Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13640g8.264ON41441422250.0
Kwal_56.237828.264ON41441517590.0
SAKL0H16984g8.264ON43543612171e-165
ZYRO0C01606g8.264ON43244510131e-134
AGR084C8.264ON42741510011e-133
TDEL0F039108.264ON42941210001e-133
Ecym_43068.264ON4344169931e-131
KLLA0F19184g8.264ON5124209581e-125
NCAS0B050308.264ON4334469451e-124
NDAI0B020008.264ON4334459411e-124
Kpol_543.408.264ON4144307951e-102
YLR090W (XDJ1)8.264ON4594277742e-98
Skud_12.1588.264ON4554397612e-96
Smik_12.1498.264ON4604287543e-95
TPHA0A017908.264ON4394187411e-93
Suva_10.1748.264ON4564357281e-91
CAGL0L12276g8.264ON4524616916e-86
KNAG0G020508.264ON4324156774e-84
YNL064C (YDJ1)2.243ON4094295658e-68
Skud_14.2682.243ON4104295632e-67
Smik_14.2632.243ON4094295613e-67
TBLA0E038102.243ON4103695589e-67
KAFR0J009402.243ON4113955544e-66
KNAG0I019002.243ON4093685535e-66
CAGL0J09966g2.243ON4073665527e-66
Kpol_1003.122.243ON4083665492e-65
Suva_14.2772.243ON4094245483e-65
ZYRO0A01496g2.243ON4124295413e-64
NDAI0D010302.243ON4113665414e-64
Kwal_23.48302.243ON4113685319e-63
TPHA0C031102.243ON4074235311e-62
KLLA0F03333g2.243ON4093665292e-62
ADL257C2.243ON4103685292e-62
Ecym_32812.243ON4093955258e-62
NCAS0G030002.243ON4103815171e-60
KLTH0G09394g2.243ON4113685135e-60
TDEL0C046002.243ON4113665065e-59
SAKL0E08734g2.243ON4113705066e-59
KLTH0G08756g2.218ON4623694617e-52
Kwal_23.30612.218ON4583774363e-48
KLLA0E07899g2.218ON4954104225e-46
ZYRO0C15048g2.218ON4914664225e-46
TDEL0C043502.218ON4623734196e-46
SAKL0H05258g8.730ON3683504083e-45
AER427W2.218ON4704034101e-44
SAKL0E09306g2.218ON4613693933e-42
KAFR0A041608.730ON3783553866e-42
Ecym_62368.730ON3743613841e-41
Smik_14.2492.218ON5334333921e-41
YNL077W (APJ1)2.218ON5284303903e-41
Suva_14.2622.218ON5364223861e-40
NCAS0B005308.730ON3753643771e-40
Skud_14.2532.218ON5324163842e-40
KLTH0D12496g8.730ON3753523664e-39
CAGL0J10296g2.218ON4794143621e-37
TBLA0E036602.218ON4483883601e-37
NDAI0E008708.730ON3763503562e-37
YMR214W (SCJ1)8.730ON3773713552e-37
TDEL0B037908.730ON3733513552e-37
Kpol_1002.1222.218ON5034053612e-37
KLLA0C07260g8.730ON3683503533e-37
NCAS0G028502.218ON4943933594e-37
Suva_13.3978.730ON3753523524e-37
KNAG0M020202.218ON4603553574e-37
KNAG0G028808.730ON3783613525e-37
NDAI0F024502.218ON5304453501e-35
ZYRO0A06226g8.730ON3773573394e-35
Kpol_1064.408.730ON3873553378e-35
Smik_13.4228.730ON3783543352e-34
Skud_13.3838.730ON3753513291e-33
CAGL0F03729g8.730ON3613493262e-33
TPHA0G006308.730ON3933663282e-33
AER346W8.730ON3673493141e-31
TPHA0D005508.61ON4864213084e-30
Ecym_53842.218ON5032823084e-30
KNAG0G011308.61ON5003943075e-30
TBLA0B034908.730ON3843672931e-28
Kwal_26.90248.730ON3752242656e-25
KAFR0C031608.61ON4983842634e-24
TBLA0D026008.61ON5103912563e-23
TPHA0C029802.218ON5542702468e-22
NDAI0G032808.61ON5523902405e-21
Kpol_1011.98.61ON4953772352e-20
ZYRO0F03652g8.61ON4623992298e-20
CAGL0J04224g8.61ON5223752308e-20
Suva_6.448.61ON5074062201e-18
YFL016C (MDJ1)8.61ON5114022183e-18
Smik_6.638.61ON5104012157e-18
NCAS0C039508.61ON5193882112e-17
Skud_6.568.61ON5174072076e-17
TDEL0H022907.217ON387911782e-13
AFR507W8.61ON474681764e-13
KNAG0I007407.157ON4251031755e-13
TBLA0J018707.157ON470981731e-12
ZYRO0D16390g7.217ON398911711e-12
TBLA0D042407.217ON389941702e-12
KLLA0D04818g1.398ON354671692e-12
NCAS0E029307.217ON387911692e-12
KLLA0D13464g7.157ON433981693e-12
CAGL0J02750g7.217ON382911674e-12
Kwal_0.2071.398ON353671674e-12
TBLA0E024907.217ON366941665e-12
NDAI0C026101.398ON340671665e-12
KLTH0A03740g7.217ON395991675e-12
NDAI0G042501.398ON363671656e-12
CAGL0H03707g1.398ON349671648e-12
Ecym_43727.217ON579671669e-12
AAL008W1.398ON349671641e-11
ZYRO0E04598g1.398ON357671641e-11
NDAI0E045607.217ON394911641e-11
KAFR0H031501.398ON359671631e-11
ADR015W7.157ON436981641e-11
Kpol_457.151.398ON357671631e-11
NCAS0A132107.157ON414981632e-11
SAKL0F04444g7.157ON4291001632e-11
KAFR0L007407.217ON364911622e-11
Skud_5.1587.217ON391911622e-11
TPHA0G014808.698ON660771642e-11
CAGL0J01936g7.157ON425981632e-11
TPHA0C012607.217ON380911622e-11
KNAG0L013307.217ON396911622e-11
NDAI0A028207.157ON482981622e-11
Suva_5.1507.217ON391911613e-11
TDEL0B059601.398ON369671603e-11
Smik_14.3211.398ON366671603e-11
TPHA0B037601.398ON355671603e-11
KNAG0H016801.398ON363671603e-11
YNL007C (SIS1)1.398ON352671593e-11
SAKL0D08778g1.398ON348671593e-11
Ecym_44697.157ON433981604e-11
Suva_14.3411.398ON359671594e-11
KLTH0H12100g1.398ON350671594e-11
Kpol_1072.48.698ON661771614e-11
Kpol_1070.227.217ON380911594e-11
Smik_15.4378.698ON663771615e-11
Skud_14.3201.398ON368671585e-11
KNAG0J018408.698ON650771597e-11
Smik_5.1737.217ON391911577e-11
Suva_8.3038.698ON664771598e-11
TDEL0A064308.698ON666771588e-11
SAKL0F08052g7.217ON3931301578e-11
KAFR0B047807.157ON4231031579e-11
YER048C (CAJ1)7.217ON391911561e-10
KAFR0H023108.698ON655771571e-10
Kwal_47.181337.217ON393911552e-10
CAGL0L00957g7.217ON373911542e-10
