Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13662g8.263ON51951927780.0
Kwal_56.237918.263ON51851823850.0
SAKL0H17006g8.263ON53151519280.0
KLLA0F19162g8.263ON52848218160.0
TDEL0F039008.263ON55948118130.0
KNAG0G020408.263ON59152818140.0
Suva_10.1738.263ON59248318070.0
CAGL0L12254g8.263ON57448218000.0
YLR089C (ALT1)8.263ON59248118020.0
Skud_12.1578.263ON59248118010.0
Smik_12.1488.263ON59248117920.0
NCAS0B050208.263ON56848117700.0
Kpol_392.58.263ON51250717570.0
ZYRO0C01628g8.263ON53448317530.0
NDAI0B019908.263ON58851517570.0
TPHA0J007508.263ON52252217160.0
KAFR0B027308.263ON53949217130.0
AGR085W8.263ON52150117040.0
Ecym_43078.263ON53450916770.0
Skud_4.3728.263ON50751516630.0
NCAS0B038408.263ON49748216580.0
KNAG0M012108.263ON52147816480.0
Smik_4.3578.263ON50750516450.0
YDR111C (ALT2)8.263ON50751316330.0
Suva_2.2718.263ON50750616240.0
TBLA0E044408.263ON56247616280.0
KAFR0B05520singletonON51048316160.0
Kpol_543.398.263ON49248215970.0
KAFR0B055308.263ON51448315980.0
NDAI0J013608.263ON50149915630.0
TBLA0F030608.263ON50048815510.0
TPHA0A018008.263ON49848515260.0
TBLA0G01630singletonON50049015150.0
YIL116W (HIS5)2.252ON3851431472e-09
Kwal_23.48882.252ON3891741446e-09
KNAG0E018502.252ON3841461436e-09
SAKL0E08492g2.252ON3841911411e-08
KLLA0F03509g2.252ON3871951392e-08
KLTH0G09614g2.252ON3891271356e-08
TDEL0C040902.252ON3831481321e-07
Ecym_32902.252ON3861921312e-07
NDAI0G057601.321ON4481891312e-07
Skud_9.552.252ON3851441302e-07
ADL249W2.252ON3871991303e-07
Smik_9.532.252ON3881491293e-07
KNAG0B053201.321ON4331681293e-07
NDAI0B037302.252ON3861471294e-07
SAKL0E02948g2.475ON4232291251e-06
NCAS0B064402.252ON3851691242e-06
Suva_6.1361.321ON4441881242e-06
TPHA0O014501.321ON4431701232e-06
ZYRO0A01672g2.252ON3861751223e-06
Kpol_278.23.511ON4983641223e-06
Kwal_26.77682.475ON4222201223e-06
Kwal_34.160181.472ON3791521214e-06
KNAG0B006603.511ON4961741214e-06
KLTH0D05478g2.475ON4212381204e-06
NDAI0B045502.102ON5651621214e-06
YJL060W (BNA3)1.321ON4441881205e-06
Kpol_1039.222.252ON3861911197e-06
TDEL0D019001.321ON4431711197e-06
Skud_10.1561.321ON4601881197e-06
TPHA0D033703.511ON4971551188e-06
Smik_10.1801.321ON4441741189e-06
Suva_9.782.252ON3861441171e-05
KAFR0J015802.252ON3831481142e-05
NCAS0A092001.321ON4453551142e-05
ZYRO0G20636g1.321ON4531851133e-05
CAGL0J05126g1.321ON4333531116e-05
SAKL0F02156g3.511ON4981241117e-05
Ecym_7228na 1ON4881871107e-05
KLTH0G19624gsingletonON4681901107e-05
KLLA0F10021g3.511ON4973251108e-05
KLLA0F01617g1.321ON4441681108e-05
KLLA0E00969g8.204ON4452371072e-04
TPHA0F012602.252ON3921971062e-04
SAKL0D11528g1.472ON3831521062e-04
Smik_7.693.511ON5001461063e-04
Ecym_62921.321ON4302441053e-04
KLTH0G19646g1.472ON3791511044e-04
YGL202W (ARO8)3.511ON5001461036e-04
CAGL0G01254g3.511ON5041221036e-04
CAGL0C01243g2.252ON3831461027e-04
NCAS0E006703.511ON4972211027e-04
AFR548C3.511ON4971511027e-04
KLLA0A04906gna 1ON4801241028e-04
Kwal_47.189823.511ON4961911010.001
KLTH0H10648g1.321ON4431781010.001
Kpol_1035.231.321ON4441711010.001
NDAI0I028303.511ON5001221010.001
KLTH0B00176g8.204ON4481921000.001
Kwal_47.17462na 1ON4921331000.001
KLTH0G02002g3.511ON4963241000.002
Kwal_8.5858.204ON446191990.002
Kpol_1032.398.204ON453408990.002
Suva_7.613.511ON500149980.002
Ecym_6319singletonON354343970.003
Skud_7.693.511ON500146960.004
ZYRO0C06028g3.511ON496122950.005
ABL038W2.475ON443241950.005
KAFR0A017101.321ON435172950.006
TDEL0A016008.204ON475183940.007
KAFR0B023808.204ON443182930.009
KNAG0G016808.204ON45261930.009
AEL170C1.321ON45875930.010
AGR141C8.204ON438178910.014
TBLA0B009902.102ON546160910.017
SAKL0H21824gna 1ON499130910.018
Kwal_14.25741.321ON443186900.019
AGR167Wna 1ON512201900.025
Smik_5.3198.204ON443178890.028
NCAS0B072202.102ON510159890.032
KAFR0D031602.475ON435272880.037
ZYRO0B11088g8.204ON450184870.045
KAFR0D014203.511ON492151870.050
TBLA0I011802.475ON443366860.057
SAKL0H18612g8.204ON445181850.085
TBLA0B093302.420ON40894840.093
SAKL0D06886g1.321ON44770830.14
NCAS0A057302.475ON438177830.16
TBLA0B080808.204ON444240820.18
KLTH0E07678gna 1ON492125820.18
TDEL0D057903.511ON49759820.19
KNAG0G005501.472ON387154820.21
Kpol_480.11.472ON380153810.22
NCAS0A038308.204ON446199810.24
SAKL0E12188g2.102ON530166810.27
Smik_8.2182.102ON513313810.27
ZYRO0G05346g2.102ON504159800.37
KLLA0D11110g2.102ON530165790.42
NCAS0G040501.472ON384152780.49
CAGL0I06578g8.204ON436175770.71
YHR137W (ARO9)2.102ON513290761.0
CAGL0G06028g2.102ON537161751.3
SAKL0E04268g2.420ON421174741.6
Suva_15.3342.102ON560164741.7
Suva_5.2818.204ON45032742.0
TDEL0G027002.340ON61429742.2
YER152C8.204ON44332732.4
Kwal_23.34582.328ON15382693.4
Skud_5.2908.204ON443179713.9
KNAG0H037302.102ON523176714.2
NDAI0D032404.351ON136293706.2
TDEL0A019402.420ON420134697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13662g
         (519 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...  1074   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   923   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   747   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   704   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   702   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   703   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   700   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   697   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   698   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   698   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   694   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   686   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   681   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   679   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   681   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   665   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   664   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   660   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   650   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   645   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   643   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   639   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   638   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   633   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   630   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   631   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   627   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   619   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            620   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   606   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   602   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   592   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              588   0.0  
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    61   2e-09
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    60   6e-09
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    60   6e-09
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    59   1e-08
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    58   2e-08
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    57   6e-08
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    55   1e-07
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    55   2e-07
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    55   2e-07
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    55   2e-07
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    55   3e-07
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    54   3e-07
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    54   3e-07
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    54   4e-07
SAKL0E02948g Chr5 complement(241418..242689) [1272 bp, 423 aa] {...    53   1e-06
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    52   2e-06
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    52   2e-06
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    52   2e-06
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    52   3e-06
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    52   3e-06
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    52   3e-06
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    51   4e-06
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    51   4e-06
KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} simila...    51   4e-06
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    51   4e-06
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    51   5e-06
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    50   7e-06
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    50   7e-06
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    50   7e-06
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    50   8e-06
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    50   9e-06
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    50   1e-05
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    49   2e-05
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    49   2e-05
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    48   3e-05
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    47   6e-05
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    47   7e-05
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    47   7e-05
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    47   7e-05
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    47   8e-05
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    47   8e-05
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    46   2e-04
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    45   2e-04
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    45   2e-04
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    45   3e-04
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    45   3e-04
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    45   4e-04
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    44   6e-04
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    44   6e-04
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    44   7e-04
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     44   7e-04
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    44   7e-04
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    44   8e-04
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    44   0.001
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    44   0.001
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    44   0.001
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    44   0.001
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    43   0.001
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    43   0.001
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    43   0.002
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    43   0.002
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    43   0.002
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    42   0.002
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    42   0.003
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    42   0.004
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    41   0.005
ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic ho...    41   0.005
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    41   0.006
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    41   0.007
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    40   0.009
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    40   0.009
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    40   0.010
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    40   0.014
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    40   0.017
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    40   0.018
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    39   0.019
AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-synte...    39   0.025
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    39   0.028
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    39   0.032
KAFR0D03160 Chr4 (618891..620198) [1308 bp, 435 aa] {ON} Anc_2.4...    39   0.037
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    38   0.045
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    38   0.050
TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {O...    38   0.057
SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} high...    37   0.085
TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON} Anc_2...    37   0.093
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    37   0.14 
NCAS0A05730 Chr1 (1121257..1122573) [1317 bp, 438 aa] {ON} Anc_2...    37   0.16 
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    36   0.18 
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    36   0.18 
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    36   0.19 
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       36   0.21 
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    36   0.22 
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     36   0.24 
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    36   0.27 
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    36   0.27 
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    35   0.37 
KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} simila...    35   0.42 
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    35   0.49 
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    34   0.71 
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    34   1.0  
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    33   1.3  
SAKL0E04268g Chr5 complement(338322..339587) [1266 bp, 421 aa] {...    33   1.6  
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    33   1.7  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    33   2.0  
TDEL0G02700 Chr7 (516198..518042) [1845 bp, 614 aa] {ON} Anc_2.3...    33   2.2  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    33   2.4  
Kwal_23.3458 s23 complement(298021..298482) [462 bp, 153 aa] {ON...    31   3.4  
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    32   3.9  
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    32   4.2  
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    32   6.2  
TDEL0A01940 Chr1 (355974..357236) [1263 bp, 420 aa] {ON} Anc_2.4...    31   7.4  

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score = 1074 bits (2778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/519 (100%), Positives = 519/519 (100%)

Query: 1   MMLSRQLTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPI 60
           MMLSRQLTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPI
Sbjct: 1   MMLSRQLTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPI 60

Query: 61  PLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPT 120
           PLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPT
Sbjct: 61  PLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPT 120

Query: 121 GELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIF 180
           GELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIF
Sbjct: 121 GELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIF 180

Query: 181 LTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDT 240
           LTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDT
Sbjct: 181 LTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDT 240

Query: 241 EQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQE 300
           EQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQE
Sbjct: 241 EQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQE 300

Query: 301 NGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEE 360
           NGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEE
Sbjct: 301 NGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEE 360

Query: 361 VKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYE 420
           VKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYE
Sbjct: 361 VKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYE 420

Query: 421 TFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGS 480
           TFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGS
Sbjct: 421 TFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGS 480

Query: 481 GFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519
           GFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD
Sbjct: 481 GFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/518 (83%), Positives = 480/518 (92%)

Query: 2   MLSRQLTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIP 61
           MLSR + R+MPHSRL+LR LS +  ++ D SQK LGSKKTL+D+N+CVLNAKYAVRG IP
Sbjct: 1   MLSRPIIRSMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIP 60

Query: 62  LRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTG 121
           LRAEEL+ KL+EEPGSLPF+KIINANIGNPQQLDQKPLTFYRQVL+LLQNP LI  L +G
Sbjct: 61  LRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSG 120

Query: 122 ELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFL 181
           ELHK FKPDAVERAKKMLKQVGGSVGAYS SQGVAGFR+SVAEFIEERDGEPASA DIFL
Sbjct: 121 ELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFL 180

Query: 182 TAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTE 241
           T GAS AVS ILS+FC G ENGALIPIPQYPLYTA+LALN++HALPYYLDE SGWSMDTE
Sbjct: 181 TTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTE 240

Query: 242 QVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQEN 301
           Q+E+VV+D+I+KG+RPTCLVVINPGNPTGA+L+ + IE ++ VAAKYS+V+IADEVYQEN
Sbjct: 241 QIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQEN 300

Query: 302 GFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEV 361
           GF+DA+FVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEV
Sbjct: 301 GFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEV 360

Query: 362 KQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYET 421
           KQVFLKLASISLCPVVTGQAL+DLMVRPPKKGDASYE DRQER  IH++LH++S LLY+ 
Sbjct: 361 KQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQA 420

Query: 422 FQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSG 481
           FQS+EGVSCQ+PQGAMYLFPKL+LS KAI KAES G+APDEYYCKELLEATGICTVPGSG
Sbjct: 421 FQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSG 480

Query: 482 FRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519
           F QVPGT+HLRTTFLAPGTEW+DSWKKFH+KF ++HRD
Sbjct: 481 FGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/515 (68%), Positives = 431/515 (83%), Gaps = 5/515 (0%)

Query: 6   QLTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAE 65
            + + MPHS L LR  S+         Q A   K +L D+N+ VL AKYAVRG IP +AE
Sbjct: 21  NIAKNMPHSTLFLRSFSSNFVPYK--FQPA--DKLSLEDLNENVLRAKYAVRGKIPQKAE 76

Query: 66  ELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELHK 125
           EL+++L  +P SLPF++IINANIGNPQQLDQKPLTFYRQVLSLLQNP ++E +P  +L +
Sbjct: 77  ELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQ 136

Query: 126 LFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAG 184
           ++KPDA++RA ++L  +GGSVGAYS SQGV GFR++VA+FI +RDG E A A DIFLTAG
Sbjct: 137 IYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAG 196

Query: 185 ASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVE 244
           AS+AVS ILS+ C G + G LIPIPQYPLYTA+LALN++HALPYYLDE S WS + E++E
Sbjct: 197 ASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIE 256

Query: 245 QVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFD 304
           +VV ++I KGV P CLVVINPGNPTGAILSPE+IEKI  VAAKY +VVIADEVYQEN F+
Sbjct: 257 KVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFN 316

Query: 305 DADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQV 364
            A+F SM+KVL+ LQ+   GK+DN+QLASLHSTSKGVSGECGQRGGYMEL+GFS +V+QV
Sbjct: 317 GAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQV 376

Query: 365 FLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQS 424
           FLKLASISLCPVVTGQALVDLMV PPK GDASYE D++ER+ IH++L  ++++LYETF  
Sbjct: 377 FLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNR 436

Query: 425 LEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQ 484
           LEG+ CQKPQGAMYLFP+LDLS KA++KAE L ++PDE+YC+ELLEATGICTVPGSGF Q
Sbjct: 437 LEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQ 496

Query: 485 VPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519
           VPGTYHLRTTFLAPGT+W+ +W++FH+KF +E+RD
Sbjct: 497 VPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/482 (69%), Positives = 402/482 (83%), Gaps = 2/482 (0%)

Query: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98
           K +L DVN+ VL AKYAVRG IP+RAEELR +L ++P SLPF+KII+ANIGNPQQLDQKP
Sbjct: 48  KLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKP 107

Query: 99  LTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGF 158
           LTFYR+VLSLLQ+P L+E      L  L+K D+++RAK++L +VGGSVGAYS SQGV G 
Sbjct: 108 LTFYREVLSLLQHPELLEEADEA-LQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGI 166

Query: 159 RQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217
           R++VA+FI +RD GE +   DI+LTAGAS+AVS ILS+ C G   G LIPIPQYPLYTA+
Sbjct: 167 RETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTAS 226

Query: 218 LALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEA 277
           LALN++  LPYYL E   WS D E++EQVV DAI+KG++PTCLVVINPGNPTGAILS ++
Sbjct: 227 LALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQS 286

Query: 278 IEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHST 337
           I+KI  VAAKY +VVIADEVYQEN F  + F SMKKVLR LQKT  G+YDN+QLASLHST
Sbjct: 287 IQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHST 346

Query: 338 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASY 397
           SKGVSGECGQRGGYMELVGF+ +++QVFLKLASISLCPVVTGQALVDLMV PP+ GD SY
Sbjct: 347 SKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESY 406

Query: 398 ELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLG 457
           E D+QER  IH++L ++++ L+ETF  LEG+ C+KPQGAMYL+PKLDL  K I++A+ L 
Sbjct: 407 EQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLE 466

Query: 458 MAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEH 517
           M PDE+YCK LLE TGICTVPGSGF QVPGTYHLRTTFL PGTEWV++W+KFH+ F D++
Sbjct: 467 MEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKY 526

Query: 518 RD 519
           RD
Sbjct: 527 RD 528

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/481 (69%), Positives = 397/481 (82%), Gaps = 2/481 (0%)

Query: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100
           T+RD+N+ VL AKYAVRG IP+RAEEL+ +L  +P SLPF+KI+NANIGNPQQL+QKPL+
Sbjct: 79  TVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLS 138

Query: 101 FYRQVLSLLQNPALIESLPTGELHK-LFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159
           FYRQVLS+LQ P ++E      + K +FK DA+ERAK++L+ VGGSVGAYS+SQGV G R
Sbjct: 139 FYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIR 198

Query: 160 QSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATL 218
           ++VA+FI ERD GEPA   DIFLTAGAS+AVS +LS+ C G E G LIPIPQYPLYTATL
Sbjct: 199 KTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATL 258

Query: 219 ALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAI 278
           ALN++H LPYYLDE SGWS +T ++E VV ++I  G+RP+ LVVINPGNPTG++LS EAI
Sbjct: 259 ALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAI 318

Query: 279 EKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 338
           EKI  VAAKY +VVIADEVYQEN F  ++F SMKKVLR LQK  PG YDNVQL SLHSTS
Sbjct: 319 EKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTS 378

Query: 339 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYE 398
           KGVSGECGQRGGYMEL GF+ E++QV LKLASISLCPVVTGQALVDLMV PPK GD SYE
Sbjct: 379 KGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYE 438

Query: 399 LDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGM 458
            DR+ER  IH  L  ++ LL++TF SLEG+ CQKP+GAMYLFP++ L  KAI+ A+ L  
Sbjct: 439 QDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEK 498

Query: 459 APDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518
            PDE+YC++LLEATGICTVPGSGF Q PGTYHLRTTFLAPGTEW+  W+ FH+KF D++R
Sbjct: 499 TPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYR 558

Query: 519 D 519
           D
Sbjct: 559 D 559

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/528 (64%), Positives = 423/528 (80%), Gaps = 10/528 (1%)

Query: 1   MMLSRQLTRT----MPHSRLILRRLSAKAAVKSDLSQKAL-GSKKTLRDVNQCVLNAKYA 55
           +++SR+ + +    MPH+ +  +R  AK  + S    K    ++  + D+N+ VL AKYA
Sbjct: 65  LIISRKFSASENIKMPHA-VKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKAKYA 123

Query: 56  VRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALI 115
           VRG IP+RAE+L+H+L E+P SLPF+KIINANIGNPQQL+QKPL+FYRQVLSLLQ P L+
Sbjct: 124 VRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFPELL 183

Query: 116 ESLPT--GELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-E 172
            SL         L+K DAV RA+K+L+ +GGSVGAYS SQGV G R++VA+FI  RD  E
Sbjct: 184 NSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNE 243

Query: 173 PASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDE 232
           PA   DIFLTAGAS+AVS +LS+FC G + G LIPIPQYPLYTATLALN++H LPYYLDE
Sbjct: 244 PAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDE 303

Query: 233 ASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVV 292
            SGWS +T++++ VV DAI + ++P+ LVVINPGNPTGA+LS +AI +I  +AAKY +VV
Sbjct: 304 KSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSEKAIAEIFEIAAKYGIVV 363

Query: 293 IADEVYQENGFD-DADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGY 351
           IADEVYQEN FD D  F SMKKVLR LQ+  PGK+D VQLASLHSTSKGVSGECGQRGG+
Sbjct: 364 IADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRGGF 423

Query: 352 MELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSL 411
           MEL GFS E++QV LKLASISLCPVVTGQALVDLMV PP++G+ SYELD+ ER+ IH+ L
Sbjct: 424 MELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIHSEL 483

Query: 412 HQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEA 471
           H+++  L+ETF  LEG+ CQKPQGAMYLFP+L+L  KA++KA+ + M  DE+YCKELLE 
Sbjct: 484 HKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKELLEN 543

Query: 472 TGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519
           TGICTVPGSGF QVPGTYHLRTTFLAPGTEW+D W+KFH++F +++RD
Sbjct: 544 TGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHKEFYNKYRD 591

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/483 (69%), Positives = 398/483 (82%), Gaps = 6/483 (1%)

Query: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100
           TL DVN+ VL A+YAVRG IP+RAEEL+ +L ++P SLPFNKIINANIGNPQQL QKPLT
Sbjct: 112 TLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLT 171

Query: 101 FYRQVLSLLQNPALI---ESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAG 157
           +YRQVLSLLQ P L+   E    G   KLFK DA++RAK ++K +GGSVGAYS+SQGV G
Sbjct: 172 YYRQVLSLLQYPELLNHNEQELVGS--KLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEG 229

Query: 158 FRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTA 216
            R+SVA+FI +RDG E A   DIFLTAGAS+AV+ +LS+FC G E G LIPIPQYPLYTA
Sbjct: 230 IRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTA 289

Query: 217 TLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPE 276
           TLALN++  LPYYLDE SGWS + E++E VVK+AI+  ++PT LVVINPGNPTGA+LSPE
Sbjct: 290 TLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPE 349

Query: 277 AIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHS 336
           +I +I  VAAKY  VVIADEVYQEN F   +F SMKKVLR LQ+  PGK+DNVQLASLHS
Sbjct: 350 SIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHS 409

Query: 337 TSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDAS 396
           TSKGVSGECGQRGGYMEL GFS E++QV LKLASISLCPVVTGQALVDLMVRPP +G+ S
Sbjct: 410 TSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEES 469

Query: 397 YELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESL 456
           +E D+ ERN+IH  L+ ++  LYETF SLEG+ CQKPQGAMYLFPK+D+  KAI++A  L
Sbjct: 470 FESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHL 529

