 KYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKI 368

Query: 360 IEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEYISAENETDMNDDDL----GFGS 415
           I +LFA NVV +K +G   G++Y+E+E S F M DE+ IS   ++  +   +    G G 
Sbjct: 369 IHELFAHNVVTLKDTG---GMVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGV 425

Query: 416 ATRL-------TTPLT-SPGRTPSRTPNRTP-------------GRTPGR-------TP- 446
              +        TPL  S G    +T + TP              RT  R       TP 
Sbjct: 426 EQEMDEMPSMGLTPLKGSNGDMLHKTADSTPKVKRTSSLSRASSKRTGERASLSDTITPT 485

Query: 447 NEVRKV-------QGGELENLGAENQKVDDVDSTGTSSELSGPAQKYYPGNSRSTTYTEA 499
            +V+KV        G E    G      D+ D    S E+ GP+  ++   + S T   A
Sbjct: 486 KKVKKVGENRSRLSGSESVEQGNSEANRDEYD---LSEEIPGPSTSFFATVNHSRT-ARA 541

Query: 500 SNNDFSVEI 508
             ND S+E+
Sbjct: 542 DENDISIEL 550

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  341 bits (874), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/356 (44%), Positives = 240/356 (67%), Gaps = 8/356 (2%)

Query: 46  DFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADG 105
           + IK   +VKGQLTQD ++L+ S +L+   L+   DK+ AG VE KF+LLKRRY +   G
Sbjct: 62  ELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSI-LQG 120

Query: 106 IVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYC 165
            V D+K  D  V EP+L+FD+IM  HL NGHL WR++H +L++ YAN TR F  +   YC
Sbjct: 121 NVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYC 180

Query: 166 SQCNPEEELRPYKKFRHTNIYSGLLPLERVHVEIISPF----SEAIEGTYSHVLFFRDYY 221
           S CN +  ++ + +++H N+Y  ++PLER HVEI +PF    +E IE  YSHVL+ RDY+
Sbjct: 181 SHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYH 240

Query: 222 SRFVWMQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYI 281
           SRFVWM PL+G   RD+            R+PIF+ET+T+DRQD+F+ CE +A +Y L I
Sbjct: 241 SRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKI 300

Query: 282 GLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLL 341
           GLG++  + FQ+NGV R++ L   ++EQC++ W MCL+   T  N NY+ R+ G+P +LL
Sbjct: 301 GLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLL 360

Query: 342 HSTVCDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEY 397
            + + +   +F+LK+  +I++L+A +VV+ + +G   G+IYLED+ SAF + ++E+
Sbjct: 361 CNEISNIAHKFKLKQRKIIDELYAHHVVQFREAG---GMIYLEDDNSAFVVDEDEH 413

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  315 bits (807), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 152/373 (40%), Positives = 235/373 (63%), Gaps = 8/373 (2%)

Query: 18  EFDMPAVGEPIEKY-HXXXXXXXXXXXXXDFIKYQESVKGQLTQDQFDLVRSCSLTEDNL 76
           +F  P++GE  ++Y +             D +KYQES+ GQ+    ++L+R+ SLT + L
Sbjct: 38  QFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETL 97

Query: 77  MTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGH 136
            + SDK    + E+K++ L RRYY + +GIVRD +  D +VCEP  +FDLIMC HL N H
Sbjct: 98  ASNSDKWDKDSAESKYMFLMRRYYAE-NGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDH 156

Query: 137 LHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERVH 196
           + +R +++ L   Y+N TR F Q+ V+YCS CNP+   RP +K+RH NI+ GLLPLERVH
Sbjct: 157 MTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVH 216

Query: 197 VEIISPF-SEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGXXXXXXXXPRIPIF 255
           +EI   F +E+I   +++VL+ RDY++RFVW+ PLK    + +             +PIF
Sbjct: 217 IEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIF 276

Query: 256 IETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWY 315
           +E+ST+D+QDLF+ CE + G+Y++ +GLG + SS F  NG++R++ LL   +  C+  W 
Sbjct: 277 MESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWN 336

Query: 316 MCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIKVSG 375
           MCL+YG  + N  +N    G+P +LL+ +     + F  K+E +I++L A+NVV +    
Sbjct: 337 MCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVN--- 393

Query: 376 RRRGIIYLEDETS 388
             +G++YLEDE S
Sbjct: 394 --KGLLYLEDENS 404

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  306 bits (783), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 177/487 (36%), Positives = 275/487 (56%), Gaps = 38/487 (7%)

Query: 49  KYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVR 108
           K  ++VKGQLTQ+ +DL+ S +L+   L+   DK+    VE K++LLKRRY V   GIV 
Sbjct: 59  KIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRY-VAKGGIVI 117

Query: 109 DYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQC 168
           D K  D  V EP+ +FD+IM  HL N H+ WR+++ +++  YAN TR    +   YCS C
Sbjct: 118 DRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHC 177

Query: 169 NPEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFS----EAIEGTYSHVLFFRDYYSRF 224
           N +  +R + +++H N++  L+PLER HVE+ +PF     E I+G YSH L+ RDY+SRF
Sbjct: 178 NMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRF 237

Query: 225 VWMQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLG 284
           +W+ PL+G   R +            R+PIF+ET+T+DRQD+F+ CE +A +Y   IGLG
Sbjct: 238 IWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLG 297

Query: 285 MSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHST 344
           ++  + FQKNG++R++ LL   +E+C   W MCL+   +  N  Y  R+ G+P +LL + 
Sbjct: 298 LNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNE 357

Query: 345 VCDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKM--PDEEYISAEN 402
           + +   +F+ K++ +I++L+A +VV  K +G   G+IYLEDE SAF M  PD++      
Sbjct: 358 IPNISMKFKQKQKKIIDQLYAHHVVHFKEAG---GMIYLEDEESAFVMDDPDDDCTPVPE 414