CAGL0G07469g8.698ON668771562e-10
CAGL0C04565g1.113ON1751101472e-10
Skud_15.4208.698ON665771562e-10
YOR254C (SEC63)8.698ON663771562e-10
TBLA0A011007.157ON4341261542e-10
TBLA0B037308.698ON693771552e-10
KLLA0E04423g7.217ON428731542e-10
Skud_13.3232.350ON2241071493e-10
NCAS0G036101.398ON327671523e-10
TBLA0C014801.398ON353671523e-10
NCAS0C048901.398ON367671523e-10
KLLA0C09823g8.698ON669771533e-10
Ecym_12921.398ON347671514e-10
SAKL0B01276gna 1ON292931494e-10
TPHA0L007907.157ON446921515e-10
KLTH0F13398g7.157ON419981515e-10
Kwal_55.209657.157ON421981516e-10
NCAS0C012208.698ON669771517e-10
YMR161W (HLJ1)2.350ON2241071458e-10
YJR097W (JJJ3)1.113ON172671428e-10
ZYRO0D10934g8.698ON663771491e-09
Suva_12.1851.113ON168671401e-09
Ecym_23748.698ON661781482e-09
KAFR0C024507.217ON373911462e-09
Smik_13.3612.350ON2241071422e-09
KLLA0D07656g8.61ON4712851462e-09
ZYRO0G03850g7.157ON418981453e-09
Smik_9.2037.157ON432971453e-09
SAKL0H05984g8.698ON658771454e-09
TDEL0C058801.113ON1591001364e-09
TDEL0H032107.157ON411981435e-09
NDAI0D005001.113ON190701376e-09
TDEL0E005002.15ON581661436e-09
Suva_13.3402.350ON2251081386e-09
KNAG0F008602.15ON6261461411e-08
Kwal_26.88798.698ON656771411e-08
YIR004W (DJP1)7.157ON432971391e-08
KLTH0D11770g8.698ON652771402e-08
Skud_14.1102.15ON596661402e-08
Suva_9.2137.157ON431981392e-08
Suva_14.1162.15ON600661392e-08
TDEL0G028002.350ON2251061342e-08
YNL227C (JJJ1)2.15ON590851392e-08
KLTH0G18546gna 1ON283861353e-08
Skud_9.1817.157ON421971373e-08
Ecym_14508.61ON492691373e-08
Smik_14.1062.15ON593831374e-08
ZYRO0F15400g2.15ON525891364e-08
NCAS0A093201.297ON635941365e-08
KNAG0I008602.350ON219921315e-08
NDAI0F038002.15ON638661355e-08
Skud_10.3191.113ON168671286e-08
KLTH0F09944g2.350ON233671316e-08
Suva_6.1481.297ON642681356e-08
CAGL0J07370g2.15ON623661357e-08
NCAS0D009602.350ON224671298e-08
NDAI0K012308.698ON680771349e-08
KLTH0B08338g2.15ON590661349e-08
Kwal_14.24521.297ON607961339e-08
Kpol_529.212.15ON622661339e-08
Kpol_499.307.157ON408911321e-07
NCAS0G013602.15ON616661321e-07
NDAI0H031802.350ON229671281e-07
ABL194C2.15ON552661321e-07
Skud_10.1691.297ON644681312e-07
Smik_10.3851.113ON172671242e-07
KLLA0D19602g2.15ON620681302e-07
TBLA0G001702.15ON6591431302e-07
NCAS0I028301.185ON491651302e-07
Smik_10.1681.297ON649681293e-07
Kpol_526.62.350ON228851244e-07
AAL103W8.698ON669771284e-07
KNAG0C024501.185ON544641275e-07
KLLA0E01629g2.350ON231671235e-07
TPHA0O019402.15ON5981441275e-07
Ecym_56262.350ON243671245e-07
Kwal_23.3578singletonOFF85611155e-07
TDEL0C008708.61ON470691276e-07
Kpol_1027.131.297ON641681276e-07
AFL190C2.350ON235671236e-07
Ecym_11101.113ON156671197e-07
YJL073W (JEM1)1.297ON645681268e-07
SAKL0E06050g2.350ON232671228e-07
KNAG0A056502.350ON175861199e-07
TDEL0D016401.297ON6041011259e-07
KAFR0A079502.15ON551661259e-07
KAFR0A016201.297ON665821241e-06
Kwal_23.44202.15ON592661231e-06
CAGL0H02827g1.297ON656681232e-06
TPHA0A028101.185ON492761222e-06
KAFR0B048902.350ON220671173e-06
KAFR0G009101.113ON163761153e-06
Kwal_33.138601.185ON578721213e-06
KLTH0H10032g1.297ON607661213e-06
Kwal_47.179578.61ON478791213e-06
KLLA0D06402g1.297ON631691213e-06
ADR124C1.297ON611681204e-06
SAKL0E14234g2.15ON678661204e-06
ZYRO0A07502g2.350ON238951164e-06
TPHA0C045902.350ON233671165e-06
SAKL0B02068g8.61ON510691187e-06
CAGL0H04499g2.350ON232671148e-06
KLTH0A02882g8.61ON473691178e-06
TBLA0B093802.350ON227671149e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13640g
         (414 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   861   0.0  
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   682   0.0  
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   473   e-165
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   394   e-134
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   390   e-133
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   389   e-133
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   387   e-131
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   373   e-125
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    368   e-124
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    367   e-124
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   310   e-102
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   302   2e-98
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   297   2e-96
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   295   3e-95
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   290   1e-93
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   285   1e-91
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   270   6e-86
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   265   4e-84
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   222   8e-68
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   221   2e-67
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   220   3e-67