Query: 457 GMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDE 516
            + PDE+YCK+LLE+TGICTVPGSGF Q PGTYHLRTTFLAPG EW+  W+ FH++F D+
Sbjct: 530 ELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQ 589

Query: 517 HRD 519
           +RD
Sbjct: 590 YRD 592

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/482 (68%), Positives = 397/482 (82%), Gaps = 2/482 (0%)

Query: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98
           + TL+DVN+CVLNAKYAVRG IP+RAEEL+ +L+E P SLPFN IINANIGNPQQL QKP
Sbjct: 94  QATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQLKQKP 153

Query: 99  LTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGF 158
           L+FYRQVLSLLQ P LI +L       + K DA++RAK++L  +GGSVGAYS+SQGV G 
Sbjct: 154 LSFYRQVLSLLQYPELIPTLENNP-QTMIKQDAIDRAKRLLDDIGGSVGAYSSSQGVLGI 212

Query: 159 RQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217
           R++VA+FI  RD G  A   DIFLTAGASSAV  +LS+FC G E G LIPIPQYPLYTAT
Sbjct: 213 RKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTAT 272

Query: 218 LALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEA 277
           LAL ++HALPYYL+E +GWS D E++E ++ D+I   ++P+ LVVINPGNPTGA+LS EA
Sbjct: 273 LALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGNPTGAVLSEEA 332

Query: 278 IEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHST 337
           IE+I T+AAKY ++VIADEVYQEN F+D  F SMKKVLR LQ  +PG YDNVQLASLHST
Sbjct: 333 IEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHST 392

Query: 338 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASY 397
           SKGVSGECGQRGGYMELVGF+ +++QV LKLASISLCPVVTGQALVDLMV PP+KG+ SY
Sbjct: 393 SKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEESY 452

Query: 398 ELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLG 457
           E D++ER  IH  LH+++TLL++ F  L+G+SCQKPQGAMYLFPKL+L  KAI++A    
Sbjct: 453 EQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEALHQD 512

Query: 458 MAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEH 517
           M+PDE+YCK LLE TGICTVPGSGF Q PGTYHLRTTFLAPGT+W++ W  FHQ+F ++ 
Sbjct: 513 MSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKF 572

Query: 518 RD 519
           ++
Sbjct: 573 KN 574

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/481 (69%), Positives = 396/481 (82%), Gaps = 2/481 (0%)

Query: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100
           TL DVN+ VL AKYAVRG IP+RAEEL+ +L ++P SLPF++IINANIGNPQQL QKPLT
Sbjct: 112 TLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLT 171

Query: 101 FYRQVLSLLQNPALIESLPTGEL-HKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159
           +YRQVLSLLQ P L+       +  KLFK DA++RAK +++ +GGSVGAYS+SQGV G R
Sbjct: 172 YYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIR 231

Query: 160 QSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATL 218
           +SVAEFI +RD GE +   DIFLTAGAS+AV+ +LS+FC G E G LIPIPQYPLYTATL
Sbjct: 232 KSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATL 291

Query: 219 ALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAI 278
           ALN++ ALPYYLDE SGWS + E++E VVK+AI+  ++PT LVVINPGNPTGA+LSPE+I
Sbjct: 292 ALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESI 351

Query: 279 EKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 338
            +I  VAAKY  VVIADEVYQEN F    F SMKK+LR LQ+  PGK+DNVQLASLHSTS
Sbjct: 352 AQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTS 411

Query: 339 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYE 398
           KGVSGECGQRGGYMEL GFS E++QV LKLASISLCPVVTGQALVDLMVRPP +G+ S+E
Sbjct: 412 KGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE 471

Query: 399 LDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGM 458
            D+ ERN+IH  L  ++  LYETF SLEG+ CQKPQGAMYLFPK+DL  KA+++A  L +
Sbjct: 472 SDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLEL 531

Query: 459 APDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518
            PDE+YCK+LLE+TGICTVPGSGF Q PGTYHLRTTFLAPG EW+  W+ FH++F D++R
Sbjct: 532 TPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYR 591

Query: 519 D 519
           D
Sbjct: 592 D 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/481 (69%), Positives = 396/481 (82%), Gaps = 2/481 (0%)

Query: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100
           TL DVN+ VL AKYAVRG IP+RAEEL+ +L ++P SLPF+KIINANIGNPQQL QKPLT
Sbjct: 112 TLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLT 171

Query: 101 FYRQVLSLLQNPALIESLPTGELH-KLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159
           +YRQVLSLLQ P L+       +  KLFK DA++RAK +++ +GGSVGAYS+SQGV G R
Sbjct: 172 YYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIR 231

Query: 160 QSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATL 218
           +SVAEFI +RD GE +   DIFLTAGAS+AV+ +LS+FC G E G LIPIPQYPLYTATL
Sbjct: 232 KSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATL 291

Query: 219 ALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAI 278
           ALN++ ALPYYLDE SGWS + E++E VVK+AI+  ++PT LVVINPGNPTGA+LSPE++
Sbjct: 292 ALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESV 351

Query: 279 EKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 338
            +I  VAAKY  VVIADEVYQEN F    F SMKK+LR LQ+  PGK+DNVQLASLHSTS
Sbjct: 352 SQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTS 411

Query: 339 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYE 398
           KGVSGECGQRGGYMEL GFS E++QV LKLASISLCPVVTGQALVDLMVRPP +G+ S+E
Sbjct: 412 KGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE 471

Query: 399 LDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGM 458
           LD+ ERN+IH  L  ++  LY+TF SLEG+ CQKPQGAMYLFPK+DL  KA+++A  L +
Sbjct: 472 LDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLEL 531

Query: 459 APDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518
            PDE+YCK LLE+TGICTVPGSGF Q PGTYHLRTTFLAPG EW+  W+ FH++F D++R
Sbjct: 532 TPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYR 591

Query: 519 D 519
           D
Sbjct: 592 D 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/481 (68%), Positives = 395/481 (82%), Gaps = 2/481 (0%)

Query: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100
           TL DVN+ VL AKYAVRG IP+RAEEL+ +L ++P SLPFNKIINANIGNPQQL QKPLT
Sbjct: 112 TLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLT 171

Query: 101 FYRQVLSLLQNPALIESLPTGEL-HKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159
           +YRQVLSLLQ P L+       +  KLFK DA++RAK +++++GGSVGAYS+SQGV G R
Sbjct: 172 YYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQGVEGIR 231

Query: 160 QSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATL 218
           +SVAEFI +RD GE +   DIFLTAGAS+AV+ +LS+FC G E G LIPIPQYPLYTATL
Sbjct: 232 RSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATL 291

Query: 219 ALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAI 278
           ALN++ ALPYYLDE+SGWS + E++E VVK+AI   ++ T LVVINPGNPTGA+LSPE+I
Sbjct: 292 ALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTGAVLSPESI 351

Query: 279 EKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 338
            +I  VAAKY  VVIADEVYQEN F    F SMKK+LR LQ+  PGK+DNVQLASLHSTS
Sbjct: 352 AQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTS 411

Query: 339 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYE 398
           KGVSGECGQRGGYMEL GFS E++QV LKLASISLCPVVTGQALVDLMVRPP +G+ S+E
Sbjct: 412 KGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPLEGEESFE 471

Query: 399 LDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGM 458
            D+ ERN+IH  L  ++  LY+TF SLEG+ CQKPQGAMYLFPK+DL  +A+++A  L +
Sbjct: 472 SDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAVQEARHLEL 531

Query: 459 APDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518
            PDE+YCK+LLE+TGICTVPGSGF Q PGTYHLRTTFLAPG EW+  W+ FH++F D +R
Sbjct: 532 TPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDHYR 591

Query: 519 D 519
           D
Sbjct: 592 D 592

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/481 (68%), Positives = 391/481 (81%), Gaps = 2/481 (0%)

Query: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100
           TL ++N  VL AKYAVRG IP+RAEEL+ +L E+P SLPF+ I+NANIGNPQQL+QKPL+
Sbjct: 88  TLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLNQKPLS 147

Query: 101 FYRQVLSLLQNPALIESLPTGELHK-LFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159
           FYRQVLSLLQ P +++   +  +   LFK DA+ERAK +L ++GG+VGAYSASQGV G R
Sbjct: 148 FYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQGVYGIR 207

Query: 160 QSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATL 218
           ++VA FI +RD GEPA   DIFLTAGAS+AV  +LS+ C G E G LIPIPQYPLYTA+L
Sbjct: 208 KTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASL 267

Query: 219 ALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAI 278
           ALN++HALPYYLDE SGWS + +++E+VV  A  K +RP+ LVVINPGNPTGA+LS ++I
Sbjct: 268 ALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSI 327

Query: 279 EKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 338
           E I  +AAKY +VVIADEVYQEN F++  F SMKKVLR LQK  PG YD VQLASLHSTS
Sbjct: 328 EHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTS 387

Query: 339 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYE 398
           KGVSGECGQRGGYMEL GF+ EV+ V LKLASISLCPVVTGQALVDLMV PPKKGD S+E
Sbjct: 388 KGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKGDESFE 447

Query: 399 LDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGM 458
            D+ ER  I + LH ++  LY+ F +LEG+ CQKPQGAMYLFP+LDL  KA++KA+ L M
Sbjct: 448 QDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKAQHLEM 507

Query: 459 APDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518
           +PDE+YCK LLEATGICTVPGSGF Q PGTYHLRTTFLAPGTEW++ WK FHQ F + +R
Sbjct: 508 SPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDFYNTYR 567

Query: 519 D 519
           D
Sbjct: 568 D 568

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/507 (65%), Positives = 402/507 (79%), Gaps = 10/507 (1%)

Query: 15  RLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEE 74
           R+ +RRL+    +           K  + D+N+ VL AKYAVRG IPLRAEEL  KL  E
Sbjct: 14  RVGVRRLTLSTTLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEEL--KLYLE 71

Query: 75  PGS-LPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVE 133
            G  LPF+ +INANIGNPQQL QKPLTFYRQVLS+LQ P L+ES        +FK DA+E
Sbjct: 72  AGQKLPFDTVINANIGNPQQLKQKPLTFYRQVLSILQYPELLESG-----SNIFKKDAIE 126

Query: 134 RAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERD-GEPASANDIFLTAGASSAVSAI 192
           RA+K+LK++G SVG+YS+SQG+   R++VA FI +RD GE ++ NDIFLTAGASSAV  +
Sbjct: 127 RARKLLKEIG-SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYL 185

Query: 193 LSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIR 252
           LS+ C   ++G LIPIPQYPLYTATLALN+AHALPYYLDE+ GWS D  ++E+V+ D++ 
Sbjct: 186 LSILCKNEKSGVLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLD 245

Query: 253 KGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMK 312
           KG++PT LV+INPGNPTG+ILS E++EKI+ VAA + +V+IADEVYQEN F++A F SMK
Sbjct: 246 KGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMK 305

Query: 313 KVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASIS 372
           KVLR LQK  PG+YD VQLASLHSTSKGVSGECGQRGGYMEL GF+ E+KQV LKL SIS
Sbjct: 306 KVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSIS 365

Query: 373 LCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQK 432
           LCPVVTGQALVDLMV PP+KGD SYE D+ ER+ I N L  ++ LL+E F S+EGVSCQK
Sbjct: 366 LCPVVTGQALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQK 425

Query: 433 PQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLR 492
           P+GAMYLFPK+DL  K ++K++ L + PDE+YCK LLEATGICTVPGSGF Q PGTYHLR
Sbjct: 426 PEGAMYLFPKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLR 485

Query: 493 TTFLAPGTEWVDSWKKFHQKFVDEHRD 519
           TTFLAPGTEW+D W KFH +F D++RD
Sbjct: 486 TTFLAPGTEWIDRWNKFHAEFYDKYRD 512

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/483 (66%), Positives = 389/483 (80%), Gaps = 2/483 (0%)

Query: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98
           K  L +VN+ VL AKYAVRG IP+ A EL  KL ++P SLPF+ I++ANIGNPQ L QKP
Sbjct: 52  KLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKP 111

Query: 99  LTFYRQVLSLLQNPALIESLPTGELH-KLFKPDAVERAKKMLKQVGGSVGAYSASQGVAG 157
           LTFYRQVLSLLQ P L+E      +  KL++ DA+ RA+++L  +G SVGAYS SQG+ G
Sbjct: 112 LTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQG 171

Query: 158 FRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTA 216
            R++VA+FI ERDG E A A DIFLTAGASSAVS +LS+ C G E G LIPIPQYPLYTA
Sbjct: 172 IRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTA 231

Query: 217 TLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPE 276
           +LALN++H LPYYLDE SGWS +  ++E VV +AI + ++P+ LVVINPGNPTGA+LS E
Sbjct: 232 SLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEE 291

Query: 277 AIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHS 336
            I +I  +AAKY +VVIADEVYQEN FD A+F SMKK+LR LQK+ PG +DNVQLASLHS
Sbjct: 292 DISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHS 351

Query: 337 TSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDAS 396
           TSKGVSGECGQRGGYME+ GF+ +++QV LKLASISLCPVVTGQALVDLMV PPK GD S
Sbjct: 352 TSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDES 411

Query: 397 YELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESL 456
           YELD+QER +IH +L +++  L+ TF SLEG+ CQKP+GAMYLFP+L L  KAI+ AE  
Sbjct: 412 YELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHE 471

Query: 457 GMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDE 516
           GM PD +YCK+LLEATGICTVPGSGF Q PGTYHLRTTFLAPGTEW++ W+ FH+ F +E
Sbjct: 472 GMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEE 531

Query: 517 HRD 519
           +RD
Sbjct: 532 YRD 534

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/515 (63%), Positives = 400/515 (77%), Gaps = 12/515 (2%)

Query: 7   LTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEE 66
           +TR++ H  L       K A   D    A   + TL D+N+ VL AKYAVRG IP+RAEE
Sbjct: 84  MTRSISHHSL-------KVAKGKDF---APAEQLTLADLNENVLKAKYAVRGSIPMRAEE 133

Query: 67  LRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELH-K 125
           L+ +L   P +LPF++I+NANIGNPQQL QKPL+FYRQVLS+LQ P +++      +  K
Sbjct: 134 LKVQLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAK 193

Query: 126 LFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAG 184
           ++K DA++RAK +L ++GGSVGAYSASQGV G R++VA FI ERDG EPA   DIFLT  
Sbjct: 194 VYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVW 253

Query: 185 ASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVE 244
                  +LS+ C G + G LIPIPQYPLYTATLALN++HALPYYLDE SGWS + +++E
Sbjct: 254 CFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIE 313

Query: 245 QVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFD 304
           +VV+DA+ + + P+ LVVINPGNPTGA+L+ E+IE I  +AAKY +VVIADEVYQEN  D
Sbjct: 314 EVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIAD 373

Query: 305 DADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQV 364
              F SMKKVLR LQK+ PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL+GF+ EV++V
Sbjct: 374 GVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKV 433

Query: 365 FLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQS 424
            LKLASISLCPVVTGQALVDLMV PPKKGDASYE D+ ER  I + L  +++ LYETF  
Sbjct: 434 ILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVG 493

Query: 425 LEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQ 484
           LEG+ CQKPQGAMYLFPKLDL  KA+++A+ L M PDE+YCK LL+ATGICTVPGSGF Q
Sbjct: 494 LEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQ 553

Query: 485 VPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519
            PGTYHLRTTFLAPGTEW+  W+ FH++F D +RD
Sbjct: 554 EPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/522 (63%), Positives = 406/522 (77%), Gaps = 3/522 (0%)

Query: 1   MMLSRQLTRTMPHSRLIL--RRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRG 58
           MML  + T    ++ + L  +RL +   +           K T+ D+N+ VL AKYAVRG
Sbjct: 1   MMLRSRSTNCTVNAAIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRG 60

Query: 59  PIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESL 118
            IP RAE L+ +L++ P SLPF K+INANIGNPQQL+QKPLTFYRQVLSLLQ P +++  
Sbjct: 61  KIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDET 120

Query: 119 PTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASAN 177
            +G    L+K DA+ERAK++L  +G SVG+YS+SQGV G R++VAE+I  RDG E A A 
Sbjct: 121 FSGNTKTLYKQDAIERAKRILNDIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAE 180

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWS 237
           DIFLTAGASSAVS +L++ C G E+G LIPIPQYPLYTATLALN+ +ALPYYL+E SGWS
Sbjct: 181 DIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWS 240

Query: 238 MDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEV 297
            + E++E VV +AIR+ + P  LVVINPGNPTGAILS E+IEKI  VAA + +VVIADEV
Sbjct: 241 TNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEV 300

Query: 298 YQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGF 357
           YQEN F   +F SMKKVLR LQ+  PGKY+NVQLASLHSTSKGVSGECGQRGGYMEL GF
Sbjct: 301 YQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGF 360

Query: 358 SEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTL 417
           S E+K   LKL SISLCPVVTGQALVDLM  PPKKG+ASYE D+ ER+ IH+ L++++T 
Sbjct: 361 STEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATY 420

Query: 418 LYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTV 477
           L++ F  +EGVSCQKPQG+MYLFPK+D+  KA+ KA+ L + PDE YC ELLEATGICTV
Sbjct: 421 LWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTV 480

Query: 478 PGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519
           PGSGF Q PGT+HLRTTFLAPGT W+D W++FHQ F +++RD
Sbjct: 481 PGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/492 (66%), Positives = 403/492 (81%), Gaps = 3/492 (0%)

Query: 28  KSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINAN 87
           K +L+ K  G + T+ D+N+ VL AKYAVRG IP RAEEL+ +L E+P SLPF+KIINAN
Sbjct: 47  KHNLNFKPAG-QLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINAN 105

Query: 88  IGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGE-LHKLFKPDAVERAKKMLKQVGGSV 146
           IGNPQQL Q+PL+FYRQVLSLLQ P L+ ++ T      ++K DA+ RAKK+LK +GGSV
Sbjct: 106 IGNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSV 165

Query: 147 GAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGAL 205
           GAYS SQGV G R++VA FI ERDG EPA   DIFLTAGAS+AV+ +LS+ C G + G L
Sbjct: 166 GAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVL 225

Query: 206 IPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINP 265
           IPIPQYPLYTATLALN++HALPY+LDE +GWS++  ++E V+K A++  ++P  LVVINP
Sbjct: 226 IPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINP 285

Query: 266 GNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGK 325
           GNPTGA+LS EAI  IL +AAKY +VVIADEVYQEN FD   F S+K VLR LQ+  PGK
Sbjct: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGK 345

Query: 326 YDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDL 385
           +DNVQLASLHSTSKGVSGECGQRGGYME++GF+ EV+QV LKLASISLCPVVTGQALVDL
Sbjct: 346 FDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDL 405

Query: 386 MVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDL 445
           MV PPK+G+ S+ LD+ +R  IH+ L Q++ LL++TF SL+G+ CQKP GAMYLFPKL+L
Sbjct: 406 MVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNL 465

Query: 446 SRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDS 505
             +AI++A+ L ++PDE+YCKELLE TGICTVPGSGF QV GTYHLRTTFLAPG EW+DS
Sbjct: 466 PYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDS 525

Query: 506 WKKFHQKFVDEH 517
           WK+FH +F++++
Sbjct: 526 WKQFHIEFMEKY 537

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/501 (64%), Positives = 400/501 (79%), Gaps = 5/501 (0%)

Query: 19  RRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSL 78
           RRLS+   VK D S+       TL DVN+ V+ AKYAVRG IP RAEEL  +L E PGSL
Sbjct: 26  RRLSS---VK-DGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSL 81

Query: 79  PFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKM 138
           PF+KII ANIGNPQQL QKPLTFYRQV+SL+QNP L+E +P   L + FK D V RA++M
Sbjct: 82  PFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLE-MPAEWLQQAFKADVVVRARRM 140

Query: 139 LKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCT 198
           L+  GGSVGAYSASQGV G+R++VA+FIE RDG PA+ ++++LTAGASSAVS +LS FC 
Sbjct: 141 LQDAGGSVGAYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCK 200

Query: 199 GSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPT 258
           G E G LIPIPQYPLYTAT+  N+A ALPYYL+EA GWS + +++E+V+ D+ ++ + P 
Sbjct: 201 GPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPK 260

Query: 259 CLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVL 318
           CLVVINPGNPTG++LS + +E ILT+AAKY +VVIADEVYQ+N F DA F SM+KVL+ L
Sbjct: 261 CLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNL 320

Query: 319 QKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVT 378
           Q  EP  Y NVQLASLHS SKG+SGECGQRGGYMEL+GF EE+++VF+KLASISLCPVVT
Sbjct: 321 QLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVT 380

Query: 379 GQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMY 438
           GQALVDLMV PP +GD SYE   QE  +I++ L ++S LL++TF SLEG+ C  PQGA+Y
Sbjct: 381 GQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALY 440

Query: 439 LFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAP 498
           LFPKL L +KAI  A+ LG+  DE YC ELL+ TGICTVPG+GF Q+PGTYH+RTTFL P
Sbjct: 441 LFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPP 500

Query: 499 GTEWVDSWKKFHQKFVDEHRD 519
           GT+W++SWK FH+KF D++RD
Sbjct: 501 GTKWIESWKDFHKKFYDKYRD 521

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/509 (60%), Positives = 392/509 (77%), Gaps = 5/509 (0%)

Query: 11  MPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHK 70
           +PH+ + LR +S+  +      +   G    L D+N  VL AKYAVRG IP RA EL  +
Sbjct: 31  LPHATMGLRSISSGTS----RIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQ 86

Query: 71  LVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELHKLFKPD 130
           L  +P SLPF KII ANIGNPQQL QKPL+F R+VLSLL++P L++ +P   L+ ++KPD
Sbjct: 87  LSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQ-MPMEVLNLIYKPD 145

Query: 131 AVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVS 190
           AV RAK+M++ +  S+GAYS SQGV GFR++VAE++  RDGEPASA DIFLT GAS+  S
Sbjct: 146 AVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGAS 205

Query: 191 AILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDA 250
            ++ + C G E+G LIPIPQYPLYTAT+ LN+  ALPYYLDE SGWS++ + +E+++ ++
Sbjct: 206 LMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIES 265

Query: 251 IRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVS 310
           I KGV+P CLVVINPGNPTGAIL  E++E+I  +AAKYS+VVIADEVYQEN F+   F S
Sbjct: 266 IEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYS 325

Query: 311 MKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLAS 370
           MKKVLR LQ+     + NVQL SLHSTSKG+SGECGQRGGYMELVGFS+++++V LK+AS
Sbjct: 326 MKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMAS 385