Query: 403 ETDMNDDDLGFGSATRLTTPLTSPGRTPSRTPNRTPGRTPGRTPNE-------------- 448
           E  +  D +   SAT L TP+TS   T +    + P +   R P++              
Sbjct: 415 EPPVASDSIQ-NSATIL-TPITSTQITENEVARQDPDQLEIRPPSQNNESLSDRVSSEEP 472

Query: 449 -------VRKVQGGELENLGAENQKVDDVDSTGTSSELSGPAQKYYPGNSRSTTYTEASN 501
                   RK+    L+   + +  V+  +    +SEL+GP   ++   S   T  E   
Sbjct: 473 PVSKERKKRKISKRALKTASSPSPNVN--EEYYNNSELAGPGSSFFKNIS---TSQEPRY 527

Query: 502 NDFSVEI 508
            D S+E+
Sbjct: 528 GDVSLEL 534

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  305 bits (780), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 165/392 (42%), Positives = 244/392 (62%), Gaps = 22/392 (5%)

Query: 53  SVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKC 112
           +VKGQLTQ  +DL+ S +LT++NL+  SDK+    VE KF+LLKRRYYV  + ++ D K 
Sbjct: 91  TVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYV-QENLLHDVKR 149

Query: 113 SDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEE 172
            D VV EP  +FDLIM  H+ N H+  + +++ L   YAN T++F ++   +CS+CN   
Sbjct: 150 KDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESG 209

Query: 173 ELRPYKKFRHTNIYSGLLPLERVHVEIISPFSEA-----------IEGTYSHVLFFRDYY 221
               YKKF+H NI++ L+PL R HVEI +PF  A           IEG Y  VL+ RDYY
Sbjct: 210 NKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYY 269

Query: 222 SRFVWMQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYI 281
           SR+VW++PLK   + D+            R+PIFI+T T+DRQD+F+ CE++A  Y + I
Sbjct: 270 SRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKI 329

Query: 282 GLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLL 341
           GLGM+ S++FQK G++R++ L  +++E+CL  W MCLK   +  N NY+ R+ GVP +LL
Sbjct: 330 GLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLL 389

Query: 342 HSTVCDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEYISAE 401
            ST  D  ++F   + ++I +L   +VV+ + +G   G+IYLEDE S   +   +  S E
Sbjct: 390 CSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAG---GMIYLEDENSPNLLLSGDDNSEE 446

Query: 402 NETDMND-DDLGFGSATRLTTPLT---SPGRT 429
           +E D    D+L   +++R  TP++   SP RT
Sbjct: 447 SEHDSEIFDEL---ASSRDGTPISEQPSPHRT 475

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  300 bits (767), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 162/460 (35%), Positives = 253/460 (55%), Gaps = 27/460 (5%)

Query: 46  DFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADG 105
           +  K+Q+S+ G LT++ +DL+R+ SLT + L +T+ K      E ++L LKRRYY D +G
Sbjct: 75  EVFKFQQSINGHLTEETYDLIRTDSLTPETLASTNPKWTKITAEPRYLFLKRRYYRDNNG 134

Query: 106 IVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYC 165
           ++ D+   D +VCEP  +FD+IM  HL N H   +++H  L   Y+N TR      +K+C
Sbjct: 135 LIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGFVKKIHHSLSTFYSNITRDLCLKALKFC 194

Query: 166 SQCNPEEELRPYKKFRHTNIYSGLLPLERVHVEIISPF-SEAIEGTYSHVLFFRDYYSRF 224
           S CNPE+++   +KF+H NIY+ L+PLERVH+EI  PF +E IE  YSH+L+ RDY+SR+
Sbjct: 195 SVCNPEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRY 254

Query: 225 VWMQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLG 284
           +WM PLK    + +            R PIFIET+++D QD+F+ CE +A +Y L IGLG
Sbjct: 255 IWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLG 314

Query: 285 MSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHST 344
            S+ +TF   G+ +++  L+ + E+CL SW +CLKYG+ +HN+ +N R  GVPG+LL S 
Sbjct: 315 TSKPNTFHAAGIRQMKAKLEAHREECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQ 374

Query: 345 VCDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEYISAENET 404
           + +   +F+ K   ++E   + +V+ +       G+I+LE +    +  DE Y   + E 
Sbjct: 375 IQECSLKFKEKIIQILENAVSESVLRVD-----NGLIFLEVDEPHDEPHDEPYDEFQFEG 429

Query: 405 DMNDDDLGFGSATRLTTPLTSPGRTPSRTPNRTPGRTPGRTPNEVRKVQGGELENLGAEN 464
           D + D+   G+     T   +           T G    R    +               
Sbjct: 430 DQSIDEEDMGAVMPPATEADAQDSMSLTEAYMTDGLPKPRVSKRL--------------- 474

Query: 465 QKVDDVDSTGTSSELSGPAQKYYPGNSRSTTYTEASNNDF 504
             +D  D    +SE+SGP   YY     S    +   +D+
Sbjct: 475 --IDRQD----TSEISGPLTSYYEETHDSIISKKHKTDDY 508

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  290 bits (741), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 148/372 (39%), Positives = 223/372 (59%), Gaps = 20/372 (5%)

Query: 48  IKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYV-DADGI 106
           +++Q +V GQLTQ  ++L+RS +L+  NL     K    + E ++  L+ RY+V + +G+
Sbjct: 68  LQFQGTVAGQLTQQIYELIRSDTLSIANL-ERCHKWKGESSEIEYYYLRSRYFVSEENGM 126

Query: 107 VRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCS 166
           V D K  D +VCEP  MF L+MC HL+N H+    +H  L   YAN TR +    + YCS
Sbjct: 127 VCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCS 186

Query: 167 QCNPEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFS-EAIEGTYSHVLFFRDYYSRFV 225
           +CNP+ + +P++K RH N+Y  LLPLERVH+E+  PF  E I+G +SH+L+FRDY+SR+V
Sbjct: 187 KCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYV 246