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   219   9e-67
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   218   4e-66
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   217   5e-66
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   217   7e-66
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   216   2e-65
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   215   3e-65
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   213   3e-64
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   213   4e-64
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   209   9e-63
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   209   1e-62
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   208   2e-62
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   208   2e-62
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   206   8e-62
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   203   1e-60
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   202   5e-60
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   199   5e-59
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   199   6e-59
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   182   7e-52
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   172   3e-48
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   167   5e-46
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   167   5e-46
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   166   6e-46
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   161   3e-45
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   162   1e-44
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   155   3e-42
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   153   6e-42
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   152   1e-41
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...   155   1e-41
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...   154   3e-41
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...   153   1e-40
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      149   1e-40
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...   152   2e-40
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   145   4e-39
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   144   1e-37
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...   143   1e-37
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   141   2e-37
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   141   2e-37
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   141   2e-37
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   143   2e-37
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   140   3e-37
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218    142   4e-37
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   140   4e-37
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   142   4e-37
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   140   5e-37
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...   139   1e-35
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   135   4e-35
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....   134   8e-35
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   133   2e-34
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   131   1e-33
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   130   2e-33
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   130   2e-33
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...   125   1e-31
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...   123   4e-30
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...   123   4e-30
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...   122   5e-30
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...   117   1e-28
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...   106   6e-25
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...   105   4e-24
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...   103   3e-23
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    99   8e-22
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    97   5e-21
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    95   2e-20
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    93   8e-20
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    93   8e-20
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    89   1e-18
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    89   3e-18
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    87   7e-18
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    86   2e-17
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    84   6e-17
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    73   2e-13