Query: 371 ISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSC 430
           I LC  V GQALVDLM+  PK GD SYE D  ER++I N+L ++S  L+ETF +LEGV C
Sbjct: 386 IQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVEC 445

Query: 431 QKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYH 490
           +KPQG+MYLFP+L L +KAI+ AESL M PDE+YC ELL +TGICTVPGSGF Q P T H
Sbjct: 446 RKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCH 505

Query: 491 LRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519
           LRTTFL PGTEW++SW+ FH+ F D++RD
Sbjct: 506 LRTTFLCPGTEWIESWELFHKSFYDKYRD 534

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/515 (60%), Positives = 388/515 (75%), Gaps = 14/515 (2%)

Query: 10  TMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRH 69
           TM H + +     AK     DL  K   +K T +D+N  V  A+YAVRG IP RA+EL+ 
Sbjct: 2   TMTHQQDLKSVFIAK-----DLDFKP-AAKITKKDLNGSVTKAEYAVRGSIPTRADELKE 55

Query: 70  KLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALI----ESLPTGELHK 125
           +L + PG LPF+ IINANIGNPQQLDQKPLTF RQVLS+L+ P ++    E L +     
Sbjct: 56  ELKKNPGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLAS---LN 112

Query: 126 LFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAG 184
           LF  DA++RA+ +LK +GGSVGAYS SQGV G RQ+VA+FI  RDG EPA+  DI+LT G
Sbjct: 113 LFSKDALKRAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTG 172

Query: 185 ASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVE 244
           ASSA +++LS+ C  +  G LIPIPQYPLYTA+ +L +A  LPYYLDE   WS +++++E
Sbjct: 173 ASSAATSLLSLLCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIE 232

Query: 245 QVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFD 304
           +VV+DA+ KG+RP+ L+VINPGNPTGA+L+ E I +I  +AAKY + VI+DEVYQEN F+
Sbjct: 233 KVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFN 292

Query: 305 DADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQV 364
           D  F SMKKVLR LQ   PGK+DNVQLASLHS SKG  GECGQRGGYME+VGFS++++  
Sbjct: 293 DFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDA 352

Query: 365 FLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQS 424
             KL SIS+C VVTGQA+VDLMV PP+ GD SYE DRQER+ I N +  ++ LLYETF  
Sbjct: 353 LFKLMSISICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNG 412

Query: 425 LEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQ 484
           LEG+ CQ PQGAMYLFP+L L  KA R++E LG+ PDE+YC  LLE+TGICTVPGSGF Q
Sbjct: 413 LEGIECQNPQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQ 472

Query: 485 VPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519
            PGTYH+RTTFLAPGT+W+ +WK FHQ F +E+RD
Sbjct: 473 KPGTYHVRTTFLAPGTQWIQNWKNFHQSFFNEYRD 507

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/482 (61%), Positives = 388/482 (80%), Gaps = 1/482 (0%)

Query: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98
           K +L+D+N+ V++AK+A+RG I ++AE+L+ +L + P  LPF++I  ANIGNPQ+L+QKP
Sbjct: 16  KLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQELNQKP 75

Query: 99  LTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGF 158
           LTF RQV+S+LQ P L+ +       K+F  D+ +RA+++L+ +GGSVGAYSASQGV G 
Sbjct: 76  LTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQGVYGI 135

Query: 159 RQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217
           R++ AE+I +RDG EP+   DIFLT GA+SA S +LS+ C G + G LIPIPQYPLYTAT
Sbjct: 136 RKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTAT 195

Query: 218 LALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEA 277
           LALN +  +PYYLDE S WS +T ++E++V D+I+KG++P+ +VVINPGNPTGA+LS  A
Sbjct: 196 LALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELA 255

Query: 278 IEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHST 337
           I KI  +AAKY +VV+ADEVYQEN FD   F S KKVLR LQK  PGK+DN+QLAS+HST
Sbjct: 256 IAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHST 315

Query: 338 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASY 397
           SKGV GECGQRGGYMELVGF++EV+Q+ LKLA +++C VVTGQA+VDLM+ PPKKGDASY
Sbjct: 316 SKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKGDASY 375

Query: 398 ELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLG 457
           ELD++ER  I +++++++  LY  F  L+G+ CQKPQGAMYL+P L LS+KAI KAESL 
Sbjct: 376 ELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKAESLN 435

Query: 458 MAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEH 517
           + PDE+YC ELL+ATGICTVPGSGF Q  GTYHLRTTFLAPG EW++ W+KFH+ F +++
Sbjct: 436 LTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHFYEKY 495

Query: 518 RD 519
           +D
Sbjct: 496 QD 497

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/478 (63%), Positives = 377/478 (78%), Gaps = 2/478 (0%)

Query: 44  DVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYR 103
           D+N+ +++A+YAVRG IP++AEEL  +L ++P  LPFN I  ANIGNPQQLDQKPLTF R
Sbjct: 44  DLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQKPLTFSR 103

Query: 104 QVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVA 163
           QV+S+LQ P L++          +K DA +RA  +L+Q+GGSVGAYS +QGV G R+SVA
Sbjct: 104 QVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYGIRESVA 163

Query: 164 EFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALND 222
           +FI  RD GE AS +DIFLT GAS A + +LS+ C  S  G +IPIPQYPLYTA++ + +
Sbjct: 164 DFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYN 223

Query: 223 AHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKIL 282
           +  LPYYLDE SGWS   E++EQ V D+I++GV P  +VVINPGNPTGA+LS + I +IL
Sbjct: 224 SVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQIL 283

Query: 283 TVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEP-GKYDNVQLASLHSTSKGV 341
           T+AAKY +VV+ADEVYQ N +    F SMKKVLR LQ+  P G+YDNVQLAS+HSTSKGV
Sbjct: 284 TIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGV 343

Query: 342 SGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDR 401
           SGECGQRGGYMELVGFS EV+QV LKLASIS+C VVTGQALVDLM+ PP++GD SYELD 
Sbjct: 344 SGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSYELDV 403

Query: 402 QERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPD 461
           +ER  IHN++  +  LLY+TFQ LEG+ CQ+PQGAMYLFPKL LS+KAI +A+SLG+ PD
Sbjct: 404 RERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSLGLQPD 463

Query: 462 EYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519
           E+YC  LL+ TGICTVPGSGF Q  GTYH+RTTFLAPGT+W+  W+ FH+ F D++RD
Sbjct: 464 EFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFYDKYRD 521

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/505 (59%), Positives = 387/505 (76%), Gaps = 6/505 (1%)

Query: 21  LSAKAAVKSDLSQKAL----GSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPG 76
           ++ +  +KS  + K L     +K T +D+N  V  A+YAVRG IP RA+EL+ +L  +PG
Sbjct: 3   MTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPG 62

Query: 77  SLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELH-KLFKPDAVERA 135
            LPF+ IINANIGNPQQLDQKPLTF RQVLS+L+ P ++   P       LF+ DA+ RA
Sbjct: 63  VLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRA 122

Query: 136 KKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILS 194
           + +L+ +GGS+GAYS SQGV G RQSVAEFI +RD GEPA+  +I+LT GASSA +++LS
Sbjct: 123 EHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLS 182

Query: 195 MFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKG 254
           + C   + G LIPIPQYPLYTA+ +L +A  LPYYLDE S WS  ++++E+VVKDA+ KG
Sbjct: 183 LLCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKG 242

Query: 255 VRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKV 314
           ++P+ L+VINPGNPTGA+LS + I KI  +AAKY + +I+DEVYQEN F+   F SMKKV
Sbjct: 243 IKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKV 302

Query: 315 LRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLC 374
           LR LQ+  PGK+DNVQLASLHS SKG  GECGQRGGYME+VGFS++++    KL SIS+C
Sbjct: 303 LRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISIC 362

Query: 375 PVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQ 434
            VVTGQA+VDLMV+PP+ GD SY+ D  ER  I + ++ ++TLL+ETF  LEG+ CQKPQ
Sbjct: 363 SVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQ 422

Query: 435 GAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTT 494
           GAMYLFP+L L  KA+R++E LG+ PDE+YC  LLE+TGICTVPGSGF Q PGTYH+RTT
Sbjct: 423 GAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTT 482

Query: 495 FLAPGTEWVDSWKKFHQKFVDEHRD 519
           FLAPGT+W+  WK FHQ F +++RD
Sbjct: 483 FLAPGTQWIQDWKHFHQDFFNKYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/513 (59%), Positives = 389/513 (75%), Gaps = 10/513 (1%)

Query: 10  TMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRH 69
           TM H + +    +AK     DL  K  G K T +D+N  V  A+YAVRG IP RA+EL+ 
Sbjct: 2   TMTHQQDLKGVFTAK-----DLDFKPAG-KITKKDLNTGVTKAEYAVRGAIPTRADELKE 55

Query: 70  KLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELH--KLF 127
           +L + P  LPF+ IINANIGNPQQLDQKPLTF RQVL++L+ P ++  +   EL    LF
Sbjct: 56  ELKKNPEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILR-VGHNELASLNLF 114

Query: 128 KPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAGAS 186
             DA+ERA+++L  +GGS+GAYS SQGV G RQ+VA+FI  RDG EPA+  DI+LT GAS
Sbjct: 115 SRDALERAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGAS 174

Query: 187 SAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQV 246
           SA +++LS+ C  S+ G LIPIPQYPLYTA+ +L +A  LPYYLDE S WS +++++E+V
Sbjct: 175 SAATSLLSLLCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKV 234

Query: 247 VKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDA 306
           V+DA++K +RP+ L+VINPGNPTGA+LS E I +I  +AAKY + +I+DEVYQEN F+D 
Sbjct: 235 VQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDV 294

Query: 307 DFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFL 366
            F SMKKVLR LQ   PGK+DNVQLASLHS SKG   ECGQRGGYME++GFS+E++    
Sbjct: 295 KFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALF 354

Query: 367 KLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLE 426
           KL SIS+C VVTGQA+VDLMV+PP+ GD SYE D  ER  I + +  ++ LLYETF+ LE
Sbjct: 355 KLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELE 414

Query: 427 GVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVP 486
           G+ CQKPQGAMYLFP+L L +KA+ ++E LG+ PDE+YC  LLE+TGICTVPGSGF Q P
Sbjct: 415 GIECQKPQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRP 474

Query: 487 GTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519
           GTYH+RTTFLAPGT+W+  WK+FHQ F  ++R+
Sbjct: 475 GTYHVRTTFLAPGTKWIQDWKEFHQDFFSKYRN 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/506 (58%), Positives = 382/506 (75%), Gaps = 8/506 (1%)

Query: 21  LSAKAAVKSDLSQKAL----GSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPG 76
           ++ +  +KS  + K L     +K T +D+N  V  A+YAVRG IP RAEEL+ +L     
Sbjct: 3   MTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSN 62

Query: 77  SLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPAL--IESLPTGELHKLFKPDAVER 134
           SLPFN IINANIGNPQQLDQKPLTF RQVLS+L+ P +  ++      L+ LF  DA++R
Sbjct: 63  SLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLN-LFAKDALKR 121

Query: 135 AKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAIL 193
           A+++L  +GGSVGAYS SQGV G RQ+VA+FI ERDG EPA   DI+LT GASSA +++L
Sbjct: 122 AQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLL 181

Query: 194 SMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRK 253
           S+ C  S+ G L+PIPQYPLYTA+ +L +A  LPYYLDE + WS +++++E+VV DA++K
Sbjct: 182 SLLCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKK 241

Query: 254 GVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKK 313
           G+RP+ LVVINPGNPTGA+L+   I KI  +AAKY + +I+DEVYQEN F D  F SMKK
Sbjct: 242 GIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKK 301

Query: 314 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 373
           +LR LQ   PGK+DNVQLASLHS SKG  GECGQRGGYME+VGFS++++    KL SIS+
Sbjct: 302 ILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISI 361

Query: 374 CPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKP 433
           C V TGQA++DLMV+PP+ GD SY+ DR+ER  I+N +  ++ LLYETF  LEG+ CQKP
Sbjct: 362 CSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKP 421

Query: 434 QGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRT 493
           QGAMYLFPKL L  KA+R++E L + PD  YC  LLE+TGICTVPGSGF Q  GTYH+RT
Sbjct: 422 QGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRT 481

Query: 494 TFLAPGTEWVDSWKKFHQKFVDEHRD 519
           TFL PGT+W+  W++FHQ F +++RD
Sbjct: 482 TFLPPGTQWIQDWRQFHQDFFNKYRD 507

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/476 (62%), Positives = 373/476 (78%), Gaps = 2/476 (0%)

Query: 44  DVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYR 103
           D+N  V+ AKYAVRG IP  A++L+ +L++ PG+LPF  +IN+NIGNPQQL QKPL+F R
Sbjct: 88  DLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQKPLSFGR 147

Query: 104 QVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVA 163
           QVLS+L+ PAL++   T      + PD++ERAK +L  +G S+GAYS SQGV G RQ+VA
Sbjct: 148 QVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVHGIRQTVA 206

Query: 164 EFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALND 222
           +FI  RD GE A  +DIFLTAGASSAVS ILS+ C G + G LIPIPQYPLYTATL LND
Sbjct: 207 DFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLYTATLTLND 266

Query: 223 AHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKIL 282
           A ALPYYLDE++GWS D  ++ +V +D++  G++PTCLVVINPGNPTG++L+ EAI+ + 
Sbjct: 267 ATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVF 326

Query: 283 TVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVS 342
            VAAKY LVVIADEVYQ+N F  ++F SMKK+LR+LQK  P KYDN+QLASLHS SKG+ 
Sbjct: 327 DVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLL 386

Query: 343 GECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQ 402
           GECG RGGY E +GF+ EVKQV  KL+SISLC  V GQALVDLM  PPKKG+ SYELD+ 
Sbjct: 387 GECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEPSYELDQH 446

Query: 403 ERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDE 462
           ER  I  +  ++S  LYE F SLEGV+CQKPQGAMY+FP + L   AI+ A++L + PDE
Sbjct: 447 ERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQNLDITPDE 506

Query: 463 YYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518
           +YC+ELL+ATGICTVPGSGF Q PGTYH+RTTFLAPG EW+  W+KFH +F +++R
Sbjct: 507 FYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFEKYR 562

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/483 (61%), Positives = 378/483 (78%), Gaps = 4/483 (0%)

Query: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVE--EPGSLPFNKIINANIGNPQQLDQ 96
           K ++ D+NQ ++NA+YAVRG I +RAEEL  +L    +P S PF +II ANIGNPQQLDQ
Sbjct: 29  KISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNPQQLDQ 88

Query: 97  KPLTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVA 156
           KPLTF RQV+S+L+ P L++         ++K DA+ERA+ +  Q+G SVGAYS +QGV 
Sbjct: 89  KPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSLAQGVY 148

Query: 157 GFRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYT 215
           G R++ A FI +RD  E ASA+DIFLT GAS AV+ ++   C     G LIPIPQYPLYT
Sbjct: 149 GIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYT 208

Query: 216 ATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSP 275
           A++ +++A  LPYYLDE SGWS   E++E  V +AI  G++P+ +VVINPGNPTGA+LS 
Sbjct: 209 ASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSV 268

Query: 276 EAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLH 335
           + I++I+TVAAKY +V+IADEVYQ+N F+  +F SMKK+LR LQK  PGKYDNVQLASLH
Sbjct: 269 DVIQRIITVAAKYGIVLIADEVYQDNIFN-GEFHSMKKILRQLQKKYPGKYDNVQLASLH 327

Query: 336 STSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDA 395
           STSKGVSGECGQRGGYME+VGFS+EV+ + LKLASI++C VVTGQALVDLMV PP  GD 
Sbjct: 328 STSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPHVGDE 387

Query: 396 SYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAES 455
           SYE D++ERN IH++L +++  LY+TF +LEG+ CQKPQGAMYLFP+L L  +AI +A+ 
Sbjct: 388 SYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIEEAKK 447

Query: 456 LGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVD 515
           L M  DE+YC +LLE TGICTVPGSGF Q  GTYH+RTTFL+PGTEW+D WKKFH+KF+ 
Sbjct: 448 LQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFHEKFMK 507

Query: 516 EHR 518
           E++
Sbjct: 508 EYQ 510

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/482 (61%), Positives = 374/482 (77%), Gaps = 5/482 (1%)

Query: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98
           K ++ D+NQ  ++A YAVRG IP+RAE+L  +++ +PGSLPF+KII ANIGNPQQ+ QKP
Sbjct: 8   KLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVGQKP 67

Query: 99  LTFYRQVLSLLQNPALI---ESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGV 155
           LTF RQVLS+L+ P ++   E L       +++ D +ERA+KML  +GGSVGAYSASQGV
Sbjct: 68  LTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSASQGV 127

Query: 156 AGFRQSVAEFIEERDG--EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPL 213
            GFRQ+VA+FI +RDG  + AS NDIFLT GASSAV  +LS+ C+G E G LIPIPQYPL
Sbjct: 128 LGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPL 187

Query: 214 YTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAIL 273
           YTATL L+++ A+PYYL E + WS +T+++E  +K+++  GV+P  +V+INPGNPTGAIL
Sbjct: 188 YTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAIL 247

Query: 274 SPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLAS 333
           S   +  I+ ++AKY + +IADEVYQEN F   +F SM+KVL  LQ   PG YDNVQLAS
Sbjct: 248 SESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLAS 307

Query: 334 LHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKG 393
           LHSTSKG  GECGQRGGYMEL+GF +EV  + LKLASIS+C VVTGQAL+DL+  PP+ G
Sbjct: 308 LHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPPQPG 367

Query: 394 DASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKA 453
           DASY+LD++ERN I   L  ++  LY  F SLEGV CQ+PQGAMYLFPKL L  KAI KA
Sbjct: 368 DASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAIEKA 427

Query: 454 ESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKF 513
             L + PDEYYC+ELL+ATGICTVPGSGF Q PGTYHLRTTFL PGTEW++ W++FHQ+F
Sbjct: 428 LQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFHQQF 487

Query: 514 VD 515
            +
Sbjct: 488 YE 489

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/483 (62%), Positives = 365/483 (75%), Gaps = 4/483 (0%)

Query: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLV--EEPGSLPFNKIINANIGNPQQLDQ 96
           K TL D+NQ VL ++YAVRG IP RAEEL  +L+  +   SL F  I++ANIGNPQQLDQ
Sbjct: 33  KITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQQLDQ 92

Query: 97  KPLTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVA 156
           KPLTF RQV+S+LQ P L+          +FK DA+ERA+ +L  +GGSVGAYS+SQGV 
Sbjct: 93  KPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSSSQGVY 152

Query: 157 GFRQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYT 215
           G R++VA +I  RD GE AS +DIFLT GAS A S +LS+ C     G LIPIPQYPLYT
Sbjct: 153 GIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIPQYPLYT 212

Query: 216 ATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSP 275
           AT+ L DA  LPYYL+E SGWS +T ++E+VV DAI   V+P+ +VVINPGNPTG++LS 
Sbjct: 213 ATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSK 272

Query: 276 EAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLH 335
           + I  I+ + AKY +V+IADEVYQEN FD  +F SMKKVLR LQK  PGKYD VQLASLH
Sbjct: 273 DDIIHIINIGAKYGIVLIADEVYQENIFD-GEFHSMKKVLRSLQKQYPGKYDAVQLASLH 331

Query: 336 STSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDA 395
           STSKGVSGECGQRGGYMELVGF +E++Q  LKLASISLC V+TGQALVDLMV PPKKGD 
Sbjct: 332 STSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPKKGDE 391

Query: 396 SYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAES 455
           SYELD  ER  IH +L +++  LY  F  L+GV CQKPQGAMYLFPKL   +  I +A +
Sbjct: 392 SYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLITEAIN 451

Query: 456 LGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVD 515
             M+PDE+YC  LLEATGICTVPGSGF Q  GTYHLRTTFLAPG +W + WK FH++F  
Sbjct: 452 QNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFHEEFFS 511

Query: 516 EHR 518
           +++
Sbjct: 512 KYQ 514

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/499 (56%), Positives = 378/499 (75%), Gaps = 4/499 (0%)

Query: 23  AKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNK 82
           A   +++DL       K +++D+N  V+ A++AVRG IP++A+EL+ +L + P SLPFN+
Sbjct: 2   ATHTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNE 61

Query: 83  IINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLP--TGELHKLFKPDAVERAKKMLK 140
           I  ANIGNPQ+L QKPLTF RQV+S+LQ P L+      T     ++  D+ +RA+K+L 
Sbjct: 62  ITVANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLN 121

Query: 141 QVGGSVGAYSASQGVAGFRQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTG 199
           ++GGSVGAYSASQGV G R+++A +I +RD GE AS NDIF+T GA++A S +LS+   G
Sbjct: 122 EIGGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNG 181

Query: 200 SENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVK-DAIRKGVRPT 258
            + G L+PIPQYPLYTA LAL++A  LPYYL+E SGWS+DT ++E+ +K +A+ KG++P 
Sbjct: 182 PQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPK 241

Query: 259 CLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVL 318
            +V+INPGNPTG+ILS +++ KI  +AAKY +V+IADEVYQEN F+   F S KKVLR L
Sbjct: 242 VMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSL 301

Query: 319 QKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVT 378
           QK  P +Y+NVQLASLHSTSKG+ GECGQRGGYME++GF+ +V+ + LKLA I +CPVVT
Sbjct: 302 QKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVT 361

Query: 379 GQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMY 438
           GQA++DLM+ PPK+GD SY+LD  ER  IHN +  ++  LY+ F  +EG+ CQKPQGAMY
Sbjct: 362 GQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMY 421

Query: 439 LFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAP 498
           LFP+L LS K I +A+   M PDE+YC ELL  TGICTVPGSGF Q P TYHLRTTFLAP
Sbjct: 422 LFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAP 481

Query: 499 GTEWVDSWKKFHQKFVDEH 517
           G +W++ W+KFH+ F+  +
Sbjct: 482 GDQWINKWEKFHKAFLKRY 500

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/488 (59%), Positives = 373/488 (76%), Gaps = 8/488 (1%)

Query: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98
           K +L D+N+ +L A+YA+RG IP RAEEL  +L+E   SLPF KI+ ANIGNPQQLDQ+P
Sbjct: 13  KFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQLDQQP 72

Query: 99  LTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGF 158
           LTF RQV+SL+Q P L++S       K++  D++ERA K+L  +GGSVGAYS+SQGV   
Sbjct: 73  LTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQGVLDI 132