Query: 226 WMQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGM 285
           W+ PL+ D  + + +         PRIPIF+E++TIDR+ LF+ C  +A  YSL +GLG+
Sbjct: 247 WILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGV 306

Query: 286 SQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTV 345
             S  F  NG++ ++ LL  ++E+CL+ W +CLKYG  + N N N    G PG+LL ++V
Sbjct: 307 KNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSV 366

Query: 346 CDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKM------------P 393
            D  R+F  KR D+I    ++ VV +       G+++LE+     K             P
Sbjct: 367 PDCNRKFVKKRNDVILDTPSQQVVHLG-----EGVLFLENNKEEHKTVEAVKENITHSDP 421

Query: 394 DEEYISAENETD 405
           DEE    +N  D
Sbjct: 422 DEERAENDNTND 433

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  277 bits (708), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 148/376 (39%), Positives = 215/376 (57%), Gaps = 17/376 (4%)

Query: 47  FIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGI 106
           F+ +Q S+ GQL +  ++L+R+ SLTE+ L       HA    T+  L KRRY  D +G 
Sbjct: 120 FLNFQRSIHGQLDEVVYELIRTKSLTEETLAANFPHFHA---PTRCALFKRRYVADNEGR 176

Query: 107 VRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCS 166
           VRD    + +VC+P L+++++M  HL N H  +RR H  L   YAN TR F    V++CS
Sbjct: 177 VRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCS 236

Query: 167 QCNPEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFS-EAIEGTYSHVLFFRDYYSRFV 225
            CNP + + P  KF+H N Y G+LPLERVH+EI  PF+ + IEG YSHV++ RDY SR++
Sbjct: 237 VCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYI 296

Query: 226 WMQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGM 285
            ++PLK    +++           PRIPIFIET +++ QD F+  E +  +Y + +GLGM
Sbjct: 297 MLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGM 356

Query: 286 SQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTV 345
             +  F   GV++++ LL+ + ++CL  W MCLKYG  N+N  +N R  GVP +LL   V
Sbjct: 357 KTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNV 416

Query: 346 CDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDET------SAFKMPDEEYIS 399
            D   +   K E +I  L   N+V+I       G IYLE++       +   M  EEY S
Sbjct: 417 KDVTHKSIEKYEQIIRTLPKDNIVQIG-----NGSIYLEEKVKDPNIDNYDAMLGEEYDS 471

Query: 400 AE--NETDMNDDDLGF 413
            +  N     D DL +
Sbjct: 472 EQEDNNNKNTDQDLAY 487

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  271 bits (692), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 139/361 (38%), Positives = 215/361 (59%), Gaps = 5/361 (1%)

Query: 50  YQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRD 109
           + ES+  QLTQ  ++L+++ SLT D L   SDK      E K L L+R+YYVD +G VRD
Sbjct: 80  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRD 139

Query: 110 YKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCN 169
            + +D + CEP  ++D++M  HL N HL  + LHS+L   +AN + A      ++CS+CN
Sbjct: 140 GRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCN 199

Query: 170 PEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFS-EAIEGTYSHVLFFRDYYSRFVWMQ 228
            + +++P K+++  ++Y  LLP+ER+H+E+  PFS E IEG YS+VL  RDY S F+W+ 
Sbjct: 200 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLL 259

Query: 229 PLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQS 288
           PLK    + +            R+PIF+ +ST+D+ DL++ CE++A +Y L IGLG+  S
Sbjct: 260 PLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS 319

Query: 289 STFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDY 348
           + F   G+  + Y L   +E+CL  W  CL+YG    N   N R    P  +L S +  +
Sbjct: 320 ARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEIPGH 379

Query: 349 GRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEYISAENETDMND 408
             +FE KRE +IE  ++RN+   K +G  +G+IYLED  + F + ++   S  N +  N+
Sbjct: 380 NAKFETKRERVIENTYSRNM--FKTAG-GKGLIYLED-VNTFALANKADNSYNNGSSHNN 435

Query: 409 D 409
           D
Sbjct: 436 D 436

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  270 bits (689), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 136/347 (39%), Positives = 214/347 (61%), Gaps = 5/347 (1%)

Query: 50  YQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRD 109
           + ES+  QLTQ  ++L+++ SLT D L   SDK      E K L L+R+YYVD +G VRD
Sbjct: 78  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRD 137

Query: 110 YKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCN 169
            + +D + CEP+ ++D++M  HL N HL  + LHS+L  ++AN + A      ++CS+CN
Sbjct: 138 GRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCN 197

Query: 170 PEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFS-EAIEGTYSHVLFFRDYYSRFVWMQ 228
            + +++P K+++  ++Y  LLP+ER+H+E+  PF+ EAIEG YS+VL  RDY S F+W+ 
Sbjct: 198 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLL 257

Query: 229 PLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQS 288
           PLK    + +            R+PIF+ +ST+D+ DL++ CE++A +Y L IGLG+  S
Sbjct: 258 PLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS 317

Query: 289 STFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDY 348
           + F   G+  ++Y L   +++CL  W  CL+YG    N   N R    P  +L S V  +
Sbjct: 318 ARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRRNKRTKRKPVQVLLSEVPGH 377

Query: 349 GRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDE 395
             +FE KRE +IE  ++RN+   K++G  +G+IYLED  + F + +E
Sbjct: 378 NAKFETKRERVIENTYSRNM--FKMAG-GKGLIYLED-VNTFALANE 420

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  270 bits (689), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 134/337 (39%), Positives = 208/337 (61%), Gaps = 4/337 (1%)

Query: 50  YQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRD 109
           + ES+  QLTQ  ++L+++ SLT D L   SDK      E K L L+R+YYVD +G VRD
Sbjct: 81  FLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRD 140

Query: 110 YKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCN 169
            + +D + CEP+ ++D++M  HL N HL  + LHS+L  ++ANT+ A      ++CS+CN
Sbjct: 141 GRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 200

Query: 170 PEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFS-EAIEGTYSHVLFFRDYYSRFVWMQ 228
            + +++P K+++  ++Y  LLP+ER+H+E+  PF+  AIEG Y +VL  RDY S F+W+ 
Sbjct: 201 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLL 260

Query: 229 PLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQS 288
           PLK    + +            R+PIF+ +ST+D+ DL++ CE++A +Y L IGLG+  S
Sbjct: 261 PLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSS 320

Query: 289 STFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDY 348
           + F   G+  ++Y L   +E+CL  W  CL+YG    N   N R    P  +L S V  +
Sbjct: 321 ARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEVPGH 380

Query: 349 GRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLED 385
             +FE KRE +IE  ++RN+   K++G  +G+IYLED
Sbjct: 381 NAKFETKRERVIENTYSRNM--FKMAG-GKGLIYLED 414

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  266 bits (679), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 137/357 (38%), Positives = 209/357 (58%), Gaps = 8/357 (2%)

Query: 46  DFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADG 105
           D  K+Q ++ G L+Q  +DL+ +  LT   +     K  A     K+  LK RYYV   G
Sbjct: 88  DLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKW-ANKSNEKYYFLKNRYYVSDKG 146

Query: 106 I-VRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKY 164
             VRD +  D ++C P  + ++++C HL N H   + +H  L   YAN +R   +I + Y
Sbjct: 147 TTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYANISRTITRISLLY 206

Query: 165 CSQCNPEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFSE--AIEGTYSHVLFFRDYYS 222
           CS CNP E ++P KK +   +Y GLLP ER+H+EI  PF +   IEGTYSH+L+ RDYYS
Sbjct: 207 CSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYS 266

Query: 223 RFVWMQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIG 282
           R+VW+ PLK    +++T+          + PI+IE+STI+R DL    + +A +Y L IG
Sbjct: 267 RYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIG 326

Query: 283 LGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGN-LL 341
           +G+  SS F  NG+E ++ LL  +E++CL  W MCLKYG   HN   N ++LG+P N LL
Sbjct: 327 IGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLL 386

Query: 342 HSTVCDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEYI 398
           +S + +   +++ K+  +I++ F  N++   V    +  IYLED  ++  + DE+ I
Sbjct: 387 NSGISECSIKYKSKKNTVIDETFPHNMI---VLDNGKSEIYLEDNLTSTPVIDEKNI 440

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  269 bits (688), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 162/476 (34%), Positives = 252/476 (52%), Gaps = 31/476 (6%)

Query: 46  DFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADG 105
           +F ++Q+++ GQL +  ++L+++ SLT++ L  T+ K+      ++ + L RRY +D  G
Sbjct: 110 EFFEFQKTINGQLNESTYELIKTNSLTQETLSATALKMDKFRAASRLVFLNRRYGLDEQG 169

Query: 106 IVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYC 165
            VRD    + +VCEP  ++D+IM  HL N H   R+ H  L   Y+N TR F +   ++C
Sbjct: 170 NVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGRPRKCHQLLGPMYSNITRFFVERICQFC 229

Query: 166 SQCNPEEELRPYKKFRHTNIYSGLLPLERVHVEIISPF-SEAIEGTYSHVLFFRDYYSRF 224
           S CNP +E  P+KK++H N + GLLPLERV VE+  PF  E + G Y  +L+FRDY SRF
Sbjct: 230 SVCNPSKETIPFKKYKHINWFKGLLPLERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRF 289

Query: 225 VWMQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLG 284
           +WM PL+      +            RIPIF ET+TI+ QD F+  E +  +Y + IGLG
Sbjct: 290 IWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFETTTIENQDFFDIFEKIVEKYQINIGLG 349

Query: 285 MSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHST 344
                    NG+ ++R LL  ++E+CL  W MCLKYG    N   N R  GVPG+LL   
Sbjct: 350 TKLGGKRLTNGLPQIRKLLGPHKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGD 409

Query: 345 VCD-YGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEY-ISAEN 402
           + D Y + ++ K E +++ L   N+V+I      RG IYLED     + P+ EY  + ++
Sbjct: 410 IPDLYTKSYD-KIEQILQDLPTENIVKIG-----RGCIYLEDRNP--EDPEAEYEANTDD 461

Query: 403 ETDMND-------DDLGFGSATRLTTPLTSPGRTPSRTPNRTPGRTPGRTPNE----VRK 451
           E+D  D       D+   G+   + +P+    RT     N           N+    V K
Sbjct: 462 ESDTEDNVEHRQEDEEDIGA---MMSPMIDNTRTEDELENGEKSHEDDNHSNDNEEGVTK 518

Query: 452 VQGGELENLGAENQKVDDVDSTGT----SSELSGPAQKYYPGNSRSTTYTEASNND 503
           V+G        + +K+++ + T T    S E++ P+  YY     +T+     ++D
Sbjct: 519 VEGS--VPTTPKRRKLNNKNVTNTQETESPEITEPSTSYYQTYQETTSQPTMKHDD 572

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  268 bits (685), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 210/347 (60%), Gaps = 5/347 (1%)

Query: 50  YQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRD 109
           + ES+  QLTQ  ++L+++ SLT + L   SDK      E K L L+R+YYVD +G VRD
Sbjct: 131 FLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGNVRD 190

Query: 110 YKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCN 169
            + +D + CEP+ ++D++M  HL N HL  + LHS+L  ++ANT+ A      ++CS+CN
Sbjct: 191 RRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 250

Query: 170 PEEELRPYKKFRHTNIYSGLLPLERVHVEIISPF-SEAIEGTYSHVLFFRDYYSRFVWMQ 228
            + +++P K+++  ++Y  LLP+ER+H+E+  P+  +AIEG Y +VL  RDY S F+W+ 
Sbjct: 251 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWLL 310

Query: 229 PLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQS 288
           PLK    + +            RIPIF+ +ST+D+ DL++ CE++A +Y L IGLG+  S
Sbjct: 311 PLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS 370