Query: 159 RQSVAEFIEERD--GEPA------SANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQ 210
           R++VA FI +RD   +P       +A+++FLTAGAS+AV  IL +F      G L+PIPQ
Sbjct: 133 RKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQ 192

Query: 211 YPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTG 270
           YPLYTA + L  +  LPYYL+E++ WS D +Q+EQ+V DAI++ ++PT LVVINPGNPTG
Sbjct: 193 YPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTG 252

Query: 271 AILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQ 330
           AIL+ ++I  I+ +AA+Y +V+IADEVYQEN ++  +F S KKVL  L+K  P KYDNVQ
Sbjct: 253 AILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQ 312

Query: 331 LASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPP 390
           LASLHS SKGV+GECGQRGGYME+ GFS +VK+V LK+ASIS+C VVTGQ LVDLMV PP
Sbjct: 313 LASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDLMVNPP 372

Query: 391 KKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAI 450
           + GD SYELD+ ER+ IH++L  KS  LY+ F  L G+SCQKPQGAMYLFP+L LS  AI
Sbjct: 373 QPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHLSENAI 432

Query: 451 RKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFH 510
             A  L + PDE+YC +LLE TGICTVPGSGF Q PGTYHLRTTFL PG EW++SW+KFH
Sbjct: 433 NAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINSWEKFH 492

Query: 511 QKFVDEHR 518
            +F+++++
Sbjct: 493 LEFMEKYK 500

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/485 (58%), Positives = 365/485 (75%), Gaps = 4/485 (0%)

Query: 38  SKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQK 97
           +K TL+D+N  ++  +YAVRGPIP RAEEL+ +L ++P SLPFNKIINANIGNPQQL QK
Sbjct: 13  AKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQLGQK 72

Query: 98  PLTFYRQVLSLLQNPALIES---LPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQG 154
           PL+F R+VLS+LQ P ++E    L T    ++++ D V RA+K+L ++GGSVGAYS SQG
Sbjct: 73  PLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYSLSQG 132

Query: 155 VAGFRQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPL 213
           V G +Q+VA++I +RD GE A   DIFLT GASSAVS IL MFC G   G LIPIPQYPL
Sbjct: 133 VPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPL 192

Query: 214 YTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAIL 273
           YTAT+ L  A A+ YYL+E   WS++T ++E  ++++I+ G++PT +V+INPGNPTG+IL
Sbjct: 193 YTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSIL 252

Query: 274 SPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLAS 333
           + + I  I+ ++AKY L++IADEVYQEN F   +F S+KKVLR LQ+   G Y+ VQLAS
Sbjct: 253 TEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLAS 312

Query: 334 LHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKG 393
           LHSTSKG+ GECGQRGGYMEL+G +++V+   +KL SIS+C VVTGQAL+D++V PP+ G
Sbjct: 313 LHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPRPG 372

Query: 394 DASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKA 453
           D SYE+D+ ERN I N L  +S  L++ F SLEGV C +PQGAMYLFPK    +K I  A
Sbjct: 373 DESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKFIDIA 432

Query: 454 ESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKF 513
           + L    D  YCKELLE TGICTVPGSGF Q P TYHLRTTFL PG  W+D W+KFH +F
Sbjct: 433 QKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKFHTEF 492

Query: 514 VDEHR 518
            + +R
Sbjct: 493 CERYR 497

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/490 (56%), Positives = 363/490 (74%), Gaps = 10/490 (2%)

Query: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98
           K +L D++Q +L+ +YA+RG IP RA+EL+ +L   P  LPF KII ANIGNPQQL+Q+P
Sbjct: 11  KFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLEQEP 70

Query: 99  LTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGF 158
           LTF RQVLSL++ P L+ S      +K++ PDA++RA+ +L  +GGSVGAYS+SQG+   
Sbjct: 71  LTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQGILSI 130

Query: 159 RQSVAEFIEERDGEPASAND----------IFLTAGASSAVSAILSMFCTGSENGALIPI 208
           R++VA+ I +RD +    ND          IFLT GA++AVS IL +F      G L+PI
Sbjct: 131 RKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGVLLPI 190

Query: 209 PQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNP 268
           PQYPLYTA + L ++  LPYYL+E   WS D E++E ++KDAI + ++PT LV+INPGNP
Sbjct: 191 PQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIINPGNP 250

Query: 269 TGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDN 328
           TGAILS E+I +I+ +AAKY +V+IADEVYQ N + D  F S KK+L  L+   P KYDN
Sbjct: 251 TGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPKKYDN 310

Query: 329 VQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVR 388
           VQLASLHS SKGV+GECGQRGGY EL+GFS+E+K++ LKLASI +C VVTGQ LVDLM +
Sbjct: 311 VQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVDLMSK 370

Query: 389 PPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRK 448
           PP+KGD SY+LD++ERN I ++L  KS  LY+ F  L G+SCQKPQGAMYLFP+L L+  
Sbjct: 371 PPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLHLTSN 430

Query: 449 AIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKK 508
            I +A+   + PDE+YC +LLE TGICTVPGSGF Q  GTYH+RTTFL  G EW+  W+K
Sbjct: 431 MINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIKLWEK 490

Query: 509 FHQKFVDEHR 518
           FH +F+++++
Sbjct: 491 FHLEFMNQYK 500

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 73/143 (51%), Gaps = 9/143 (6%)

Query: 158 FRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217
           +R   + +  + + +P +A+++ L  G+  ++ AI+   C   +   L+  P Y +Y+  
Sbjct: 69  YRNKTSSYANDPEVKPLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVC 128

Query: 218 LALNDAHALPYYLDEASG-WSMDTEQVEQVVK-DAIRKGVRPTCLVVINPGNPTGAILSP 275
             +ND   +   L  + G + MDTE V  ++K D++ K      + V +PGNPTGA +  
Sbjct: 129 ANINDIEVVQCPLTVSDGSFQMDTEAVLTILKNDSLIK-----LMFVTSPGNPTGAKIKT 183

Query: 276 EAIEKILTVAAKYSLVVIADEVY 298
             IEK+L      + +V+ DE Y
Sbjct: 184 SLIEKVLQNWD--NGLVVVDEAY 204

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 83/174 (47%), Gaps = 22/174 (12%)

Query: 173 PASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAH--ALPYYL 230
           P +  ++ L  G+   + A++   C   ++  LI  P Y +Y+    +ND     +P  +
Sbjct: 84  PLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVV 143

Query: 231 DEASGWSMDTEQV-EQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYS 289
           ++ S + MDTE+V E +  D   K V      + +PGNPTGA++ PE IEK+L  +   S
Sbjct: 144 EDNS-FQMDTEKVIETLQNDPSIKLV-----FITSPGNPTGALIKPENIEKLL--SQWQS 195

Query: 290 LVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSG 343
             V+ DE Y        DF +    +  L      KY N+ +    S S G++G
Sbjct: 196 GFVVVDEAY-------IDFCTTGGSVAPLV----NKYPNLAVLQTLSKSFGLAG 238

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 7/146 (4%)

Query: 154 GVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPL 213
            +A +R   + F  +    P ++ +I L  G+  ++ AI+   C  +    L+  P Y +
Sbjct: 65  AIAEYRNRSSTFTADECTRPLTSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSM 124

Query: 214 YTATLALNDAHALPY-YLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAI 272
           Y+    +ND   +    + E + + MD+++    V D +        L + +PGNPTGA 
Sbjct: 125 YSVCAKINDVEVVTCPLITEDNSFQMDSDK----VLDILNNDQEIKLLFITSPGNPTGAQ 180

Query: 273 LSPEAIEKILTVAAKYSLVVIADEVY 298
           +    IEK+L    +   +V+ DE Y
Sbjct: 181 IETARIEKVLQNWDRG--LVVVDEAY 204

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 89/191 (46%), Gaps = 23/191 (12%)

Query: 155 VAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLY 214
           +A +R   + F ++++  P +A +I L  G+  ++ A++ + C  S++  +I  P Y +Y
Sbjct: 67  MANYRNKHSSF-KDQNLPPLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMY 125

Query: 215 TATLALNDAHALPYYL-DEASGWSMDTEQV-EQVVKDAIRKGVRPTCLVVINPGNPTGAI 272
           +    +ND   +   L  E + + MDT +V E + +D   K      + + +PGNPT A+
Sbjct: 126 SICADINDVGCVKVPLVAEDNSFQMDTSKVLETLAQDPTIK-----LIFITSPGNPTAAL 180

Query: 273 LSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLA 332
           +    IEK+L        +V+ DE Y        DF        V       KY N+ + 
Sbjct: 181 IDTAEIEKVLNNWT--GGLVVVDEAY-------IDFCGGSTTPLV------NKYPNLAVI 225

Query: 333 SLHSTSKGVSG 343
              S S G++G
Sbjct: 226 QTMSKSFGLAG 236

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 96/195 (49%), Gaps = 26/195 (13%)

Query: 155 VAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLY 214
           ++ +R   + F ++++ +P  A+++ L  G+  ++ A++   C  ++   LI    Y +Y
Sbjct: 67  LSDYRNKTSIF-KDQNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMY 125

Query: 215 TATLALNDAH--ALPYYLDEASGWSMDTEQVEQVVKD--AIRKGVRPTCLVVINPGNPTG 270
           T    +ND     +P  L E   + +D E++ + +++  +I+       + + +PGNPTG
Sbjct: 126 TICSQVNDVEYVTVPLLLSEEDKFQIDEEKILETLQNDPSIK------LVFITSPGNPTG 179

Query: 271 AILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFV--SMKKVLRVLQKTEPGKYDN 328
             +    IEKIL+   +  LVV+ DE Y        DFV  S K  L  L      KY+N
Sbjct: 180 TFIDVNRIEKILS-QWQTGLVVV-DEAY-------IDFVEGSDKGSLAPLAT----KYEN 226

Query: 329 VQLASLHSTSKGVSG 343
           + +    S S G++G
Sbjct: 227 IAVLQTLSKSFGLAG 241

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 66/127 (51%), Gaps = 7/127 (5%)

Query: 173 PASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPY-YLD 231
           P SA+++ L  G+  ++ A++   C   ++  LI  P Y +Y+    +ND   +    + 
Sbjct: 84  PLSADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIV 143

Query: 232 EASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLV 291
           E + + M+T++V + ++      +      V +PGNPTGA++   +IEKIL  +   S +
Sbjct: 144 EDNSFQMNTDKVIETLQGDSNIKIA----FVTSPGNPTGALIDIASIEKIL--SQWQSGI 197

Query: 292 VIADEVY 298
           V  DE Y
Sbjct: 198 VAIDEAY 204

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 72/148 (48%), Gaps = 14/148 (9%)

Query: 154 GVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCT-GSENGALIPIPQYP 212
            +A +R   + F   +D  P +A ++ L  G+  ++ AI+   C  G E    +P P Y 
Sbjct: 65  AMANYRNRTSSF---KDITPLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMP-PTYG 120

Query: 213 LYTATLALNDAHAL--PYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTG 270
           +Y+   ++ND   +  P    + S + +DTE     V D ++K      + + +PGNPTG
Sbjct: 121 MYSVCASVNDVEIVKCPLVTSDNS-FQVDTE----AVLDTLKKDPLIKLVFITSPGNPTG 175

Query: 271 AILSPEAIEKILTVAAKYSLVVIADEVY 298
           A +    IEKIL    +  LVV  DE Y
Sbjct: 176 AKIETSRIEKILQNWDQGILVV--DEAY 201

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 86/192 (44%), Gaps = 24/192 (12%)

Query: 155 VAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLY 214
           +A +R + + F  E    P S  +I L  G+   V +++   C    +  L+  P Y +Y
Sbjct: 67  MANYRNNTSAFKSEGLA-PISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMY 125

Query: 215 TATLALNDAHALPY-YLDEASGWSMDTEQVEQVVK--DAIRKGVRPTCLVVINPGNPTGA 271
           +    +ND   +    + E + + MD + V + +   D+I+       L +  PGNPTGA
Sbjct: 126 SVFAMINDTEVVECPLITEDNSFDMDLDNVLETLSNDDSIK------LLFITTPGNPTGA 179

Query: 272 ILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQL 331
            +S + IE +L   +  + +V+ DE Y        DF S      ++      KY N+ +
Sbjct: 180 SISTQKIEMLLNNWS--AGIVVVDEAY-------IDFSSSDSAAPLVN-----KYPNLVV 225

Query: 332 ASLHSTSKGVSG 343
               S S G++G
Sbjct: 226 IQTLSKSFGLAG 237

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 88/189 (46%), Gaps = 25/189 (13%)

Query: 131 AVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV- 189
           A++ A+K L+     V  YS ++G A    S+ +      G+     +I +T GA+  + 
Sbjct: 76  AIKEAQKALEI--PLVNQYSPTRGRASLLNSLIKLYSPFYGKELKQENITITTGANEGIL 133

Query: 190 SAILSMFCTGSENGALIPIPQYPLYTATLAL----------NDAHALPYYLDEASGWSMD 239
           S ++ +   G E   ++  P +  Y + + L          N    L   + E + W++D
Sbjct: 134 SCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEWTID 191

Query: 240 TEQVEQVVKDAIRKGVRP-TCLVVIN-PGNPTGAILSPEAIEKILTVAAKYSLVVIADEV 297
            EQ         R  + P T  V++N P NP G + + E + K+  +  + ++++I+DEV
Sbjct: 192 FEQ--------FRNAITPKTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEV 243

Query: 298 YQENGFDDA 306
           Y+   F+D+
Sbjct: 244 YEFLYFNDS 252

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 71/144 (49%), Gaps = 11/144 (7%)

Query: 158 FRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217
           +R   + +  +   +P  A+++ L  G+  ++ AI+   C   +   L+  P Y +Y+  
Sbjct: 69  YRNKTSSYSNDPTVKPLRADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVC 128

Query: 218 LALNDAHAL--PYYLDEASGWSMDTEQVEQVVK-DAIRKGVRPTCLVVINPGNPTGAILS 274
             +ND   +  P  + + S + MDTE    ++K D + K      + V +PGNPTGA + 
Sbjct: 129 ANINDVEVVQCPLTVSDNS-FQMDTEAALTILKNDPLIK-----LIFVTSPGNPTGAKIK 182

Query: 275 PEAIEKILTVAAKYSLVVIADEVY 298
              IEKIL    +  LVV+ DE Y
Sbjct: 183 TCLIEKILQ-NWENGLVVV-DEAY 204

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 91/199 (45%), Gaps = 24/199 (12%)

Query: 155 VAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLY 214
           +A +R + + F EE    P +A +I L  G+  ++ AI+   C+  E   ++  P Y +Y
Sbjct: 67  LASYRNAASAFREEGLA-PLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMY 125

Query: 215 TATLALNDAHALPY-YLDEASGWSMDTEQV-EQVVKDAIRKGVRPTCLVVINPGNPTGAI 272
                +ND   +    +   + + +D +++ EQ+  D   K ++   + + +PGNPTGA 
Sbjct: 126 KVCADINDVGYVEVPLISSDNSFQIDEDRILEQLNLD---KSIK--VVFITSPGNPTGAC 180

Query: 273 LSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLA 332
           +    +EK+L      + +V+ DE Y        DF + K  L  L    P       L 
Sbjct: 181 IEVGRVEKLLRNWT--AGIVVVDEAY-------IDFSADKPSLSPLVNKHP------NLV 225

Query: 333 SLHSTSKGVSGECGQRGGY 351
            L + SK  SG  G R G+
Sbjct: 226 VLQTLSKA-SGLAGIRLGF 243

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 75/149 (50%), Gaps = 13/149 (8%)

Query: 154 GVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPL 213
            +  +R   + ++ +   +P SA+++ L  G+  ++ AI+   C   +   L+  P Y +
Sbjct: 65  AMTAYRNETSSYLNDPTVKPLSADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSM 124

Query: 214 YTATLALNDAHAL--PYYLDEASGWSMDTEQVEQVV-KDAIRKGVRPTCLVVINPGNPTG 270
           Y+    +ND   +  P  + + S + M+TE V  ++  D + K +  T     +PGNPTG
Sbjct: 125 YSVCANINDVEVVQCPLTVSDNS-FQMNTEAVLTILNNDPLIKIMFAT-----SPGNPTG 178

Query: 271 AILSPEAIEKILTVAAKY-SLVVIADEVY 298
           A +    IE++L    K+ + +V+ DE Y
Sbjct: 179 AKIKTCLIEEVL---QKWDNGIVVVDEAY 204

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 78/168 (46%), Gaps = 19/168 (11%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV-SAILSMFCTGSENGALIP 207
           YS ++G     +++A+      G+  SA++I +  GA+ A+ S ++ +   G E   ++ 
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLSADNITVHTGANEAIFSCLMGLLNKGDE--VIVF 134

Query: 208 IPQYPLYTATLAL----------NDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRP 257
            P +  Y + + L          N    L   +   + W +D + +E+ +        R 
Sbjct: 135 EPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTINS------RT 188

Query: 258 TCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDD 305
            C+++  P NP G + + E + ++  +    ++V+I+DEVY+   F D
Sbjct: 189 KCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYFSD 236

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 71/147 (48%), Gaps = 10/147 (6%)

Query: 154 GVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPL 213
            +A +R   + +  E +  P ++ ++ L  G+  ++ AI+   C   +   L+  P Y +
Sbjct: 67  AMASYRNKTSTYKAE-NLTPLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSM 125

Query: 214 YTATLALNDAHALPY-YLDEASGWSMDTEQVEQVVK-DAIRKGVRPTCLVVINPGNPTGA 271
           Y+    +ND   +    L + + + MDTE V  V++ D + K      L + +PGNPTGA
Sbjct: 126 YSVCAEINDIEIVECPLLYKNNSFQMDTESVLTVLQNDPLIK-----LLFITSPGNPTGA 180

Query: 272 ILSPEAIEKILTVAAKYSLVVIADEVY 298
            +  E IE +L        +V+ DE Y
Sbjct: 181 RIETERIETVLQNWTDG--LVVVDEAY 205

>SAKL0E02948g Chr5 complement(241418..242689) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106W AAT1 Mitochondrial aspartate aminotransferase
           catalyzes the conversion of oxaloacetate to aspartate in
           aspartate and asparagine biosynthesis
          Length = 423

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 101/229 (44%), Gaps = 23/229 (10%)

Query: 131 AVERAKKML---KQVGGSVGAYSASQGVAGFRQSVAEFIEERD----GEPASAND----- 178
           +V RA+++L   KQ+   + +Y    G A ++ +V  F+  RD    GEP  ++D     
Sbjct: 58  SVARAQQILENHKQLNTDL-SYLPITGSAEYQSNVLNFLF-RDSCPQGEPYLSHDKISFV 115

Query: 179 -IFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWS 237
                 GA +  S +L +F + +     IP P +  +T     N    + YY    +G +
Sbjct: 116 QTLSGTGALAVASKLLYLFVSKT---VWIPAPSWANHTNVFQSNGFKDIRYYTYYNNG-T 171

Query: 238 MDTEQVEQVVKDAIRKGVRPTCLVV-INPGNPTGAILSPEAIEKILTVAAKYSLVVIADE 296
           +D +   Q ++ A RK   P C+V+     NPTG   + E   KIL      +++ I D 
Sbjct: 172 LDVDSWLQDLRSATRKYRAPQCIVLHACCHNPTGVDPTIEQWSKILDAIHDLNMIPILDM 231

Query: 297 VYQENGFDDADFVSMKKVLRVLQKTEPGKYDN-VQLASLHSTSKGVSGE 344
            YQ  G +  +      +LR+   +    + N + L    + + G+ GE
Sbjct: 232 AYQ--GLESGNLYRDAYLLRMCLDSSRYHWSNGLYLCQSFAKNMGLYGE 278

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 85/169 (50%), Gaps = 11/169 (6%)

Query: 154 GVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPL 213
            +A +R + + F ++RD    +  ++ L  G+  ++ AI+   C  ++   L+  P Y +
Sbjct: 66  AMAKYRNTTSAF-KDRDLATLTNENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSM 124

Query: 214 YTATLALNDAHALPY-YLDEASGWSMDTEQVEQVVK-DAIRKGVRPTCLVVINPGNPTGA 271
           Y+    +ND   +    + E + + +++++V  ++K D + K V      + +PGNPTG 
Sbjct: 125 YSVCANINDIEVVECPLIYEDNSFQLNSDKVLDILKNDPLIKLV-----FITSPGNPTGV 179

Query: 272 ILSPEAIEKILTVAAKYSLVVIADEVYQE-NGFDDADFVSMKKVLRVLQ 319
            +  + IEK+L      + +V+ DE Y +  G   A  V+  + L VLQ
Sbjct: 180 KIETKRIEKVLQNWD--NGLVVVDEAYIDFCGGSLAPLVTQYQNLIVLQ 226

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 87/188 (46%), Gaps = 23/188 (12%)

Query: 131 AVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV- 189
           A++ A+K L+     V  YS ++G      S+ +       +   A ++ +T GA+  + 
Sbjct: 72  AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIDLYTPIYNKELKAENVVVTTGANEGIL 129

Query: 190 SAILSMFCTGSENGALIPIPQYPLYTATLALNDAHAL------PYYLDEASG----WSMD 239
           S ++ +  +G E   ++  P +  Y   + L     +      P  LD+ +     W++D
Sbjct: 130 SCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTID 187

Query: 240 TEQVEQVVKDAIRKGVRPTCLVVIN-PGNPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
            EQ E+ +    +        V+IN P NP G + + + +  +  +  K+++V+I+DEVY
Sbjct: 188 FEQFEKAITSKTKA-------VIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVY 240

Query: 299 QENGFDDA 306
           +   F D+
Sbjct: 241 EHLYFTDS 248

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 74/170 (43%), Gaps = 17/170 (10%)

Query: 146 VGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGAL 205
           V  YS ++G     +S+ +             ++ +T GA+  + A L M      +  +
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPLYKLTLKPENVLVTTGANEGILACL-MGILNQNDEVI 142

Query: 206 IPIPQYPLYTATLAL----------NDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGV 255
           +  P +  Y   + L          N    L   + + + W++D EQ E V+ +  +   
Sbjct: 143 VFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITNKTK--- 199

Query: 256 RPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDD 305
               +++  P NP G + + E +++I  +  K+++++I+DEVY    F D
Sbjct: 200 ---AIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYFVD 246

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 22/175 (12%)

Query: 157 GFRQSVAEFIEERDGE---------PASANDIFLTAGASSAVSAILSMFCTGSENGALIP 207
            F+ ++A F   R+GE         P +A ++ L  G+  ++ AI+   C  ++   L+ 
Sbjct: 61  AFKTAMANF---RNGENHQYKDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVL 117