Query: 289 STFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDY 348
           + F   G+  ++Y L   +E+CL  W  CL+YG    N   N R    P  +L S V  +
Sbjct: 371 ARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPTQVLLSEVPGH 430

Query: 349 GRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDE 395
             +FE KRE +IE  +ARN+  +      +G+IYLED  + F + +E
Sbjct: 431 NAKFETKRERVIENTYARNMFTMAGG---KGLIYLED-VNTFALVNE 473

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  234 bits (598), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 137/390 (35%), Positives = 202/390 (51%), Gaps = 29/390 (7%)

Query: 18  EFDMPAVGEPIEKY----HXXXXXXXXXXXXXDFIKYQESVKGQLTQDQFDLVRSCSLTE 73
           +F MPA+ E  E Y                  D  ++ E + G+LTQ+ + L+ + +LT 
Sbjct: 59  KFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTM 118

Query: 74  DNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLK 133
           + +M   +       ETK+  L +R+Y D +G +RD K  + +V EP+ +F+LI+  HLK
Sbjct: 119 ETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLK 178

Query: 134 NGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLE 193
           NGHL    L   LR  YAN TR F Q  + YC++CNP+  ++P +K RH NI   LLPLE
Sbjct: 179 NGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLE 238

Query: 194 RVHVEIISPFSE---------------AIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDI 238
           RVH+E+ +PF +                IEG YSHV + RD+ +R+VW  PLK    + +
Sbjct: 239 RVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTL 298

Query: 239 TKGXXXXXXXX---PRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNG 295
                         P  PIF+E+STIDR DL E  E +A +Y L +GLG +  + F   G
Sbjct: 299 VDNIATFFMTVLYDP--PIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQG 356

Query: 296 VERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVC-DYGRQFEL 354
           ++R +  L R + +C   W MCLK G  + N     R LG   N+L + +   + R    
Sbjct: 357 IKRFKTHLHRAKSECADDWLMCLKQGTYSAN-RVIERQLGKASNILFTELMGQFERDMRK 415

Query: 355 KREDLIEKLFARNVVEIKVSGRRRGIIYLE 384
           K+   IE+ F+ N+     SG   G I++E
Sbjct: 416 KKLKYIEQSFSENIKTYPKSG---GCIFIE 442

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  229 bits (585), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 200/370 (54%), Gaps = 6/370 (1%)

Query: 19  FDMPAVGEPIEKYHXXXXXXXXXXXXXDFIK-YQESVKGQLTQDQFDLVRSCSLTEDNLM 77
           FD P VG  + +Y                 K Y +S+ G L+Q  ++L+R   L  D L 
Sbjct: 43  FDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTL- 101

Query: 78  TTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHL 137
           +   +    N   K L LKRRY +   G V D    + +V EP+L +D I+  H+ N HL
Sbjct: 102 SEKTRWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNRHL 161

Query: 138 HWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERVHV 197
            ++ +H  L+  Y+N +R + ++ + +CS CNP++ +   +K  H NIY   LPLERV +
Sbjct: 162 GYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQL 221

Query: 198 EIISPF-SEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGXXXXXXXXPRIPIFI 256
           +I  PF +E I+  YSH+++ RDY SRFVW+ PLK    + +           PRIPI+I
Sbjct: 222 DIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYI 281

Query: 257 ETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWYM 316
           +T+TI+R+D+   C+ +A +Y + +G+G  + S+F   G+ RL+ LL  N+++CL+ W M
Sbjct: 282 DTTTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNM 341

Query: 317 CLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIKVSGR 376
           CLK G+  +N        GVP  L    +      FE KR ++I  L  +N  +   +  
Sbjct: 342 CLKLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYK---TST 398

Query: 377 RRGIIYLEDE 386
            +G++Y +DE
Sbjct: 399 NKGLVYAQDE 408

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  191 bits (485), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 111/360 (30%), Positives = 195/360 (54%), Gaps = 22/360 (6%)

Query: 46  DFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKL--HAGNVETKFLLLKRRYYVDA 103
           D  +Y       LTQ+  D++ + +L+ +N++    KL  H+  +E K+    RRYY++ 
Sbjct: 61  DMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALE-KYNFTSRRYYLNE 119

Query: 104 DGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWR-RLHSYLRHNYANTTRAFAQICV 162
           D  + D +    ++CEP+ M+D+++  HLK   LH    +   L+  ++N  R +   C 
Sbjct: 120 DNNIIDKRKPGRIICEPKYMYDIVIAYHLK---LHSSYAVSERLKKFFSNVGRQYIDYCA 176

Query: 163 KYCSQCNPEEELR--------PYKKFRHTNIYSGLLPLERVHVEIISPFSE-AIEGTYSH 213
           KYCS+C P+E            +K  R+  I   L P+ER+H+EI +PF +  IE  Y  
Sbjct: 177 KYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQR 236

Query: 214 VLFFRDYYSRFVWMQPLKGDDVRDITKGXXXX-XXXXPRIPIFIETSTIDRQDLFEACED 272
           +L+ RDY +R++W   LK   ++ IT             +PIF+++STID  DLF+ CE 
Sbjct: 237 ILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEK 296

Query: 273 VAGQYSLYIGLGMS-QSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNA 331
           ++ +Y + +GLG + +   F  +G+E  + L+  N+ +CL+SW   L +G+  HN  +N+
Sbjct: 297 ISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNS 356

Query: 332 RILGVPGNLLHSTVCDYG-RQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAF 390
           RIL  P ++++      G ++F  +R  +I++    N V++   G    II++EDE ++ 
Sbjct: 357 RILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKL---GNVASIIFIEDEATSI 413

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  187 bits (475), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/383 (31%), Positives = 194/383 (50%), Gaps = 25/383 (6%)

Query: 46  DFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADG 105
           D   Y  +  G+++Q+ + L ++  +T++N+        +G+   K + + RRYY DA+G
Sbjct: 62  DITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDANG 121