Query: 208 IPQYPLYTATLALNDAHAL--PYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINP 265
            P Y +Y+    +ND   +  P    + S  +   E ++    D   K      + + +P
Sbjct: 118 PPTYSMYSVCAHINDVEIVKCPLITSDNSFQANTDEVIKTAQNDPSIK-----LIFITSP 172

Query: 266 GNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQE-NGFDDADFVSMKKVLRVLQ 319
           GNPTGA +    IEKIL    +   +V+ DE Y +  G   A  V+    L VLQ
Sbjct: 173 GNPTGAKVETSRIEKILQNWDRG--MVVVDEAYIDFCGGSTAPLVTKYPNLCVLQ 225

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 92/364 (25%), Positives = 149/364 (40%), Gaps = 61/364 (16%)

Query: 157 GFRQ---SVAEFIEERDGEPASAN----DIFLTAGASSAVSAILSMFCTGSENGALIPIP 209
           GF Q    +  F++E  G     N    DI LT G ++   + L +FC    N   + + 
Sbjct: 104 GFTQGHPDLLNFLKEHTGLIHKMNYSDWDIILTTGNTNGWESTLRVFC----NKGDVILA 159

Query: 210 QYPLYTATLALNDAHAL---PYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPG 266
           +   ++++LA  +A  +   P  +DE     +  E++E+++ +      +P  L  I  G
Sbjct: 160 EAHSFSSSLASAEAQGITTFPIPIDEHG---IIPEKLEEILDNWTPGAPKPKLLYTIPTG 216

Query: 267 -NPTGAILSPEAIEKILTVAAKYSLVVIADEVYQ--ENGFDDADFVSMKKVLRVLQKTEP 323
            NPTG  L+ E   +I  +A K+  ++I DE Y   + G   AD    KKV  V + T  
Sbjct: 217 QNPTGTSLADERKVEIYRIACKHDFLIIEDEPYYFLQMGEYIADLDERKKVQDVPKPT-- 274

Query: 324 GKYDNVQLASLHSTSKGVSGEC--------------GQRGGYMELVGFSEEVKQVFLKLA 369
             +D   L SL  T   V  E               G R G+  L G S+++ Q ++ L 
Sbjct: 275 --HDQF-LGSLAKTFLSVDTEGRVIRMDSFSKVLAPGSRLGW--LTG-SKKLLQPYISLH 328

Query: 370 SISLCPVVTG--QALVD-LMVRPPKKGDASY------ELDRQERNAIHNSLHQKSTLLYE 420
            +++    +G  Q+LV+ L+ R  + G   +      E   +  NAI          LYE
Sbjct: 329 EMTVQ-AASGFTQSLVNGLLQRWGQDGYIDWLIGLRHEYTLKRDNAI--------DALYE 379

Query: 421 TFQSLEGVSCQKPQGAMYLFPKLDLS-RKAIRKAESLGMAPDEYYCKELLEATGICTVPG 479
                E      P   M+    +D S             A  E Y  + +  +G+  VPG
Sbjct: 380 YAPKHEAFKINPPIAGMFFTINIDASIHPEFETKFQSNPAMVEQYIYDKVVRSGVLVVPG 439

Query: 480 SGFR 483
           + FR
Sbjct: 440 AWFR 443

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 95/220 (43%), Gaps = 21/220 (9%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASA-----NDIFLT-----AGASSAVSAILSMFC 197
           +Y   +G   F+ +V  F+  RD  P  A     N I         GA +  S +LS+F 
Sbjct: 78  SYLPIKGCPDFQINVLSFLY-RDSCPRGATFLDQNRISFVQTLSGTGALAVASKLLSLFM 136

Query: 198 TGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTE-QVEQVVKDAIRKGVR 256
           + S     IP P +P +      N    + YY     G S+D E  ++ + K A ++G  
Sbjct: 137 SRS---VWIPNPSWPNHANVFQNNGFKEINYYSYYKDG-SLDIEGWIQDLEKHAQKEGED 192

Query: 257 PTCLVV-INPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVL 315
           P C+V+     NPTG   S E  ++IL    + +L+ I D  YQ  G D  D      +L
Sbjct: 193 PQCIVLHACCHNPTGIDPSKEQWQRILDKIHELNLIPIIDMAYQ--GLDSGDLYKDAYLL 250

Query: 316 RVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELV 355
            +       ++ N  L    S +K + G  G+R G + +V
Sbjct: 251 NMSLDENRYQWKN-GLFLCQSFAKNM-GLYGERVGSLSVV 288

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 10/152 (6%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIP 207
            Y A QG    R+ +AE     D   +  N + LT GA +A    L+ +    +    I 
Sbjct: 54  TYGAIQGSHALRKLIAEMYSNEDVTLSEEN-VILTNGAIAA--NFLTHYTLAGKGDHFIC 110

Query: 208 I-PQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPG 266
           I P Y   ++   +  A     +L + + +  +  ++E+++K   +      C+V+  P 
Sbjct: 111 ISPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMIKPNTK------CIVLNTPN 164

Query: 267 NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           NP  +++  E + +I  +A K+ +VV  DEVY
Sbjct: 165 NPLSSVIPTETLREIAELADKHGIVVFCDEVY 196

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 81/174 (46%), Gaps = 20/174 (11%)

Query: 136 KKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEE-RDGEPA------SANDIFLTAGASSA 188
           KK  K  GG V    A Q   GF Q   E ++  RD          S  D+  T G ++A
Sbjct: 85  KKNEKVHGGDVPFARALQ--YGFSQGQPELMDYLRDHTNIIHKMQYSDWDVVATTGNTNA 142

Query: 189 VSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHAL---PYYLDEASGWSMDTEQVEQ 245
             + L +FC   + G +I + +   +++ LA   A  +   P  +DE     +  E++EQ
Sbjct: 143 WESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG---IIPEKLEQ 195

Query: 246 VVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           ++ +      +P  L  I  G NPTG+ LS +  EKI  VA K+  ++I DE Y
Sbjct: 196 ILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q01802 Saccharomyces cerevisiae YKL106W AAT1
           Mitochondrial aspartate aminotransferase catalyzes the
           conversion of oxaloacetate to aspartate in aspartate and
           asparagine biosynthesis
          Length = 421

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 102/238 (42%), Gaps = 21/238 (8%)

Query: 131 AVERAKKMLKQV--GGSVGAYSASQGVAGFRQSVAEFIEERD----GEPASANDIFLT-- 182
           +V RA+ +L Q     +  +Y   +G   F+ +V +F+ +       E  S N I     
Sbjct: 59  SVARAQMVLDQSFEMNTDLSYLPIEGCPDFQSNVLQFLYKESCPEGAEFLSKNRISFVQT 118

Query: 183 ---AGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMD 239
               GA +  S +LS+F + +     IP P +P +      N    + YY     G  +D
Sbjct: 119 LSGTGALAVASKLLSLFMSKA---VWIPNPSWPNHANVFQNNGFKRINYYTYYRDG-GLD 174

Query: 240 TEQVEQVVKDAIRKGV-RPTCLVV-INPGNPTGAILSPEAIEKILTVAAKYSLVVIADEV 297
            +   Q ++ A+R G   P C+V+     NPTG   S E    IL    + +L+ I D  
Sbjct: 175 VDSWLQDLEQAVRDGDGSPQCIVLHACCHNPTGVDPSLEQWRTILDKINELNLIPIIDMA 234

Query: 298 YQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELV 355
           YQ  G D  D      +LR+    E  ++ N  L    S +K + G  G+R G + +V
Sbjct: 235 YQ--GLDTGDLHKDAYLLRMSLDEERYQWPN-GLFLCQSFAKNM-GLYGERVGSLSVV 288

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 72/162 (44%), Gaps = 15/162 (9%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEP---ASANDIFLTAGASSAVSAILSMFCTGSENGAL 205
           YS +QG+      +  FI + +  P    +  DI L  G+S ++  +    C  S    +
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLYDIMLANGSSDSMFKVFETLCDESTTVLM 196

Query: 206 IPIPQYPLYTATLALNDAHALPYYLD---EASGWSMDTEQVEQVV-----KDAIRKGVRP 257
                 P+ +  +A   A  +P  L+   E  G  +D E +E ++     K   +   +P
Sbjct: 197 EEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQG--IDIEYLENLLDNWGGKSNTKHLSKP 253

Query: 258 TCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
             L  I+ G NP G  LS E   KI T+A ++ L+++ D+ Y
Sbjct: 254 KILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 84/188 (44%), Gaps = 23/188 (12%)

Query: 131 AVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV- 189
           A++ A+K L      V  YS ++G      S+ +           A ++ +T GA+  + 
Sbjct: 72  AIKEAQKALDI--PMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGIL 129

Query: 190 SAILSMFCTGSENGALIPIPQYPLYTATLALNDAHAL------PYYLDEASG----WSMD 239
           S ++ +   G E   ++  P +  Y   + L     +      P  LD+ +     W++D
Sbjct: 130 SCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTID 187

Query: 240 TEQVEQVVKDAIRKGVRPTCLVVIN-PGNPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
            EQ E+ +    +        V+IN P NP G + + E +  +  +  K+++V+I+DEVY
Sbjct: 188 FEQFEKAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY 240

Query: 299 QENGFDDA 306
           +   F D+
Sbjct: 241 EHLYFTDS 248

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 89/191 (46%), Gaps = 20/191 (10%)

Query: 155 VAGFRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPL 213
           +AGFR      +++  G EP + +++ L  G+   + +++   C    +  L   P Y +
Sbjct: 66  LAGFRNR----LDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSM 121

Query: 214 YTATLALNDAHALPY-YLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAI 272
           Y+    +ND   +    + E + + M+  +V   +K+  +  +    L + +PGNPTG +
Sbjct: 122 YSVCANINDVEIVECPLITEDNSFQMNVPEVLSTLKNDPKIKL----LFITSPGNPTGKL 177

Query: 273 LSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLA 332
           ++ + IE IL      + +V+ DE Y +    +    SM K++         KY N+ + 
Sbjct: 178 VNKKDIEFILENWT--NGLVVVDEAYIDFADAEGTTYSMAKLVT--------KYPNLTVL 227

Query: 333 SLHSTSKGVSG 343
              S S G++G
Sbjct: 228 QTLSKSFGLAG 238

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 75/171 (43%), Gaps = 17/171 (9%)

Query: 146 VGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV-SAILSMFCTGSENGA 204
           V  YS ++G     +S+ +           A ++ +T GA+  + S ++ +   G E   
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAELKAENVTVTTGANEGILSCLMGILNPGDEVIV 143

Query: 205 LIP-----IPQYPLY---TATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVR 256
             P     IP   L       + +N    +   + + + W++D EQ    + D       
Sbjct: 144 FEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITDK------ 197

Query: 257 PTCLVVIN-PGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDA 306
            T  V+IN P NP G + + E + +I  +  K ++V+I+DEVY+   F D+
Sbjct: 198 -TKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYFTDS 247

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 85/188 (45%), Gaps = 23/188 (12%)

Query: 131 AVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV- 189
           A++ A+K L+     V  YS ++G      S+ +           A ++ +T GA+  + 
Sbjct: 88  AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIKLYSPIYDTDLRAENVTVTTGANEGIL 145

Query: 190 SAILSMFCTGSENGALIPIPQYPLYTATLALNDAHAL------PYYLDEASG----WSMD 239
           S ++ +  +G E   ++  P +  Y   + L     +      P  LD+ +     W++D
Sbjct: 146 SCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTKGEEWTID 203

Query: 240 TEQVEQVVKDAIRKGVRPTCLVVIN-PGNPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
            EQ E  +    +        V+IN P NP G + + E +  +  +  K+++V+I+DEVY
Sbjct: 204 FEQFENAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY 256

Query: 299 QENGFDDA 306
           +   F D+
Sbjct: 257 EHLFFTDS 264

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 71/155 (45%), Gaps = 13/155 (8%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASAN----DIFLTAGASSAVSAILSMFCTGSENGA 204
           Y A+QG    +  + EF+ E +      N    D  LT G ++   + L +FC    N  
Sbjct: 103 YGATQG----QPEILEFLREHNKLVHEFNYSDWDSILTTGNTNGWESTLRIFC----NKG 154

Query: 205 LIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVIN 264
            + + +   ++++LA  +A  +  +        +  E++E ++ +      +P  L  I 
Sbjct: 155 DVILAEAHSFSSSLASAEAQGVITFPVPIDSDGIIPEKLESILDNWTPGSPKPKLLYTIP 214

Query: 265 PG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
            G NPTG+ LS E  E I  +A K+  ++I DE Y
Sbjct: 215 TGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 78/174 (44%), Gaps = 23/174 (13%)

Query: 146 VGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV-SAILSMFCTGSENGA 204
           V  YS ++G      S+ +       +  +  ++ +T GA+  + S ++ +   G E   
Sbjct: 85  VNQYSPTRGRPSLINSLIKLYSPIYNKDLTTENVTVTTGANEGILSCLMGLLNAGDE--V 142

Query: 205 LIPIPQYPLYTATLALNDAHAL------PYYLD----EASGWSMDTEQVEQVVKDAIRKG 254
           ++  P +  Y + + L     +      P  LD        W++D EQ E        K 
Sbjct: 143 IVFEPFFDQYISNIELCGGKVVYVPINPPKELDLRNTRGEEWTIDFEQFE--------KA 194

Query: 255 VRP-TCLVVIN-PGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDA 306
           + P T  V+IN P NP G + + E +  +  +  K+++++I+DEVY+   F D+
Sbjct: 195 ITPKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYEHLYFTDS 248

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 71/144 (49%), Gaps = 11/144 (7%)

Query: 158 FRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217
           +R   + +  +   +  +A+++ L  G+  ++ AI+   C   +   L+  P Y +Y+  
Sbjct: 69  YRNKTSSYSNDPAVKSLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVC 128

Query: 218 LALNDAHAL--PYYLDEASGWSMDTEQVEQVVK-DAIRKGVRPTCLVVINPGNPTGAILS 274
             +ND   +  P  + + S + MD E V  +++ D + K V      V +PGNPTGA + 
Sbjct: 129 ANINDIEVVQCPLVVSDNS-FQMDVEAVLTILENDPLIKLV-----FVTSPGNPTGAKIK 182

Query: 275 PEAIEKILTVAAKYSLVVIADEVY 298
              IE++L    +  LVV+ DE Y
Sbjct: 183 TSLIEQVLQ-NWQNGLVVV-DEAY 204

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (46%), Gaps = 10/148 (6%)

Query: 153 QGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYP 212
           + +A +R   + F    D  P +  +  L  G+  ++ AI+   C  S+   L+  P Y 
Sbjct: 64  KAMASYRNKTSVF-RSYDLVPLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYS 122

Query: 213 LYTATLALNDAHALPY-YLDEASGWSMD-TEQVEQVVKDAIRKGVRPTCLVVINPGNPTG 270
           +Y+    +ND   +    + E + + +D TE +  +  D + K V      + +PGNPTG
Sbjct: 123 MYSVCANINDVDVVTCPLITEDNSFQIDATEILNILANDPLIKLV-----FITSPGNPTG 177

Query: 271 AILSPEAIEKILTVAAKYSLVVIADEVY 298
           A +  + IE +L    +   +VI DE Y
Sbjct: 178 AKIEIDRIEYLLKNWDQG--LVIVDEAY 203

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/355 (20%), Positives = 141/355 (39%), Gaps = 51/355 (14%)

Query: 146 VGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV-SAILSMFCTGSENGA 204
           V  YS ++G      ++ +      G      ++ +T GA+  + S ++ +   G E   
Sbjct: 86  VNQYSPTRGRVSLLNALIKQYTPIYGSELKQENVTITTGANEGILSCLMGLLNAGDE--V 143

Query: 205 LIPIPQYPLYTATLAL----------NDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKG 254
           ++  P +  Y + + L          N    L   + E + W++D EQ     K+AI   
Sbjct: 144 IVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTVDMEQF----KNAITSK 199

Query: 255 VRPTCLVVIN-PGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKK 313
            +    V+IN P NP G + + E + +I  +  + ++++I+DEVY+   F D +F  +  
Sbjct: 200 TKA---VIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVYEHLYFTD-EFTRIAT 255

Query: 314 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 373
           +       E G     QL     ++       G R G++  +  + E+ Q ++  A   +
Sbjct: 256 L-----SPEIG-----QLTLTVGSAGKTFAATGWRIGWV--ISLNSELLQ-YVSKAHTRI 302

Query: 374 C---PVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSC 430
           C   P    +A  + +       DA   L+      +     QK  +    F+ L G+  
Sbjct: 303 CFASPSPLQEACANSI------NDA---LESNYFEKMRQEYIQKFKIFTSVFEEL-GLPY 352

Query: 431 QKPQGAMYL---FPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGF 482
            KP+G  ++   F K+ +        E L    D      L+   G+  +P + F
Sbjct: 353 TKPEGTYFVLADFSKVKIPEDYPYPKEILNKGKDFRISHWLINELGVVAIPPTEF 407

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 81/185 (43%), Gaps = 17/185 (9%)

Query: 131 AVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV- 189
           A+  A+K L+     V  YS ++G      S+ +      G+     ++ +T GA+  + 
Sbjct: 79  AIHEAQKALEI--PLVNQYSPTKGRPSVINSLKKLYSPLYGQELKDENVTITTGANEGIL 136

Query: 190 SAILSMFCTGSENGALIP-----IPQYPLY---TATLALNDAHALPYYLDEASGWSMDTE 241
           S+++ +   G E     P     IP   L       + +N    +   + E   W++D E
Sbjct: 137 SSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYE 196

Query: 242 QVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQEN 301
           ++ +      +       L++  P NP G + + E + KI  +  + ++V+I+DEVY+  
Sbjct: 197 ELAKAFTSKTK------ALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYEFL 250

Query: 302 GFDDA 306
            F D+
Sbjct: 251 YFTDS 255

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 75/353 (21%), Positives = 141/353 (39%), Gaps = 47/353 (13%)

Query: 146 VGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV-SAILSMFCTGSENGA 204
           V  YS ++G     +S+ E  +   G+     ++ +T GA+  + S ++ +   G E   
Sbjct: 74  VNQYSPTRGRPSLIKSLVELYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNAGDE--V 131

Query: 205 LIPIPQYPLYTATLAL--NDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVR-PTCLV 261
           ++  P +  Y   + L       +P +  +       T    Q+  DA+ K     T  V
Sbjct: 132 IVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNNKTKAV 191

Query: 262 VIN-PGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQK 320
           +IN P NP G + + + + K+  +  +++ VVI+DEVY+   F +    S  ++  +   
Sbjct: 192 IINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFTE----SFPRIANI--- 244

Query: 321 TEPGKYDNVQLASLHST--SKGVS-GECGQRGGYM-----ELVGFSEEVKQVFLKLASIS 372
                  N  +A+L  T  S G S    G R G++     +L+ +   V +   ++   S
Sbjct: 245 -------NEDIANLTLTVGSAGKSFAATGWRIGWIISKNDQLLNY---VSKAHTRICFAS 294

Query: 373 LCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQK 432
             P+    A           G   + L       +     +K  +L   F  L G++  +
Sbjct: 295 PSPLQEACA-----------GSIEHALKIDYFPKMREEYRKKFEILTTAFDKL-GLNYTQ 342

Query: 433 PQGAMYL---FPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGF 482
           P+G  ++   F K+ +    +   E L  A D      L+   GI  +P + F
Sbjct: 343 PEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 9/124 (7%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLAL--NDAHALPYYLDEASG 235
           D+  TAG ++A  + L +FC     G  I    Y   ++  A      +  P  LDE   
Sbjct: 135 DVLATAGNTNAWESTLRVFCN---RGDTILAEAYSFSSSLYAAEAQGVNVFPVPLDE--- 188

Query: 236 WSMDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIA 294
           + +  E++E ++ +   +  +P  L  I  G NPTG+ LS +   KI  +A K++ ++I 
Sbjct: 189 FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIE 248

Query: 295 DEVY 298
           DE Y
Sbjct: 249 DEPY 252

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 88/187 (47%), Gaps = 21/187 (11%)

Query: 120 TGELHKLFK----PDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPAS 175
           TG+L KL K    P  +  A+ +  Q G S G     + V+  ++ + +F +     P S
Sbjct: 76  TGKLCKLAKDQENPKDIPLARAL--QYGNSRGQ---RELVSFLKEHIVKFHQI----PYS 126

Query: 176 ANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASG 235
             D+ +TAG++ A  A L +FC   ++  L    +   Y++++   +A  +     E  G
Sbjct: 127 DWDVLITAGSTQAWDASLRLFCNPGDSVLL----ESWTYSSSVEAAEAQGMYCVGVEIDG 182

Query: 236 WSMDTEQVEQVVK--DAIRKGVR-PTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLV 291
             +  E++E +++  D +  G   P  L VI  G NP G  L+ E    I  +  KY +V
Sbjct: 183 HGVVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYNIIQKYDMV 242

Query: 292 VIADEVY 298
           +I D+ Y
Sbjct: 243 LIEDDPY 249

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 74/190 (38%), Gaps = 34/190 (17%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASAN------DIFLTAGASSAVSAIL---SMFCTG 199
           Y +  G A  R  +AEF       P S+N       + LT+GAS  +  IL   ++  TG
Sbjct: 48  YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNILLQTTLPHTG 107

Query: 200 SENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVK----------- 248
               A I  P Y L      L+          E  G  +D   +E  +K           
Sbjct: 108 YTKQAFIVTPTYFLVNKAF-LDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGESG 166

Query: 249 -------------DAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIAD 295
                        D  +K  R    +V    NPTGAI S  +  K+L +A KY +++I+D
Sbjct: 167 QKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 226

Query: 296 EVYQENGFDD 305
           +VY     DD
Sbjct: 227 DVYDLLRLDD 236

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 72/325 (22%), Positives = 141/325 (43%), Gaps = 35/325 (10%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDA---HALPYYLDEAS 234
           D+  T G + A  ++L +FC     G  I   Q+  ++++++  +A   +  P  LDE  
Sbjct: 134 DVLATIGNTGAWESVLRIFCN---RGDTILAEQF-AFSSSISAAEAQGVNVFPIPLDEHG 189

Query: 235 GWSMDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVI 293
              +   ++E ++ +      +P  L  +  G NPTG+ LS +  E+I  +A K+  ++I
Sbjct: 190 ---IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIII 246