Query: 106 IVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYC 165
           ++RD   ++ +V +P   FD+IM  HL N HL   R++  LR  YAN      +  ++YC
Sbjct: 122 MIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYC 181

Query: 166 SQCNPEEELRPYKKFRHTNIYSGLLPLERVHVEIISPF-SEAIEGTYSHVLFFRDYYSRF 224
           S CNP  +L P K      ++   LPLER+ +EII PF +E +EG YS+++  +D+  RF
Sbjct: 182 SVCNPSLKLTP-KVQPKPYLFEKALPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRF 240

Query: 225 VWMQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLG 284
            W++PLK    ++I           PR+PI++E++T+D  DLF+  E +  +Y + IGLG
Sbjct: 241 EWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLG 300

Query: 285 MSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHST 344
            +  S+  +    R+   L  + ++CL  +  CLKYG T +N     + LG      H +
Sbjct: 301 CTTRSSAAQ-ATARINRDLNDHHDECLFDFNNCLKYGPTKYN---QIKYLG-----FHKS 351

Query: 345 VCDYGRQFELKREDLIEKLFARNVVEIK------VSGRRRGIIYLED-----ETSAFKMP 393
            CD     E +   L  K  A+    +K      V  R  G +YLE      E +A    
Sbjct: 352 PCDIISHSETQ---LKAKFRAKRAFILKHSPSSCVMNRGMGTLYLESPNGIQEDAAASSA 408

Query: 394 DEEYISAENETDMNDDDLGFGSA 416
           DE   + + E +  D+    GS 
Sbjct: 409 DELSSAKDAEDEERDNSTREGSG 431

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  168 bits (426), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/338 (27%), Positives = 170/338 (50%), Gaps = 15/338 (4%)

Query: 46  DFIKYQESVKGQLTQDQFDLVRSCSLTEDNL-------MTTSDKLHAGNVETKFLLLKRR 98
           D ++ +      LTQ  + L+R  +   +          T S K + G    KF+L++ R
Sbjct: 50  DHLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSGK-YMGTANKKFMLMEDR 108

Query: 99  YYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFA 158
           Y ++  G + D +    ++  P  ++DLIM  H  N HL   ++H  LR  Y+N +RA  
Sbjct: 109 YQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALV 168

Query: 159 QICVKYCSQCNPEEELRPYKKFRHTNIYS--GLLPLERVHVEIISPFSEA--IEGTYSHV 214
           ++ ++ CS CNP+     YK   +T  +S       E++HVEI  PF +       +SHV
Sbjct: 169 RLSLQNCSHCNPKS---TYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHV 225

Query: 215 LFFRDYYSRFVWMQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVA 274
           ++ RDY++R+VW+ PL+   V+++            RIPI+IE+ T+D  +L +  + ++
Sbjct: 226 IYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRIS 285

Query: 275 GQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARIL 334
              +L +G+G ++   FQ +G+  ++ L  +N E C  +W   +     ++N  YN  I 
Sbjct: 286 KTTNLILGVGTTKLDEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIY 345

Query: 335 GVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIK 372
           G+P NL+        + ++ KR+  I    ++N + +K
Sbjct: 346 GIPLNLMAQETLADNKTYKKKRQRTILLTLSKNTILLK 383

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  157 bits (396), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 107/396 (27%), Positives = 194/396 (48%), Gaps = 18/396 (4%)

Query: 18  EFDMPAVGEPIEKYHXXXXXXXXXXX-XXDFIKYQESVKGQLTQDQFDLVRSCSLTEDNL 76
           +F  P +G+  E Y+              + ++++ ++K  +T D +  +R  SL ED+ 
Sbjct: 27  DFFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDA 86

Query: 77  -MTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNG 135
            +  S K+      +K + L+ RY  ++DG + + K ++ ++CEP+ ++ L M  H  N 
Sbjct: 87  PIPASLKIKT----SKKMYLQIRYSKNSDGDLIETK-TNKLLCEPKYIYKLTMKAHFMNN 141

Query: 136 HLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYK-KFRHTNIYSGLLPLER 194
           H+   +L+  L   Y N       + ++YCS CN   ++R  +  +   N Y   LPLER
Sbjct: 142 HMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLER 201

Query: 195 VHVEIISPFSEA---IEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGXXXXXXXXPR 251
           + ++I  PF+++   I   YSH+L  RDY+SR+ W+ PLK  ++++I+          PR
Sbjct: 202 LQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPR 261

Query: 252 IPIFIETSTIDRQDLFEACEDVAGQY--SLYIGLGMSQSSTFQKNGVERLRYL--LQRNE 307
            PIF+ +  I    L +    +  +Y   + IG+G  +   F + G+ RL YL  L+ N+
Sbjct: 262 TPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENK 321

Query: 308 EQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARN 367
           E+C   WY C++      N  ++         L+     +  + FE KR+ L+  L   N
Sbjct: 322 EKCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEEN 381

Query: 368 VVEIKVSGRRRGIIYLEDETSAFKMPDEEYISAENE 403
           V++I   G    IIY ++  S  ++ +++     NE
Sbjct: 382 VLKIGECG---SIIYFDNNNSGKELDEKDVNGGVNE 414

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  155 bits (393), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 104/365 (28%), Positives = 187/365 (51%), Gaps = 14/365 (3%)

Query: 48  IKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIV 107
           I    S    L+++ +DLV++  LT  N+    + L   N  T+ + LK RYY D+  +V
Sbjct: 58  IAVANSKTNYLSKELYDLVKNDDLTRKNVAVALN-LDEKNAITRLIPLKHRYYRDSKLMV 116

Query: 108 RDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQ 167
            D    + +V +P   F ++M  HL N HL    ++  L   +AN +  F +  ++YCS 
Sbjct: 117 HDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSI 176

Query: 168 CNPEEELRPYKKFRHTNIYSGLLPLERVHVEIISPF-SEAIEGTYSHVLFFRDYYSRFVW 226
           CN  ++    KK    +    +L  ER+ +++++PF ++ I+  Y+H+L   D++++F+W
Sbjct: 177 CNSNKKNIRRKKEPQLSNSPDILFYERLILDVVAPFGAKKIQKRYTHILTITDFHTKFMW 236

Query: 227 MQPLKGDDVRDITKGXXXXXXXXPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGM- 285
             PLK   +R I           P  P+FI + T+   D+FE C  +A +Y++ IGLG  
Sbjct: 237 SFPLKNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTR 296

Query: 286 SQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNL---LH 342
           +    + KN    +  +L  ++ +CL+SW+MCLK+ A   +   N++    P N    L 
Sbjct: 297 NMQKAYSKNPY--VTRILNSHKTECLKSWFMCLKWLADRQS---NSKFDIRPPNKNYGLF 351

Query: 343 STVCDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEYISAEN 402
           S + D+ +++E + + +I +L + N + I         IY EDE S   + ++E     +
Sbjct: 352 SGMTDFLKKYEERSKMIIGRLPSENFINIDEGSH---FIYSEDEFSFDNLVEKETPKKLS 408

Query: 403 ETDMN 407
           E+ +N
Sbjct: 409 ESVVN 413

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 57/142 (40%), Gaps = 25/142 (17%)

Query: 116 VVCEPELMFDLIMCGHLK--------NGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQ 167
           + C P L+  +I C H            H     + S L   Y N ++      V  C  
Sbjct: 154 IWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAACPD 213

Query: 168 CNPEEELRPYKKFRHTNIYSGLLPL-----ERVHVEIISPFSEAI-----EGTYSHVLFF 217
           C P       KKF  T +   +LPL     +R+ V+I+S    +        T + +L+ 
Sbjct: 214 CKPLSS----KKFNITRV--NVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTKNAILYI 267

Query: 218 RDYYSRFVWMQPLKG-DDVRDI 238
            DY+S  VW+  L G +D  DI
Sbjct: 268 GDYHSGAVWLFALDGEEDATDI 289

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 414 GSATRLTTPLTSPGRTPSRTPNRTPGRTPGRTPNEV 449
            S T L +PL SP  +P  TP+ TP  TP  TP+ +
Sbjct: 602 NSITPLQSPLQSPINSPIPTPSHTPSHTPSHTPSHL 637

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 415 SATRLTTPLTSPGRTPSRTPNRTPGRTPGRTPNEV 449
           S++   TPL SP ++P  +P  TP  TP  TP+  
Sbjct: 599 SSSNSITPLQSPLQSPINSPIPTPSHTPSHTPSHT 633

>TDEL0E03810 Chr5 (718114..720576) [2463 bp, 820 aa] {ON} Anc_5.245
           YJL029C
          Length = 820

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%)

Query: 406 MNDDDLGFGSATRLTTPLTSPGRTPSRTPNRTPGRTPGRT 445
           M   D  +    R    ++ P RTPSRTP+RTP R   +T
Sbjct: 751 MRISDAAWARFIRNDLKMSPPSRTPSRTPSRTPSRQQIQT 790

>KLTH0E13442g Chr5 complement(1192885..1194228) [1344 bp, 447 aa]
           {ON} similar to uniprot|Q02884 Saccharomyces cerevisiae
           YPL101W ELP4 Elongator protein part of the HAP
           subcomplex of Elongator which is a six-subunit component
           of the RNA polymerase II holoenzyme required for
           Elongator structural integrity and histone
           acetyltransferase activity
          Length = 447

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 41/84 (48%), Gaps = 10/84 (11%)

Query: 423 LTSPGRTP---SRT--PNRTPGRTP---GRTPNEVRKVQGGELENLGAENQ-KVDDVDST 473
           L +PG +P   SR   PNRTP + P   G TP +VR V GG +  L   N  ++  V + 
Sbjct: 10  LGAPGGSPRVLSRGAGPNRTPQQPPLARGITPRDVRSVTGG-ISRLSVRNTPELSPVVTK 68

Query: 474 GTSSELSGPAQKYYPGNSRSTTYT 497
           G   + S P  +  P  S+  T T
Sbjct: 69  GLELDASHPGIRPSPATSQPATST 92

>Suva_3.9 Chr3 complement(13689..14552) [864 bp, 287 aa] {ON}
           YCL010C (REAL)
          Length = 287

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 421 TPLTSPGRTPSRTPNRTPGRTPGRTPNEV 449
            P  +PG+ P + P + PG+ PG+ P + 
Sbjct: 110 APGKAPGKAPGKAPGKAPGKAPGKAPGKA 138

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 15/24 (62%)

Query: 426 PGRTPSRTPNRTPGRTPGRTPNEV 449
           PG+ P + P + PG+ PG+ P + 
Sbjct: 107 PGKAPGKAPGKAPGKAPGKAPGKA 130

>NDAI0K01990 Chr11 (448695..450674) [1980 bp, 659 aa] {ON} Anc_2.515
           YKR005C
          Length = 659

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 449 VRKVQGGELENLGAENQKVDDVDSTGTSSELSGPAQKYYPGNSRSTTY 496
           ++KV  G  +  G  N K+ D+DS G+SS  +GPA KY+     +  Y
Sbjct: 123 LKKVLSGFTQ--GQRNVKLQDIDSNGSSSITNGPALKYFKDKENNKIY 168

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 43/217 (19%), Positives = 80/217 (36%), Gaps = 33/217 (15%)

Query: 191 PLERVHVEIISPFSEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGXXXXXXXXP 250
           P + +H ++  P S+    T ++ + F D  +RF W+ PL+       +K          
Sbjct: 666 PFQYIHTDLFGPMSDVSATTPTYFISFVDENTRFRWVYPLR-------SKSAEHILLVFR 718