Query: 294 ADEVY-----QENGFDDAD-----FVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSG 343
            DE Y     ++   D A+     +   K+ ++ L+K+        ++  L S SK ++ 
Sbjct: 247 EDEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA- 305

Query: 344 ECGQRGGYMELVGFSEEVKQVF-LKLASISLCPVVTGQALVDLMVRPPKKGDASYELD-R 401
             G R G+  +VG  + + ++  L+  +I      T   +   M R  ++G   + +  R
Sbjct: 306 -PGTRFGW--IVGAKDILARILSLQEMTIQAPAGFTQSIIAGTMNRWGQEGYLDWLIGLR 362

Query: 402 QERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPD 461
            E     +        LY+    ++ +    P   M+    +D S+     A   G  P 
Sbjct: 363 HEYTKKRDCCIDA---LYKYLPQVDYIKINPPIAGMFFTVNIDASKHP-EFATKYGSDP- 417

Query: 462 EYYCKELLE---ATGICTVPGSGFR 483
           E   K + +   A+G+  VPG+ F+
Sbjct: 418 EKVEKAIFDRSIASGVLVVPGNWFK 442

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/168 (19%), Positives = 77/168 (45%), Gaps = 19/168 (11%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV-SAILSMFCTGSENGALIP 207
           YS ++G     +S+ +F      E  + +++ +T GA+  + ++++ +   G E   ++ 
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPIYNETLNESNVTITTGANEGILASLVGLLNPGDE--VIVF 145

Query: 208 IPQYPLYTATLALNDAHA------LPYYLDE----ASGWSMDTEQVEQVVKDAIRKGVRP 257
            P +  Y + + +            P  L E     + W +D + + + + +      R 
Sbjct: 146 EPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINE------RT 199

Query: 258 TCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDD 305
            C+++  P NP G + + E + ++  +  K ++ +I+DEVY+   F D
Sbjct: 200 KCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYEHLYFGD 247

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 96/237 (40%), Gaps = 29/237 (12%)

Query: 95  DQKPLTFYRQ--VLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSAS 152
           +Q+P+ F++      LL   A++E+     L +    D ++  +  L   G   G+    
Sbjct: 4   NQRPINFFKGHPSFRLLPREAIVEATSQLLLPECRDYDDIDEDRHPLT-YGPDEGSKWVR 62

Query: 153 QGVAGFRQSVAEF-IEERDGEPASANDIFLTAGASSAVSAIL---SMFCTGSENGALIPI 208
             +A F     +   EE   +P   N   LTAGAS  V  IL   ++  TG    A I  
Sbjct: 63  TAIAAFSNDCFQLPSEEMKTKPEHIN---LTAGASYGVMNILEQTTLPHTGYTRQAFIVS 119

Query: 209 PQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVK-------------------D 249
           P Y L   T            +DE     +D + ++Q ++                   +
Sbjct: 120 PTYFLINETFIDAGFGGKLTAIDELGHGKIDFDTLQQKLEYFDSISNDNSSELQLITAPN 179

Query: 250 AIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDA 306
           A +K  R    +V    NP G   S E   K++ +A K+ +++++D+VY    +DD+
Sbjct: 180 ANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDDVYDLLRYDDS 236

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 92/197 (46%), Gaps = 36/197 (18%)

Query: 165 FIEERDGEPASAN-------DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217
           F   R+ +  +AN       ++ L  G+   + A++   C  +    ++  P Y +Y+  
Sbjct: 66  FAHYRNSKDNTANVPDLSHKNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVC 125

Query: 218 LALNDAHAL--PYYLDEASGWSMDTEQVEQVVK--DAIRKGVRPTCLVVINPGNPTGAIL 273
             +ND   +  P  +++ S + MD ++  + +K  D IR       L + +PGNPTG I+
Sbjct: 126 ANINDVDVVNCPLIVEDNS-FQMDVKRTLETLKKDDLIR------LLFITSPGNPTGKII 178

Query: 274 SPEAIEKILTVAAKY-SLVVIADEVYQE--NGFDD----ADFVSMKKVLRVLQKTEPGKY 326
              AI+ I+ V   + + +V+ DE Y +    F++     ++ S+ K++         KY
Sbjct: 179 ---AIKDIIYVLEHWKNGLVVVDEAYVDFSTYFNEETKKTEYFSVAKLV--------TKY 227

Query: 327 DNVQLASLHSTSKGVSG 343
            N+ +    S S G++G
Sbjct: 228 PNLTVLQTLSKSFGLAG 244

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 71/152 (46%), Gaps = 8/152 (5%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIP 207
            Y A +G    R  VA    +++ +    +++ +T GA  A + ++S    G  +  +  
Sbjct: 54  TYGAIKGSDELRSLVASLYSDKEVK-LDKDNVLITNGAIGA-NFLVSYTLAGPGDHVICV 111

Query: 208 IPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGN 267
            P Y   ++   +  A      L+  + +  D  +++ ++K   +      C+V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNPNN 165

Query: 268 PTGAILSPEAIEKILTVAAKYSLVVIADEVYQ 299
           P G+++    +E+I  +A K  + VI DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 68/146 (46%), Gaps = 13/146 (8%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWS 237
           D+F TAG ++A  + L +FC    N   + + +   ++++LA  +A  +  +        
Sbjct: 134 DVFATAGNTNAWESTLRLFC----NRGDVILAEAHSFSSSLASAEAQGVITFPVPIDADG 189

Query: 238 MDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADE 296
           +  E++ +++ +      +P  L  I  G NPTG  ++    E I  +A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 297 VYQENGFDDADFVSMKKVLRVLQKTE 322
            Y         F+ M   ++ L++ E
Sbjct: 250 PYY--------FLQMNPYIKDLKERE 267

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 102/244 (41%), Gaps = 47/244 (19%)

Query: 232 EASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLV 291
           EA+ W +D E +     D  +       +++ NP NP G + + + + ++ T+       
Sbjct: 163 EANDWILDRETLRAAFTDKTK------LMIINNPNNPLGKVFNRDELLEMATLCVNNGAY 216

Query: 292 VIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGY 351
           +IADEVY+   F      +   + R+   +E      + + S    +  +    G R G+
Sbjct: 217 IIADEVYEFLQF------TPNPLSRISNLSEAIAQKTITIGS----AGKIFRVTGWRVGW 266

Query: 352 M-----ELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNA 406
           M     ELV   E+V  V +++     C     Q    L ++  +  +  Y L      +
Sbjct: 267 MISKNRELV---EKVTAVHVRMG---FCSPSISQVASGLGIQ--RALECGYFL------S 312

Query: 407 IHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCK 466
           + N   +K +++Y+    L GVS  KPQGA ++    D S+  I         P++Y   
Sbjct: 313 MPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIIT--DFSKVKI---------PEDYQFP 360

Query: 467 ELLE 470
           E L+
Sbjct: 361 EYLK 364

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 72/151 (47%), Gaps = 8/151 (5%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIP 207
            Y +  G    R  VA+ I   D    +A+++ +T GA  A + ++     G  +  +  
Sbjct: 54  TYGSIWGTPVLRDLVAK-IHSSDEIQLTADNVLITNGAIGA-NFLVHYTAAGPGDHIICV 111

Query: 208 IPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGN 267
            P Y   ++  ++  A     +L+   G++ + ++++  V+   +       +V+ NP N
Sbjct: 112 DPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVRANTKY------IVLNNPNN 165

Query: 268 PTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           P G+++S E + +I+  A +  + ++ DEVY
Sbjct: 166 PLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 69/146 (47%), Gaps = 13/146 (8%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWS 237
           D+  TAG ++A  + L +FC     G +I +  +  ++++LA  +A  +  +        
Sbjct: 134 DVLATAGNTNAWESTLRVFCN---RGDVILVEAHS-FSSSLASAEAQGVITFPVPIDADG 189

Query: 238 MDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADE 296
           +  E++ +V+++      +P  L  I  G NPTG  ++    E I  +A KY  +++ DE
Sbjct: 190 IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 297 VYQENGFDDADFVSMKKVLRVLQKTE 322
            Y         F+ M   ++ L++ E
Sbjct: 250 PYY--------FLQMNPYIKDLKERE 267

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWS 237
           D+  T G ++A  + L +FC    N   + + +   ++++LA  +A  +  +        
Sbjct: 132 DVVATTGNTNAWESTLRVFC----NRGDVILAEAHSFSSSLASAEAQGIITFPVPIDAHG 187

Query: 238 MDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADE 296
           +  E++E ++ +      +P  L  I  G NPTG+ L+ E  ++I  +A K+  ++I DE
Sbjct: 188 IIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDE 247

Query: 297 VY 298
            Y
Sbjct: 248 PY 249

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 69/146 (47%), Gaps = 10/146 (6%)

Query: 155 VAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLY 214
           +A +R + + F ++    P + +++ L  G+  ++ A++   C   +   L   P Y +Y
Sbjct: 66  MATYRNNSSSF-KDLSLPPLTEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMY 124

Query: 215 TATLALNDAHALPY-YLDEASGWSMDTEQVEQVV-KDAIRKGVRPTCLVVINPGNPTGAI 272
           +    +ND   L    + E + +  D+++V  ++  D + K V      + +PGNPTGA 
Sbjct: 125 SVCANINDVEVLECPLIYEDNSFQPDSQKVISILSSDPLIKLV-----FLTSPGNPTGAK 179

Query: 273 LSPEAIEKILTVAAKYSLVVIADEVY 298
           +    I KIL   +     V+ DE Y
Sbjct: 180 IDSNIIIKIL--ESWDGGFVVVDEAY 203

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 90/221 (40%), Gaps = 30/221 (13%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASAN----DIFLTAGASSAVSAILSMFCTGSENGA 204
           Y  SQG    +  + EFI E +           D+  TAG ++A  + L +FC    N  
Sbjct: 104 YGFSQG----QPELLEFIREHNKLIHDMQYEDWDVVATAGNTNAWESTLRVFC----NRG 155

Query: 205 LIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVIN 264
            + + +   +++ LA   A  +  +        +   ++E ++ +      +P  L  I 
Sbjct: 156 DVILAEAHSFSSCLAAAQAQGITTFPVPIDDKGIIPAKLEAILDNWTPGAPKPKLLYTIP 215

Query: 265 PG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQK--- 320
            G NPTG  L+ E   +I  +A K+  ++I D  Y         F+ M K  R LQK   
Sbjct: 216 TGQNPTGTSLADERKPEIFRIAQKHDFLIIEDAPYY--------FLQMDKYERDLQKRAV 267

Query: 321 --TEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSE 359
              +P +     LASL  T   V  +    G  + L  FS+
Sbjct: 268 TRAQPRESHKDFLASLDKTFLSVDTD----GRVIRLDSFSK 304

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 69/151 (45%), Gaps = 12/151 (7%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLAL--NDAHALPYYLDEASG 235
           D+  T G +SA  + L +FC     G  I   +Y   ++ +A       A P  LDE   
Sbjct: 132 DVLATVGNTSAWESTLRVFCN---RGDTILAEEYTFSSSLVAAEAQGVRAYPVPLDENG- 187

Query: 236 WSMDTEQVEQVVKDAIR--KGV-RPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLV 291
             M  E++ +++ +  R   GV RP  L  +  G NPTG  LS +  + +  +A ++ L+
Sbjct: 188 --MVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLL 245

Query: 292 VIADEVYQENGFDDADFVSMKKVLRVLQKTE 322
           ++ DE Y     D  +  + ++  RV    E
Sbjct: 246 IVEDEPYYFLQLDPYEADAGRRAPRVFASHE 276

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 61/124 (49%), Gaps = 7/124 (5%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWS 237
           D+  TAG++ A  A L +FC     G  + + +Y  Y+++L    A  L     +     
Sbjct: 128 DLITTAGSTQAWDACLRLFCN---RGETVLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183

Query: 238 MDTEQVEQVVKD--AIRKGVRPTCLVVI-NPGNPTGAILSPEAIEKILTVAAKYSLVVIA 294
           +  +++ ++++D     +G  P  L  I N  NPTG  L  E   +++ +A++Y  ++I 
Sbjct: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 295 DEVY 298
           D+ Y
Sbjct: 244 DDPY 247

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 77/191 (40%), Gaps = 13/191 (6%)

Query: 115 IESLPTGE----LHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERD 170
           I   P+G+     H   K D V +A             Y  S G   F   V E  +   
Sbjct: 68  IGETPSGDASDTCHIAIKKDGVSKAGSSTDIPLSRALQYGFSMGQPEFLSFVREHTQLVH 127

Query: 171 GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLAL--NDAHALPY 228
               S  ++  T G + +  + L +FC     G  I   QY   ++  A      +  P 
Sbjct: 128 KMKYSDWNVLATTGNTGSWESTLRIFCN---RGDTILAEQYTFSSSVYAAEAQGINVFPV 184

Query: 229 YLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAK 287
            LD A G  +  E++E ++ +      +P  L  I  G NPTG+ LS +   +I  +A K
Sbjct: 185 PLD-ADG--LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKK 241

Query: 288 YSLVVIADEVY 298
           + L++I DE Y
Sbjct: 242 HDLLIIEDEPY 252

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 77/178 (43%), Gaps = 9/178 (5%)

Query: 131 AVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVS 190
            VE A+K L      V  YS ++G      S+ +           AN+I +T GA+  + 
Sbjct: 71  VVEEAQKALDD--AMVNQYSPTKGRMSLINSLIKQYSPLYNTQLQANNIQVTTGANEGIL 128

Query: 191 AIL-SMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMD-TEQVEQVVK 248
           A L  +   G E   ++  P +  Y + + +         L      S+  TE  E  V 
Sbjct: 129 ACLVGLLNPGDE--VIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEGTEWTVD 186

Query: 249 -DAIRKGVRPT--CLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGF 303
            D +R  + P    L++  P NP G + + E + +I  +  + ++V+I+DEVY+   F
Sbjct: 187 YDELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVYEHLYF 244

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 74/171 (43%), Gaps = 19/171 (11%)

Query: 146 VGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAV-SAILSMFCTGSENGA 204
           V  YS ++G      S+ +       +  +  ++ +T GA+  + S ++ +   G E   
Sbjct: 85  VNQYSPTRGRPRLINSLIDLYSPFYKKQLTPENVLVTTGANEGILSCLMGIINPGDEVIV 144

Query: 205 LIP-----IPQYPL---YTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVR 256
             P     IP   L       + +N    L   + + + W++D         D   + + 
Sbjct: 145 FEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVDF--------DEFTRAIT 196

Query: 257 P-TCLVVIN-PGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDD 305
           P T  V+IN P NP G + + E + K+  +  + ++++IADEVY+   F D
Sbjct: 197 PKTKAVIINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVYEHLYFVD 247

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWS 237
           DI  TAG ++A  + L +FC    N   + + +   +++ LA   A  +  +        
Sbjct: 133 DIIATAGNTNAWESTLRVFC----NRGDVILAEAHSFSSCLAAAQAQGITTFPIPIDDNG 188

Query: 238 MDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADE 296
           +  E++E+++ +      +P  L  I  G NPTG  L    +E+I  +A K+  +++ D 
Sbjct: 189 IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDA 248

Query: 297 VY 298
            Y
Sbjct: 249 PY 250

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 79/192 (41%), Gaps = 38/192 (19%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASA------NDIFLTAGASSAVSAIL---SMFCTG 199
           Y +  G A  R  +AEF  +    P  +      + + LT+GAS  +  IL   ++  TG
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNILVQTTLPHTG 108

Query: 200 SENGALIPIPQYPL-------------YTATLALNDAHALPY-------YLDEASGWSMD 239
               A I  P Y L              TA     D   L +       + + A+G   +
Sbjct: 109 YTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANG---E 165

Query: 240 TEQVEQVVKDAI------RKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVI 293
            EQ  +   D I      +K  R    +V    NPTGAI S  +  K+L +A KY +++I
Sbjct: 166 REQKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILII 225

Query: 294 ADEVYQENGFDD 305
           +D+VY     DD
Sbjct: 226 SDDVYDLLRLDD 237

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 60/133 (45%), Gaps = 14/133 (10%)

Query: 173 PASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHAL---PYY 229
           P    DI  T G++    A L +FC     G  + + +Y  Y++++   DA  L   P  
Sbjct: 127 PYQDWDIITTTGSTQGWDASLRIFCN---KGDTVLLEEY-TYSSSVEAADAQGLNCIPMP 182

Query: 230 LDEASGWSMDTEQVEQVV---KDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVA 285
           LD   G  +  E++E+++    D       P  L  I  G NPTG  LS      I  +A
Sbjct: 183 LD---GEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLA 239

Query: 286 AKYSLVVIADEVY 298
            KY +++I DE Y
Sbjct: 240 QKYDMIIIEDEPY 252

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 77/324 (23%), Positives = 137/324 (42%), Gaps = 33/324 (10%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLAL--NDAHALPYYLDEASG 235
           D+  T G + +  + L +FC     G  I   +Y   ++  A      +  P  LD A G
Sbjct: 135 DVLATIGNTGSWESTLRIFCN---RGDTILAEKYTFSSSVYAAEAQGVNVFPVPLD-ADG 190

Query: 236 WSMDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIA 294
             +  E++E ++ +   +  +P  L  I  G NPTG+ LS +  ++I  +A K+  ++I 
Sbjct: 191 --LIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIE 248

Query: 295 DEVY---QENGFDD-------ADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGE 344
           DE Y   Q + ++         +F S  + +  L K+        ++  + S SK +   
Sbjct: 249 DEPYYFLQMDAYEKDPSKRKAIEFASHDEFVNSLAKSFISLDTEGRVIRMDSFSKVLG-- 306

Query: 345 CGQRGGYMELVGFSEEVKQVFLKLASISL-CPVVTGQALVD-LMVRPPKKGDASYELD-R 401
            G R G+  LVG S+ + + + +L  +++  P    QA+V   + R  + G   + +  R
Sbjct: 307 PGTRLGW--LVG-SKRILRAYTQLHEMTIQNPSGFSQAIVSGTLNRWGQHGFLDWLIGLR 363

Query: 402 QERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPD 461
           QE N   +        LY+   S   ++   P   M+    +D S      A      P+
Sbjct: 364 QEYNEKRDVAIDA---LYKYVPSTPALTVTPPIAGMFFTVNIDASAHP-EFATKYQSKPE 419

Query: 462 --EYYCKELLEATGICTVPGSGFR 483
             E    E + A G+  VPG  F+
Sbjct: 420 LVEQAIYEKVIACGVLVVPGIWFK 443

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 77/191 (40%), Gaps = 36/191 (18%)

Query: 148 AYSASQGVAGFRQSVAEF------IEERDGEPASANDIFLTAGASSAVSAIL---SMFCT 198
            Y   +G A  R+++AE       +E+++     A  + LTAGAS  +  IL   ++  T
Sbjct: 47  GYGTDKGAAWVRETIAELTNQVFGLEKQERMATDAEFLNLTAGASYGILNILLQTTLPHT 106

Query: 199 GSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVK---------- 248
                A I  P Y L      L+   +      E +   +D   +E+ +K          
Sbjct: 107 NYTRQAFIITPTYYLINKVF-LDAGFSGKLTAVEETRHGIDLGFLEEKIKYFESSSHSTE 165

Query: 249 ----------------DAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVV 292
                           D  +K  R    +V    NP+GA  S E   K+L +A +Y +++
Sbjct: 166 KSTSSSSQSLSIINAADDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILI 225

Query: 293 IADEVYQENGF 303
           I+D+VY   GF
Sbjct: 226 ISDDVYDLLGF 236

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 90/408 (22%), Positives = 155/408 (37%), Gaps = 77/408 (18%)

Query: 148 AYSASQGVAGFRQSVAEFIEE------RDGEPASANDIF-LTAGASSAVSAIL---SMFC 197
            Y +++G    R ++ EF+ E      RD +  S  +   LT+GAS  V  IL   ++  
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGVLNILLQATLPH 109

Query: 198 TGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVE------------- 244
           TG    A I  P Y L                +DE    S+D E +E             
Sbjct: 110 TGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDPNP 169

Query: 245 --------QVVKDAI-----RKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLV 291
                    ++K+ I     +K  +    V+    NP+G   + E   K++ +A KY ++
Sbjct: 170 VNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDML 229

Query: 292 VIADEVYQENGF---DDADFVSM----KKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGE 344
           +I D+VY    +   +D D   +    K+ + + ++T   +       S  S SK ++  
Sbjct: 230 IITDDVYDLLNYSINNDPDKFELPTPIKRFVHIDRETNNDESSYGNTVSNASFSKIIA-- 287

Query: 345 CGQRGGYMELVGFSEEVKQVFLKLASIS------LCPVVTGQALVDLMVRPPKKGDASYE 398
            G R GY E +       Q+    A++S      L  ++ G  L +        GDA   
Sbjct: 288 PGLRFGYHESIN-KLLATQLSAGGANVSGGTPSQLTSMIVGTLLTN--------GDAEKI 338

Query: 399 LDRQERNAIHNSLHQKSTLLYETFQSL-EGVSCQKPQGAMYLFPKLDLSRKAIRKAESLG 457
           L    RN I     +   +     + L +G   +K +G  + + KL  S  A+   +   
Sbjct: 339 L----RNLIQTYCERADAMYNAMIKYLPKGTEIRKTEGGYFNWMKLTESYNALEVGK--- 391

Query: 458 MAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDS 505
           +A D Y          I    GS F  +    +L  ++    T +++S
Sbjct: 392 LAQDMY---------NIVLADGSNFEVIGDKRNLAQSYFRLSTSFLES 430

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 71/149 (47%), Gaps = 19/149 (12%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAH---ALPYYLDEAS 234
           D+  TAG ++A  + L +FC    N   + + +   ++++LA  +A    A P  +D A 
Sbjct: 134 DVVATAGNTNAWESTLRVFC----NRGDVILAEAHSFSSSLAAAEAQGIIAFPVPID-AD 188

Query: 235 GWSMDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVI 293
           G  +  E++ +++ +      +P  L  I  G NPTG  ++    E I  +A K+  +++
Sbjct: 189 G--IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIV 246

Query: 294 ADEVYQENGFDDADFVSMKKVLRVLQKTE 322
            DE Y         F+ M   ++ L++ E
Sbjct: 247 EDEPYY--------FLQMNAYIKDLKERE 267

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 73/343 (21%), Positives = 135/343 (39%), Gaps = 72/343 (20%)

Query: 133 ERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSA- 191
           E+ KK L+ +  +   YS  +G      ++++       +     +I +T GA+  + A 
Sbjct: 58  EQGKKALENIPAN--QYSPVRGQPILVDALSKLYSPVYKKQLKPENIQVTTGANVGIFAC 115

Query: 192 ILSMFCTGSENGALIPIPQYPLYTATL--------ALNDAHALPYYLDEASGWSMDTEQV 243
           ++S+   G E   L P     +Y   +         L     L     + S W++D +Q 
Sbjct: 116 LMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDLKTRRTKGSEWTLDFDQF 175

Query: 244 EQVVKDAIRKGVRPTCLVVIN-PGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENG 302
              + +  +        V+IN P NPTG + + E +  +  +  + ++ +I+DEVY+   
Sbjct: 176 RSAISEKTKA-------VIINSPHNPTGKVFTREELLTLGNICVEKNVYIISDEVYENLY 228

Query: 303 FDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGF----- 357
           F                       + V+LASL      ++   G  G    + G+     
Sbjct: 229 FTP---------------------ECVKLASLSPEISNITLTIGSAGKIFAVTGWRIGWI 267

Query: 358 -SEEVKQVFLKLAS---ISLC------PVVTGQALVDLMVRPPKKGDASYELDRQERNAI 407
            SE V+   LKLAS   I +C      P +     +D+ +        S   DR  ++ I
Sbjct: 268 ISENVE--LLKLASSAHIKICFSSPSPPQLACAHAIDIALN-------SDYFDRMRKDYI 318

Query: 408 HNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAI 450
                +K  +L   F+ L G+    P+G+ ++   +D S+  I
Sbjct: 319 -----EKVEILTSVFEEL-GMPYTVPEGSYFIV--VDFSKLKI 353

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 66/146 (45%), Gaps = 13/146 (8%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWS 237
           D+  TAG ++   + L +FC    N   + + +   ++++LA  +A  +  +        
Sbjct: 134 DVLATAGNTNGWESTLRVFC----NRGDVILAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 238 MDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADE 296
           +  E++ +++ +      +P  L  I  G NPTG  ++    E I  +A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 297 VYQENGFDDADFVSMKKVLRVLQKTE 322
            Y         F+ M   ++ L++ E
Sbjct: 250 PYY--------FLQMNPYIKDLKERE 267

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWS 237
           ++  + G ++A  + L +FC   + G ++   +Y  +++ LA  +A  +         + 
Sbjct: 131 EVIASVGNTNAWESTLRIFC---DRGDVVLFEEYS-FSSCLAACEAQGVTTIPIPIDAFG 186

Query: 238 MDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADE 296
           +  E++E ++ +      +P  L  I  G NPTG  L  +  E I  +A K+  +++ DE
Sbjct: 187 IVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDE 246

Query: 297 VY 298
            Y
Sbjct: 247 PY 248

>ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL106W (AAT1)
          Length = 443

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 98/241 (40%), Gaps = 33/241 (13%)

Query: 131 AVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAG------ 184
           +V RA+ M++   G   AY    G   +   V++F+     E A     FL +G      
Sbjct: 84  SVARAQLMVEGQRGGRLAYLPIAGCPSYGARVSDFLYS---ECAPQGREFLASGCVSFMQ 140

Query: 185 ------ASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALN---DAHALPYYLDEASG 235
                 A S  S  LS F + +     +P P +  +     LN   +     YY D A  
Sbjct: 141 TLSGTGALSLASLFLSNFISKT---IWVPQPSWANHMNIFKLNGFEEVRRYRYYEDGAVD 197

Query: 236 WSMDTEQVEQVVKDAIRKGVRPTCLVV-INPGNPTGAILSPEAIEKILTVAAKYSLVVIA 294
                 Q+E+   D       P C+++     NPTG   + E   +IL+V     +V I 
Sbjct: 198 VDSWLAQLERAAADR----PYPQCILLHACCHNPTGVDPTREQWSRILSVINGLGMVPIV 253

Query: 295 DEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMEL 354
           D  YQ  G +  D  +   +LR+  +    ++DN  L   HS +K + G  G+R G + +
Sbjct: 254 DMAYQ--GLESGDLRADAYLLRMCLEH---RWDN-GLYVCHSFAKNM-GLYGERVGSLSV 306

Query: 355 V 355
           V
Sbjct: 307 V 307

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/172 (20%), Positives = 73/172 (42%), Gaps = 19/172 (11%)

Query: 146 VGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAIL-SMFCTGSENGA 204
           V  YS ++G      S+ +F          A +  +  GA+ A+ +IL  +   G E   
Sbjct: 76  VNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIFSILIGLLNPGDE--V 133

Query: 205 LIPIPQYPLYTATLALNDAHAL------PYYLD----EASGWSMDTEQVEQVVKDAIRKG 254
           ++  P +  Y   + L+    +      P  LD    +   W +D + ++  +    +  
Sbjct: 134 IVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQIDWDSLQAAMNSKTK-- 191

Query: 255 VRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDA 306
                +++  P NP G + +   + ++  +  K ++V+I+DEVY+   F D+
Sbjct: 192 ----AIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFKDS 239

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 74/183 (40%), Gaps = 33/183 (18%)

Query: 149 YSASQGVAGFRQSVAEFIEE------RDGEPASANDIF-LTAGASSAVSAIL---SMFCT 198
           Y + +G    R+++  F  +      RD +  S  +   L++GAS  V +IL   ++  T
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSILLQATLAHT 110

Query: 199 GSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMD---------------TEQV 243
           G    A I  P Y L           +    +DE    S+D               TE+ 
Sbjct: 111 GYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFTEEE 170

Query: 244 EQVVKDAI--------RKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIAD 295
           +Q    AI        +K  +     +    NPTG   S E   K++ +A KY +++IAD
Sbjct: 171 DQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIAD 230

Query: 296 EVY 298
           +VY
Sbjct: 231 DVY 233

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 73/182 (40%), Gaps = 31/182 (17%)

Query: 148 AYSASQGVAGFRQSVAEFIEE---RDGEPASAND----IFLTAGASSAVSAILSMFCTGS 200
            Y +++G    R ++ +F  E   + GE   A      + LT+GAS  V  IL + CT  
Sbjct: 52  TYGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGVLNIL-LQCTLP 110

Query: 201 ENG----ALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVK--DAIRKG 254
            N     A I  P Y L          H     ++E    S+D + +E  +   D+I+  
Sbjct: 111 HNNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNLAELDSIKAD 170

Query: 255 VRPTCLV-----------------VINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEV 297
           V   C+                  V    NP+G   S     ++L +A KY +++I D+V
Sbjct: 171 VGTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDDV 230

Query: 298 YQ 299
           Y 
Sbjct: 231 YD 232

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%)

Query: 239 DTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           DT  V    K+  +K  R     V    NP+G   S E  +K+L +A KY +++IAD+VY
Sbjct: 178 DTSCVTNPTKNPNKKVYRYVLYCVPTYANPSGMSFSLETKKKLLDLARKYDMLIIADDVY 237

Query: 299 Q 299
            
Sbjct: 238 D 238

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 232 EASGWSMDTEQVEQVVKDAIRKGVRPTCLVVIN-PGNPTGAILSPEAIEKILTVAAKYSL 290
           E + W +D + + Q + +  +        V+IN P NP G + + E + K+  +  +  +
Sbjct: 194 EGTEWVIDYDMLRQTINEKTKA-------VIINSPHNPIGKVFTREELLKLGNICVEKGI 246

Query: 291 VVIADEVYQENGFDD 305
            +I+DEVY+   F D
Sbjct: 247 YIISDEVYEHLYFTD 261

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 75/178 (42%), Gaps = 22/178 (12%)

Query: 149 YSASQGVAGFRQSVAEFIEE--RDGEPASANDIFLTAGASSAVSAIL---SMFCTGSENG 203
           Y + QG    R ++A  I +  R  +   A  + LT GAS  +  IL   ++   G    
Sbjct: 51  YGSEQGSLWVRSAIATLINDCYRPEKATRAEHVNLTGGASYGIMNILMQTTLAHAGYTRR 110

Query: 204 ALIPIPQYPL-------------YTATLALNDAHA-LPYYLDEASGWSMD---TEQVEQV 246
           A +  P Y L              TA     D    L Y  ++ S +  +   TE + + 
Sbjct: 111 AFLVSPTYFLINQIFLDAGFGGRMTAVRETQDGQLDLEYLAEKLSEFDAEHPSTEALTEP 170

Query: 247 VKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFD 304
            +   ++  R    ++    NP+G+  S E   +++ +A +Y +++I+D++Y    +D
Sbjct: 171 RRTPPKRTYRYVMYLIPTYSNPSGSTYSLETRTRLVELARRYDMLLISDDIYDLLAYD 228

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 73/160 (45%), Gaps = 13/160 (8%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPI 208
           YS +QG+A     +   +   +  P    D+ L  G+S +   +  +F T ++    + +
Sbjct: 112 YSQTQGLAPILDFLKLIVANCNNPPYQNWDLLLANGSSDS---MFKLFDTLTDETTTVLV 168

Query: 209 PQYPL--YTATLALNDAHALPYYLDEASGWS---MDTEQVEQVVKD----AIRKGVRPTC 259
            ++      + +    A  +P  L+  S  S   ++   ++ ++++      +   RP+ 
Sbjct: 169 EEFTFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQHLLENWQSGPYKHLNRPSI 228

Query: 260 LVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           L  I+ G NPTG  +S E   +I  +A KY+ +++ D+ Y
Sbjct: 229 LYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 61/130 (46%), Gaps = 8/130 (6%)

Query: 173 PASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDE 232
           P +  DI  T G++ A  A L +FC     G  + + ++  Y++++   DA  L      
Sbjct: 128 PYNDWDIITTTGSTQAWDASLRIFCN---KGDTVLLEEF-TYSSSVEAADAQGLNCIPVP 183

Query: 233 ASGWSMDTEQVEQVVKDAIRK--GV-RPTCLVVINPG-NPTGAILSPEAIEKILTVAAKY 288
                +  E++E+++ +   +  G+  P  L  I  G NPTG  LS      I  +A KY
Sbjct: 184 MDNQGIIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKY 243

Query: 289 SLVVIADEVY 298
            ++++ D+ Y
Sbjct: 244 DILIVEDDPY 253

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/186 (18%), Positives = 82/186 (44%), Gaps = 21/186 (11%)

Query: 129 PDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSA 188
           P A+  A+  L      V  Y+ ++G      S+ +           A+++ +T GA+  
Sbjct: 69  PFAIHEAQAALS--SPMVNQYAPTKGRVSLINSLVKLYSPLYNTQLDASNVQVTTGANEG 126

Query: 189 V-SAILSMFCTGSENGALIPIPQYPLYTATLALNDAHAL------PYYLD----EASGWS 237
           + S ++ +   G E   ++  P +  Y + + +            P  ++    + + W+
Sbjct: 127 ILSCLVGLLNPGDE--VIVFEPFFDQYISNIQIPGGKVTYVPMHPPKEMNVRNTKGTEWT 184

Query: 238 MDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEV 297
           ++ +++E  +    +       L++  P NP G + + E + +I  +  K+++V+I+DEV
Sbjct: 185 VNYDELEAAITPKTK------ALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISDEV 238

Query: 298 YQENGF 303
           Y+   F
Sbjct: 239 YEHLYF 244

>AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL202W (ARO8)
          Length = 512

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 88/201 (43%), Gaps = 23/201 (11%)

Query: 114 LIESLPTGELHKLFKPDA-VERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGE 172
           L+  +P G   + F  D  + RA     Q G S G    S+ V   RQ   +F + R  +
Sbjct: 73  LVGRIPKGAGEREFARDVPLSRAL----QYGNSRGQ---SELVEFLRQHTEKFHKLRYAD 125

Query: 173 PASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDE 232
                D+ +TAG++ A  A + +FC   ++  +        Y++++   +A  L     E
Sbjct: 126 ----WDVLVTAGSTQAWDATMRLFCNEGDSVVMEAF----TYSSSVEAAEAQGLYCVGME 177

Query: 233 ASGWSMDTEQVEQVVK--DAIRKG-VRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKY 288
                +  E++ +++   D    G  RP  L  I  G NP G+ L      +I  +A +Y
Sbjct: 178 VDSEGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQY 237

Query: 289 SLVVIADEVY---QENGFDDA 306
            ++++ D+ Y   Q + +D A
Sbjct: 238 DMLIVEDDPYYFLQMDAYDAA 258

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 71/178 (39%), Gaps = 28/178 (15%)

Query: 149 YSASQGVAGFRQSVAEFIEER-----DG--EPASANDIFLTAGASSAVSAIL---SMFCT 198
           Y + +G    R+ +  F+ ++     DG       + + L +GAS  +  IL   ++   
Sbjct: 50  YGSDEGALWVREQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYGMLNILLQTTLPHN 109

Query: 199 GSENGALIPIPQYPLYTATL----------ALN-------DAHALPYYLDEASGWSMDTE 241
           G    A I  P Y L               A+N       D  +L   LD   G S    
Sbjct: 110 GYTRQAFIITPTYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGESQPDS 169

Query: 242 QVEQVVKDAIRKGVRPTCLVVI-NPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
             E +   A+ K +    L  I    NP+G   S E   +++ +A KY ++VI+D+VY
Sbjct: 170 TTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 69/159 (43%), Gaps = 10/159 (6%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPA---SANDIFLTAGASSAVSAILSMFCTGSENGAL 205
           YS ++G+      +  FI+     P    S  ++ L  G+S ++  +    C  S+   +
Sbjct: 109 YSETRGLNPLLDFIRYFIKWIGNSPPYEDSLWEVMLANGSSDSMFKVFETLCDESDTVLM 168

Query: 206 IPIPQYPLYTATLALNDAHALPYYLD---EASGWSMD--TEQVEQVVKDAIRKGVRPTCL 260
                 P+ +  +A   A  +P  ++   E  G  +D  +  +    +   +   +P  L
Sbjct: 169 EEFTFVPVISNVMA-TGAKCIPIKVNLNYEDQGIDIDYLSNLLNNWKEGPYKHLSKPKIL 227

Query: 261 VVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
             I+ G NP G  LS E  EKI  +A ++ L+++ D+ Y
Sbjct: 228 YTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPY 266

>KAFR0D03160 Chr4 (618891..620198) [1308 bp, 435 aa] {ON} Anc_2.475
           YKL106W
          Length = 435

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 57/272 (20%), Positives = 103/272 (37%), Gaps = 29/272 (10%)

Query: 183 AGASSAVSAILSMFCTGSENGALIPIPQYP------LYTATLALNDAHALPYYLDEASGW 236
            GA +  +  LS F +       I +P Y       ++      N  +   YY D     
Sbjct: 127 TGAIAITARFLSKFISNK-----IWLPNYSWANHINIFEKNGFHNSINYYSYYNDTTGKL 181

Query: 237 SMDTEQVEQVVKDAIRKGVRPTCLVV-INPGNPTGAILSPEAIEKILTVAAKYSLVVIAD 295
           ++D    +  +  +  K   P C+V+     NPTG   + E   KI+    + +++ I D
Sbjct: 182 AVDKWLNDLRINVSKDKSNVPHCIVLHACCHNPTGIDPTKEEWTKIIDTVHELNMIPIID 241

Query: 296 EVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELV 355
             YQ  G +  D V    VLR   +     ++ + L    + + G+ GE   R G + ++
Sbjct: 242 MAYQ--GLESGDVVEDAYVLRSCLQDNRKWHNGLYLCQSFAKNMGLYGE---RVGSLSII 296

Query: 356 GFSEEVKQVFLK--------LASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAI 407
              E +  V L         + S+   P   G  +V+ ++   K     +    ++ N++
Sbjct: 297 TPYESLPSVRLAIDSQIKKIIRSMYSSPPGYGSRIVNTILSDEKLKKQWF----KDVNSM 352

Query: 408 HNSLHQKSTLLYETFQSLEGVSCQKPQGAMYL 439
            N LH     L+E     + V   +  G  Y 
Sbjct: 353 VNRLHSIRNKLFEQLHWDDLVEFGQQHGMFYF 384

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 70/184 (38%), Gaps = 33/184 (17%)

Query: 148 AYSASQGVAGFRQSVAEFIEER-------DGEPASANDIFLTAGASSAVSAIL---SMFC 197
            Y + +G    R+++  F  +        D   +    + L +GAS  V +IL   ++  
Sbjct: 53  TYGSDEGALWVRETICHFNNDEAFRLSPGDRARSKPEHLNLNSGASYGVLSILLETTLAH 112

Query: 198 TGSENGALIPIPQYPLYT----------ATLALNDAHALPYYLD-------------EAS 234
           TG    A +  P Y L             T A+++       LD             E  
Sbjct: 113 TGYTRQAFVITPTYFLINDCFIDAGFANKTTAIDELGDGKVDLDSLEKKLEELEKQHEGQ 172

Query: 235 GWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIA 294
             S D E +    K   +K  R     +    NP+G   + E   +++ +A KY ++++A
Sbjct: 173 DDSKDLELINNPWKSTHKKVYRYVLYCIPTFANPSGQTYTLETRRRLIEIARKYDMLILA 232

Query: 295 DEVY 298
           D+VY
Sbjct: 233 DDVY 236

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 66/151 (43%), Gaps = 5/151 (3%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPI 208
           Y  SQG     + + E  E          ++ +TAG +SA  + L +FC    N     +
Sbjct: 103 YGHSQGQPELLKFIREHTEIIHTMQYDDWELLVTAGNTSAWESTLRIFC----NRGDTIL 158

Query: 209 PQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPG-N 267
            +   ++++L+   A  +  +        +  E++  ++ +   +  +P  L  I  G N
Sbjct: 159 AEAHSFSSSLSAAQAQGIITFPVPIDDKGIIPEKLAAIMDNWNPETPKPKLLYTIPTGQN 218

Query: 268 PTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           PTG+ L  E   ++  +A K+  +++ DE Y
Sbjct: 219 PTGSSLDAERKSQVYKIAQKHDFLIVEDEPY 249

>TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {ON}
           Anc_2.475 YKL106W
          Length = 443

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 80/366 (21%), Positives = 137/366 (37%), Gaps = 65/366 (17%)

Query: 154 GVAGFRQSVAEFIEERDGEPASANDIFLT-----------AGASSAVSAILSMFCTGSEN 202
           G   +R  V  F+   DG P    +I               GA S  +  LS F + S  
Sbjct: 94  GHPNYRNKVLNFLFH-DGCPEIGPEIIYQDRVSFVQTLSGTGALSVTARFLSNFISDS-- 150

Query: 203 GALIPIPQYPLYTATLALN---DAHALPYYLDEA---SGWSMDTEQVEQVVKDAIRKGVR 256
             +IP   +  +      N   +    PYY +E      W      +++  ++ +    +
Sbjct: 151 -IIIPQLSWANHANVFKNNGFRNISYYPYYSNEKIVLKDWLNHLINIQKTDRE-VTSNSK 208

Query: 257 PTCLVV-INPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVL 315
           P+C+++     NPTG   + E  ++IL      +L+ I D  YQ  G +  D +    +L
Sbjct: 209 PSCILLHACCHNPTGLDPTKEQWDQILDTIYDLNLIPIIDMAYQ--GLESGDVLKDSYLL 266

Query: 316 R-VLQKTEPGKYDN-VQLASLHSTSKGVSGECGQRGGYMELV---------------GFS 358
           R VL K     + N + L    + + G+ GE   R G + ++                  
Sbjct: 267 RKVLNKKRYKNWKNGIYLCQSFAKNMGLYGE---RVGSLSIILPETNSGNKSTSIRENID 323

Query: 359 EEVKQVFLKLAS---------ISLC---PVVTGQALVDLMVRPPKKGDASYELDRQ-ERN 405
            ++KQ+   + S         +SL      +  Q  +D+     +  D  Y+L ++   N
Sbjct: 324 SQLKQIIRSMYSSPPGYGARIVSLILSDKDLKDQWFLDVKEMVDRLNDVRYKLSQKLNWN 383

Query: 406 AIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYC 465
           +I + L+Q+  + Y T  S   V   K Q A+YL     LS   I           +Y C
Sbjct: 384 SIID-LNQQHGMFYFTNLSPIQVERLKNQFAIYLTTDGRLSLSGINDLNV------DYIC 436

Query: 466 KELLEA 471
             +L  
Sbjct: 437 NSILNV 442

>SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} highly
           similar to gnl|GLV|KLLA0E00935g Kluyveromyces lactis
           KLLA0E00935g and similar to YER152C uniprot|P10356
           Saccharomyces cerevisiae YER152C Hypothetical ORF
          Length = 445

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 74/181 (40%), Gaps = 31/181 (17%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASAND----IFLTAGASSAVSAIL---SMFCTGS 200
            Y + +G    RQ++ +F     G   S       I LT GAS  V  IL   ++  TG 
Sbjct: 50  TYGSDEGALWVRQAICDFSNHVFGLSDSVKSKPEFINLTGGASYGVMNILEQTTLAHTGY 109

Query: 201 ENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVK--DAIRKGV-RP 257
              A I  P Y L   T      +     ++E  G S+D E ++  ++  D+I  G+   
Sbjct: 110 TRQAFIVSPTYFLINETFIDAGFNGKLTAINEL-GDSIDFETLKSKLEHFDSIDDGIDHS 168

Query: 258 TCLVVINP--------------------GNPTGAILSPEAIEKILTVAAKYSLVVIADEV 297
             L +IN                      NP G   + E   K++ +A K+ +++I+D+V
Sbjct: 169 KDLDLINSPSTAHPKKIYKYVLYFVPTYSNPGGKTYNLETRLKLIDLARKHDMLIISDDV 228

Query: 298 Y 298
           Y
Sbjct: 229 Y 229

>TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON}
           Anc_2.420 YLR027C
          Length = 408

 Score = 37.0 bits (84), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 42/94 (44%), Gaps = 14/94 (14%)

Query: 267 NPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRV----LQKTE 322
           NPTG   +PE  E++L   AKY  + + D  YQ  GF   D     K +R+    L K  
Sbjct: 186 NPTGMDPTPEEWEQVLDAMAKYHHIALFDSAYQ--GFASGDLDRDAKAIRLGHAKLSKQS 243

Query: 323 PGKYDNVQLASLHSTSKGVSGECGQRGGYMELVG 356
           P       +    S SK + G  G+R G + +V 
Sbjct: 244 P-------IIICQSFSKNL-GLYGERIGCLHIVN 269

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 10/70 (14%)