Query: 251 RIPIFIETSTIDRQDLFEACEDVAGQY------SLYIGLGM----SQSSTFQKNGV-ERL 299
           ++  FI T    +   F+   D   +Y        +I  G+    + ++    NGV ER 
Sbjct: 719 KLVNFIRTQFSTKVKAFQM--DRGSEYRNELLDDFFIDKGIKSIYNTAADSASNGVAERT 776

Query: 300 RYLLQRNEEQCLRS-------WYMCLKYGATNHNLNYNARILGVP------GNLLHSTVC 346
             L   +    L++       WY  +++     N   N+ I   P        L   T+ 
Sbjct: 777 NLLFLNDCRTLLKATNLPNNMWYHAVEFATLIRNTMINSSINDSPRAKAGLEGLDIKTIL 836

Query: 347 DYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYL 383
            +G++  +   D   KL  R  +   +   +    YL
Sbjct: 837 PFGQEVVVHNHDTDSKLKPRGDLGFALCPSKESFGYL 873

>KNAG0I01470 Chr9 (282849..284957) [2109 bp, 702 aa] {ON} Anc_1.375
           YFR015C
          Length = 702

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 7/104 (6%)

Query: 376 RRRGIIYLEDETSAFK--MPD--EEYISAE-NETDMNDDDLGFGSATRLTTPLTSPGRTP 430
           +R G+ Y++    A +   PD  +E +  E N T+M  D +  G   ++T PL+ PG   
Sbjct: 600 KRMGLEYVKARQLALRRAYPDLFKELVGEELNPTNM--DSMAGGQKFKVTRPLSVPGSPS 657

Query: 431 SRTPNRTPGRTPGRTPNEVRKVQGGELENLGAENQKVDDVDSTG 474
             T N T   TPG            +  NL  +    DD+D+ G
Sbjct: 658 GATVNSTVYMTPGDLGTLQDANNIDDYFNLNVDGAVEDDLDNDG 701

>NDAI0E00730 Chr5 complement(148162..152715) [4554 bp, 1517 aa] {ON}
           Anc_8.758 YOR291W
          Length = 1517

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 8/91 (8%)

Query: 420 TTPLTSPGRTPSRTPNRTPGRTPGRTPNEVRKVQG-GELENLGAENQKVD-----DVDST 473
           + PL SP R  SR+P+R P R    T +++   +G   LEN    N   D     + D  
Sbjct: 111 SAPLISPSREISRSPSRNP-RFNFFTEDQINSAEGTSTLENTDF-NTPWDATPSYEQDKI 168

Query: 474 GTSSELSGPAQKYYPGNSRSTTYTEASNNDF 504
             SSEL+      Y   SR  + + + N+DF
Sbjct: 169 YASSELNSRRSSIYSNFSRRPSLSHSRNHDF 199

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 191 PLERVHVEIISPFSEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDI 238
           P E +H ++  P S     +  + + F D  +RF W+ PLK  D   I
Sbjct: 375 PFEYIHTDLFGPVSGVDITSPKYFISFTDENTRFRWVFPLKKKDADHI 422

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 191 PLERVHVEIISPFSEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDI 238
           P E +H ++  P S     +  + + F D  +RF W+ PLK  D   I
Sbjct: 290 PFEYIHTDLFGPVSGVDITSPKYFISFTDENTRFRWVFPLKKKDADHI 337

>TPHA0C02030 Chr3 complement(455550..458213) [2664 bp, 887 aa] {ON}
           Anc_8.442 YDR227W
          Length = 887

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 18/46 (39%)

Query: 414 GSATRLTTPLTSPGRTPSRTPNRTPGRTPGRTPNEVRKVQGGELEN 459
            + + +  P   P   P+  PN  P   P   PNEV      E+ N
Sbjct: 708 STTSEIDKPNEVPNAAPNEVPNAAPNEVPNAAPNEVPNAAPNEVPN 753

>TBLA0B00800 Chr2 complement(173024..175246) [2223 bp, 740 aa] {ON} 
          Length = 740

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 424 TSPGRTPSRTPNRTPGRTPGRTPNEVRKVQ 453
           T P  T S+TP+ TP  TP  TP+E  ++Q
Sbjct: 436 TMPSLTQSKTPSETPSETPSETPSEALQLQ 465

>TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,
           1248 aa] {ON} 
          Length = 1248

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 24/49 (48%)

Query: 191 PLERVHVEIISPFSEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDIT 239
           P + +H ++  P          ++L F D  +R+ W+ PL+  D + IT
Sbjct: 589 PFQFIHTDLFGPVQVTAVNVPRYLLAFTDECTRYKWVFPLREKDSQSIT 637

>TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 24/49 (48%)

Query: 191 PLERVHVEIISPFSEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDIT 239
           P + +H ++  P          ++L F D  +R+ W+ PL+  D + IT
Sbjct: 81  PFQFIHTDLFGPVQVTAVNVPRYLLAFTDECTRYKWVFPLREKDSQSIT 129

>TDEL0B06310 Chr2 (1116175..1118283) [2109 bp, 702 aa] {ON}
           Anc_1.375 YFR015C
          Length = 702

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 376 RRRGIIYLEDETSAFK--MPDE-EYISAENETDMNDDDLGFGSATRLTTPLTSPGRTPSR 432
           RR G+ Y++    A +   PD  + +  E   D N D L  G   ++  PL+ PG     
Sbjct: 600 RRMGLEYVKARQLALRRAYPDLFKQLVGEELNDTNMDTLAGGKKMKIARPLSVPGSPRES 659

Query: 433 TPNRTPGRTPG 443
             N T   TPG
Sbjct: 660 RANSTVYMTPG 670

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,478,502
Number of extensions: 2471467
Number of successful extensions: 7866
Number of sequences better than 10.0: 72
Number of HSP's gapped: 7976
Number of HSP's successfully gapped: 92
Length of query: 508
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 394
Effective length of database: 40,409,475
Effective search space: 15921333150
Effective search space used: 15921333150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)