Query: 236 WSMDTEQVEQVVKDAIRKGVRPT--CLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVI 293
           W++D         D +R  + P    L++  P NP G + + E + +I  +  + ++V+I
Sbjct: 187 WTVD--------YDELRAAITPKTKALILNTPHNPIGKVFTREELLEIGNICVENNVVII 238

Query: 294 ADEVYQENGF 303
           +DEVY+   F
Sbjct: 239 SDEVYEHLYF 248

>NCAS0A05730 Chr1 (1121257..1122573) [1317 bp, 438 aa] {ON}
           Anc_2.475
          Length = 438

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 75/177 (42%), Gaps = 13/177 (7%)

Query: 183 AGASSAVSAILSMFCTGSENGALIPIPQYPL--YTATLALNDAHALPYY--LDEASGWSM 238
            GA +  ++ LS F T       I +P Y    +T     N   ++ YY   D  +G  +
Sbjct: 133 TGAVAIAASFLSTFITNE-----ISVPNYSWANHTNIFTKNGFPSVDYYPYYDRKTG-QI 186

Query: 239 DTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           D +     +K+    G     L+  +  NPTG   + +  EKI+    +  ++ + D  Y
Sbjct: 187 DFQNWINHLKNLPFLGKPRGILLHASCHNPTGLDPTRQQWEKIIDTIYELKMIPVIDMAY 246

Query: 299 QENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELV 355
           Q  G +  + +    +LR+   T+   + N  +    S +K + G  G+R G + +V
Sbjct: 247 Q--GLETGNLIEDAHLLRLCLNTDKYPHWNNGIFLCQSFAKNM-GLYGERVGSLSIV 300

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 90/240 (37%), Gaps = 38/240 (15%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASAND-IFLTAGASSAVSAIL---SMFCTGSENG 203
            Y + +G    RQ V   I +   +  S  + I LT+GAS  +  IL   ++  TG    
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYGILNILLQTTLPHTGYTKQ 109

Query: 204 ALIPIPQYPL---------------------YTATLALNDAHALPYYLDEASGWSMDTEQ 242
           A I  P Y L                     YT+         L Y+  E      ++  
Sbjct: 110 AFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQNSTD 169

Query: 243 VEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQ--E 300
           + Q   +  +K  +     +    NP+G     E   +++ +A KY +++I D+VY   +
Sbjct: 170 IIQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVYDLLD 229

Query: 301 NGFDDA-------DFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYME 353
             FD           V + ++L   Q  E   Y N    S  S SK V+   G R GY E
Sbjct: 230 YNFDSNATSNVAPRLVHLDRMLSNEQIYESNFYGNT--ISNASFSKLVAP--GLRIGYHE 285

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 52/125 (41%), Gaps = 8/125 (6%)

Query: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHAL---PYYLDEAS 234
           DI  T G++    A L +FC     G  + +  Y  Y++++   DA  L   P  LD   
Sbjct: 132 DIITTTGSTQGWDASLRIFCN---KGDTVLLEDY-TYSSSVEAADAQGLNCVPMPLDGEG 187

Query: 235 GWSMDTEQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVI 293
                 E++         +   P  L  I  G NPTG  LS      I  +A +Y +++I
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIII 247

Query: 294 ADEVY 298
            D+ Y
Sbjct: 248 EDDPY 252

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 241 EQVEQVVKDAIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           E++E+++ +      RP  L  I  G NPTG  L+ +  ++I  +A K+  ++I DE Y
Sbjct: 190 EKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 66/154 (42%), Gaps = 15/154 (9%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIP 207
            Y A +G    R  +A       G   SA+++ +T GA  A + +L     G  +  +  
Sbjct: 55  TYGAIKGSKDLRTLIAGLY----GVQFSADNVLVTNGAIGA-NFLLYYTLVGKGDHVICV 109

Query: 208 IPQYPLYTATLALNDAHALPYYLDEASGW--SMDTEQVEQVVKDAIRKGVRPTCLVVINP 265
            P Y    +   +  A      L E   +  ++DT      +K AI+   +   +++ NP
Sbjct: 110 HPTYSQLYSVPKMFGAEVTLLELSEKDSFLPNLDT------LKKAIKSNTK--LIIINNP 161

Query: 266 GNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQ 299
            NP G ++S E +  I  +  + ++ +  DEVY+
Sbjct: 162 NNPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 69/153 (45%), Gaps = 13/153 (8%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFC-TGSENGALI 206
           +Y A +G    R S+A       G   + +DI LT GA  A    L+ +   G+ +  + 
Sbjct: 54  SYGAIKGSDELRTSIASLY----GPDFTMDDILLTNGAIGA--NFLAFYTLVGAGDHVIC 107

Query: 207 PIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPG 266
             P Y    +   +  A      L +   +  + + ++ ++K+  +       +++ NP 
Sbjct: 108 VEPTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKNNTK------LIIINNPN 161

Query: 267 NPTGAILSPEAIEKILTVAAKYSLVVIADEVYQ 299
           NP G+++  + +++I  +  +  + + +DEVY+
Sbjct: 162 NPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 73/199 (36%), Gaps = 36/199 (18%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASANDIFL--TAGASSAVSAIL---SMFCTGSEN 202
            Y +  G    R+ +A F  E+          FL  T+GAS  +  +L   S+  TG   
Sbjct: 52  TYGSDLGALWVREQIARFNNEKIFHVNHTKPEFLNLTSGASYGILNVLLQTSLPHTGYTK 111

Query: 203 GALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDT-------------------EQV 243
            A I  P Y L                +DE  G   D                    E +
Sbjct: 112 QAFIVTPTYFLINDCFIDAGFGGKLTAIDETMGDEYDLNLELLETNLKSFAEEEDEKESI 171

Query: 244 EQVVKDAI----RKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQ 299
             + +D I    +K  R     V    NP+G   S +   K++ +A +Y +++I+D+VY 
Sbjct: 172 SCIQRDKIGVENKKIYRFVMYCVPTFSNPSGNTYSLKTKLKLIELARRYDMLIISDDVY- 230

Query: 300 ENGFDDADFVSMKKVLRVL 318
                  D +  ++ L VL
Sbjct: 231 -------DLLDYEQFLDVL 242

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 74/166 (44%), Gaps = 25/166 (15%)

Query: 149 YSASQGVAGFRQSVAEF---IEERDGEPASAN-DIFLTAGASSAVSAILSMFCTGSENGA 204
           YS ++G+     SV EF   I +R   PA  N D+ L  G+S ++  I    C   + G 
Sbjct: 132 YSETRGLP----SVVEFSKKIVKRFNPPAYDNWDVLLANGSSDSLFKIFETLC---DEGV 184

Query: 205 LIPIPQYPLYTATLALNDA--HALPYYLD-----EASGWSMDTEQVEQVVKD----AIRK 253
            + + ++        +  +    +P  ++     E  G  +D + +  ++++      + 
Sbjct: 185 TVLMEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQG--IDVQYLCDLLENWEVGPYKH 242

Query: 254 GVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
             +P  L  I  G NPTG  LSPE  + I  +A  ++ +++ D+ Y
Sbjct: 243 LSKPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPY 288

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 123/313 (39%), Gaps = 50/313 (15%)

Query: 172 EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLD 231
           E  S  D+ L+ G++ ++  +    C  S    +      P  +   A   A  +P  +D
Sbjct: 130 ETESNWDVILSGGSNDSMFKVFETICDESTTVMIEEFTFTPAMSNVEATG-AKVIPIKMD 188

Query: 232 -----EASGWSMDTEQVEQVVKDA----IRKGVRPTCLVVINPG-NPTGAILSPEAIEKI 281
                E  G  +D E + +++ +      +   +P  L  I  G NPTG  +     EKI
Sbjct: 189 LTFDRERQG--IDVEDLTRLLDNWSTGPYKHLNKPKVLYTIATGQNPTGMSVPRWKREKI 246

Query: 282 LTVAAKYSLVVIADEVY-------------QENGFDDADFVSMKKVLRVLQKTEPGKYDN 328
             +A K+  +++ D+ Y              EN +D +D    + +   L K+      +
Sbjct: 247 YQLAQKHDFLIVEDDPYGYMYFPSYNPQNPLENPYDSSDLTIERYLNDFLMKSFLTLDTD 306

Query: 329 VQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL-CPVVTGQALVDLMV 387
            ++  L + SK  +   G R  ++    F   + Q  L LA I+   P  T QA+V   +
Sbjct: 307 ARVIRLETFSKIFAP--GLRLSFIVANKF---LLQKILDLADITTRAPSGTSQAIVYSTI 361

Query: 388 RPPKKGDASYELDRQERNAIHNSL------------HQKSTL---LYETFQSLEG-VSCQ 431
           +   + + S  +    R+A+  S             H+K+     LYET     G  +  
Sbjct: 362 KAMAESEMSSSV--SFRDAMFESWIKWIMQIASKYNHRKNVTLKALYETESYQAGHFTVM 419

Query: 432 KPQGAMYLFPKLD 444
           +P   M++  KLD
Sbjct: 420 EPSAGMFIIIKLD 432

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 68/159 (42%), Gaps = 11/159 (6%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASAN-DIFLTAGASSAVSAILSMFCTGSENGALIP 207
           Y+ ++G+ G   S A+ + ER   PA    ++ +  G+S A+  +  + C       L  
Sbjct: 94  YTNTEGM-GPLVSFAKKMIERINPPAYGGWNVCMANGSSDAMYKVFEVLCDEDSTVMLEE 152

Query: 208 IPQYPLYTATLALNDAHALPYYLD-----EASGWSMD--TEQVEQVVKDAIRKGVRPTCL 260
               P+  + + L  A  +P  +      E  G  +D   + ++       +   +P  L
Sbjct: 153 FTFSPV-ISNIKLQGASVVPVKMQLSADPEQQGIDVDRLADLLDNWSVGPYKHLNKPKAL 211

Query: 261 VVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
             +  G NPTG  LSP    +I  +A K+  +++ D+ Y
Sbjct: 212 YTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPY 250

>KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 80/165 (48%), Gaps = 23/165 (13%)

Query: 149 YSASQG---VAGFRQSVAEFIEERDGEPASAN-DIFLTAGASSAVSAILSMFCTGSENGA 204
           YS ++G   +  F + +  ++     +PA  N D+ L  G+S ++S +   F T ++   
Sbjct: 131 YSDTKGFPQLIDFSKKLVSYL----NKPAYDNWDVMLANGSSDSLSKV---FTTLTDEDV 183

Query: 205 LIPIPQYPLYTATLALNDAHA-LPYYL-----DEASGWSMDTEQVEQVVKD----AIRKG 254
            + + ++  +T T++   A+  +P  L     D+AS   ++ E ++Q++++         
Sbjct: 184 TVLMEEFT-FTPTISNVTANGGIPIPLKVDITDDASQQGINVEYMDQLLENWSTGEYSHL 242

Query: 255 VRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
            +P  L  I  G NPTG     E  +KI  +  K+ ++++ D+ Y
Sbjct: 243 SKPRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHDIIIVEDDPY 287

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 29/152 (19%), Positives = 66/152 (43%), Gaps = 11/152 (7%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCTGSENGALIP 207
            Y + +G    R  +A       G   + +++ +T GA +A + ++     G  +  +  
Sbjct: 54  TYGSIKGSDKLRSLIASMY----GPEFNKDNVLVTNGAIAA-NFLIYYTLVGPGDHVICV 108

Query: 208 IPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGN 267
            P Y    +   +  A      L +  G+  + E +++++K   +       +++ NP N
Sbjct: 109 DPTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSNTK------LIIINNPNN 162

Query: 268 PTGAILSPEAIEKILTVAAKYSLVVIADEVYQ 299
           P G+ +S E +  I  +  + ++ +  DEVY+
Sbjct: 163 PLGSAISTETLNDICQLCEENNIYLHCDEVYK 194

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 71/175 (40%), Gaps = 23/175 (13%)

Query: 148 AYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAIL---SMFCTGSENGA 204
            Y   +G    RQ + +F     G  +    + L++G+S    ++L   ++  T     A
Sbjct: 52  TYGPDEGALWVRQQICDFNNRLFGSDSKPEFLNLSSGSSYGCLSVLLHTTLPHTNFTRQA 111

Query: 205 LIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQV-------EQVVKDA------I 251
            I  P Y L           +    +DE    S++ EQ+       E++  ++      I
Sbjct: 112 FIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGDVSII 171

Query: 252 RKGVRPTCLV-------VINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQ 299
           +   +PT  V       V    NP+G   S E   K++ +A +Y +++I D+VY 
Sbjct: 172 QNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYD 226

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 60/290 (20%), Positives = 122/290 (42%), Gaps = 49/290 (16%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASAN------DIFLTAGASSAVSAILSMFCTGSEN 202
           Y+ ++G+      V +F+  R   PA ++      D+ L+ G++ ++  +    C   + 
Sbjct: 102 YAETKGLPPLLHFVKDFVS-RINRPAFSDETESNWDVILSGGSNDSMFKVFETIC---DE 157

Query: 203 GALIPIPQYPLYTATLALNDAHA-----LPYYLD-----EASGWSMDTEQVEQVVKD--- 249
              + I ++   T T A+++  A     +P  ++     E+ G  +D E + Q++ +   
Sbjct: 158 STTVMIEEF---TFTPAMSNVEATGAKVIPIKMNLTFDRESQG--IDVEYLTQLLDNWST 212

Query: 250 -AIRKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVYQ-------- 299
              +   +P  L  I  G NPTG  +     EKI  +A ++  +++ D+ Y         
Sbjct: 213 GPYKDLNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPYGYLYFPSYN 272

Query: 300 -----ENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMEL 354
                EN +  +D  + + +   L K+      + ++  L + SK  +   G R  ++  
Sbjct: 273 PQEPLENPYHSSDLTTERYLNDFLMKSFLTLDTDARVIRLETFSKIFA--PGLRLSFIVA 330

Query: 355 VGFSEEVKQVFLKLASISL-CPVVTGQALVDLMVRPPKKGDASYELDRQE 403
             F   + Q  L LA I+   P  T QA+V   ++   + + S  L  +E
Sbjct: 331 NKF---LLQKILDLADITTRAPSGTSQAIVYSTIKAMAESNLSSSLSMKE 377

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 73/161 (45%), Gaps = 13/161 (8%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPA-SAN--DIFLTAGASSAVSAILSMFCTGSENGAL 205
           Y+   G+   R + A+++  +  +PA SA+  D+ L++G+  ++      FC       +
Sbjct: 125 YNEVPGLPQIR-NFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVLM 183

Query: 206 IPIPQYPLYTATLALNDAHALPYYLD---EASGWSMDTEQVEQVVKDA----IRKGVRPT 258
                 P+ +   A   A  +P  ++   + S   +D + + Q++ +      +   +P 
Sbjct: 184 EEFTFTPVISHVKATG-AECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKPR 242

Query: 259 CLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
            L  I  G NPTG  +  E   KI  +A K++ +++ D+ Y
Sbjct: 243 ILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>SAKL0E04268g Chr5 complement(338322..339587) [1266 bp, 421 aa] {ON}
           highly similar to uniprot|P23542 Saccharomyces
           cerevisiae YLR027C AAT2 Cytosolic aspartate
           aminotransferase involved in nitrogen metabolism
           localizes to peroxisomes in oleate-grown cells
          Length = 421

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 67/174 (38%), Gaps = 15/174 (8%)

Query: 184 GASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQV 243
           GA    +  L+ FC  SE    +  P +  +TA           Y    A+  S+D E  
Sbjct: 111 GALHIAAKFLNKFC--SEKVVYLSQPTWANHTAIFETQGLKTATYPYWNAATKSLDLEGY 168

Query: 244 EQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQ--EN 301
              +KDA +  V    ++     NPTG   S E    IL    K   +V+ D  YQ   +
Sbjct: 169 LNAIKDAPKGSV---FVLHACAHNPTGLDPSKEQWVDILDALVKGDHIVLFDSAYQGFAS 225

Query: 302 GFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELV 355
           G  D D  +++  L  L    P       +    S +K V G  G+R G   LV
Sbjct: 226 GNLDNDAYAVRLGLEKLATVSP-------VLICQSFAKNV-GMYGERVGCFHLV 271

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 72/164 (43%), Gaps = 16/164 (9%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEPASAN------DIFLTAGASSAVSAILSMFCTGSEN 202
           Y+ ++G+    Q   + +  R   PA ++      D+ L+ G++ ++  +   FC  S  
Sbjct: 150 YAETKGMPPLLQFTKDMVA-RINRPAFSDETDSNWDVILSGGSNDSMYKVFETFCDES-T 207

Query: 203 GALIPIPQYPLYTATLALNDAHALPYYLD---EASGWSMDTEQVEQVVKD----AIRKGV 255
             +I    +    + +    A  +P  ++   +    S+D + + Q++++      R   
Sbjct: 208 TVMIEEFTFTPAVSNVEATGATVVPIKINLSADRETQSVDVDYLSQLLENWSTGPYRHLN 267

Query: 256 RPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           +P  L  I  G NPTG  +     EKI  +A ++  +++ D+ Y
Sbjct: 268 KPRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLIVEDDPY 311

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 267 NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           NP+G   S E   +++ +A KY ++VI D+VY
Sbjct: 203 NPSGNTYSLETRRRLIEIARKYDMLVITDDVY 234

>TDEL0G02700 Chr7 (516198..518042) [1845 bp, 614 aa] {ON} Anc_2.340
           YMR168C
          Length = 614

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 23/29 (79%)

Query: 97  KPLTFYRQVLSLLQNPALIESLPTGELHK 125
           KP+TF+ ++ SLLQ+ A +E LPT ++++
Sbjct: 313 KPITFHTELSSLLQHAAYLEDLPTTDVYQ 341

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 267 NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           NP+G   S E   +++ +A KY +++I D+VY
Sbjct: 196 NPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>Kwal_23.3458 s23 complement(298021..298482) [462 bp, 153 aa] {ON}
           YDL110C - Hypothetical ORF [contig 252] FULL
          Length = 153

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 100 TFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159
           T  R+ + + +  A+I+ LP G+L+K+     +E + K L +    +  Y A   + G R
Sbjct: 5   TSRRRPVEITEFKAVIKDLPDGQLNKIRSE--LENSMKHLDRSNLRLKKYIAK--IEGKR 60

Query: 160 QSVAEFIEERDGEPASANDIFL 181
           +S  + ++E + +   AND+ L
Sbjct: 61  ESTPDGVDEEELDKVDANDLQL 82

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 72/179 (40%), Gaps = 30/179 (16%)

Query: 149 YSASQGVAGFRQSVAEFIEE-----RDGEPAS--ANDIFLTAGASSAVSAIL---SMFCT 198
           Y + +G    R+ +  F+ E     +DG      A  + L +GAS  +  IL   ++   
Sbjct: 50  YGSDEGALWVREQICRFLNEQVFKFKDGARTRTLAQHLNLDSGASYGMLNILLQTTLPHN 109

Query: 199 GSENGALIPIPQYPLYTATL----------ALN-------DAHALPYYLD--EASGWSMD 239
           G    A I  P Y L               A+N       D  +L   LD  EA      
Sbjct: 110 GYTRQAFIITPTYFLINDCFTDAGFKGKITAINERGHDSIDFESLIAALDRHEAEPQPRG 169

Query: 240 TEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           T ++ Q  K + +K  +     +    NP+G   S E   +++ +A +Y ++VI D+VY
Sbjct: 170 TTEIIQGSKLS-KKIFKYVMYCIPTFANPSGNTYSLETRRRLIDIARQYDMLVITDDVY 227

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 35/176 (19%), Positives = 72/176 (40%), Gaps = 32/176 (18%)

Query: 149 YSASQGVAGFRQSVAEFIEERDGEP-ASANDIFLTAGASSAVSAILSMFCTGS-----EN 202
           YSA++G+         F++     P  +  D  L  G+S ++  +  +    +     E 
Sbjct: 115 YSATEGLDPLLNFTKSFLQRIGNTPLYNGWDTILANGSSDSLYKVFDILADRNTTVLVEE 174

Query: 203 GALIPIPQYPLYTATLALNDAHALPY--YLDEASGWS-------------MDTEQVEQVV 247
              +P+        T+    AH +P    LDE +  +             +D E +  ++
Sbjct: 175 FTFVPV------VGTILGTGAHIVPMKLNLDEVTSDNFNNDKQFDPNHEGIDVEYLADLL 228

Query: 248 KDAI----RKGVRPTCLVVINPG-NPTGAILSPEAIEKILTVAAKYSLVVIADEVY 298
           ++      +   +PT +  +  G NPTG  LS E   +I  +A +++ +++ D+ Y
Sbjct: 229 ENWAVGPHKHLPKPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 30  DLSQKALGSKKTLRDVNQCVLNAKYAVRG--PIPLRAEELRHKLVEEPGSLP-FNKIINA 86
           DL QK++ S K L+D++    NAKY       I    EELR+ ++ +  SL  F   ++ 
Sbjct: 705 DLFQKSVASSKNLKDISNGS-NAKYTRNKNLKICFFTEELRNSIINDNKSLANFFPTVDE 763

Query: 87  NIGNPQQLDQKPLTFYRQVLSLLQNPALIESLP 119
            + +  QL Q+   +Y  +L L      +E+ P
Sbjct: 764 -LNDYVQLYQREFHYYFPILHLYSVEPSMENYP 795

>TDEL0A01940 Chr1 (355974..357236) [1263 bp, 420 aa] {ON} Anc_2.420
           YLR027C
          Length = 420

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 58/134 (43%), Gaps = 21/134 (15%)

Query: 227 PYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVI---NPGNPTGAILSPEAIEKILT 283
           PY+  +AS  ++D E   + +KDA      PT  V++      NPTG   + +    I+ 
Sbjct: 153 PYW--QASTKTLDMEGFLKTIKDA------PTGSVILLHACAHNPTGLDPTQDQWSDIID 204

Query: 284 VAAKYSLVVIADEVYQ--ENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGV 341
             A    +V+ D  YQ   +G  D D  +++  +  L +  P       +    S +K V
Sbjct: 205 AVASKDHIVLFDSAYQGFASGDLDRDAYAIRLGVEKLARVSP-------IFVCQSFAKNV 257

Query: 342 SGECGQRGGYMELV 355
            G  G+R G   LV
Sbjct: 258 -GMYGERAGCFHLV 270

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,707,623
Number of extensions: 2137298
Number of successful extensions: 5738
Number of sequences better than 10.0: 148
Number of HSP's gapped: 5786
Number of HSP's successfully gapped: 148
Length of query: 519
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 405
Effective length of database: 40,409,475
Effective search space: 16365837375
Effective search space used: 16365837375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)