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    72   4e-13
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    72   5e-13
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    71   1e-12
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    70   1e-12
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    70   2e-12
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    70   2e-12
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     70   2e-12
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    70   3e-12
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    69   4e-12
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    69   4e-12
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    69   5e-12
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               69   5e-12
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    69   5e-12
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    68   6e-12
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    68   8e-12
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    69   9e-12
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    68   1e-11
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    68   1e-11
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             68   1e-11
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    67   1e-11
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    68   1e-11
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    67   1e-11
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    67   2e-11
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    67   2e-11
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    67   2e-11
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    67   2e-11
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    68   2e-11
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    67   2e-11
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    67   2e-11
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    67   2e-11
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    67   2e-11
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    67   3e-11
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    66   3e-11
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    66   3e-11
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    66   3e-11
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    66   3e-11
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    66   3e-11
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    66   3e-11
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    66   4e-11
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    66   4e-11
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    66   4e-11
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    67   4e-11
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    66   4e-11
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    67   5e-11
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    65   5e-11
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    66   7e-11
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    65   7e-11
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    66   8e-11
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    65   8e-11
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    65   8e-11
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               65   9e-11
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    65   1e-10
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    65   1e-10
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    64   2e-10
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    64   2e-10
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    65   2e-10
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    61   2e-10
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    65   2e-10
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    65   2e-10
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    64   2e-10
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    64   2e-10
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    64   2e-10
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    62   3e-10
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      63   3e-10
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    63   3e-10
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     63   3e-10
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    64   3e-10
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    63   4e-10
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    62   4e-10
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    63   5e-10
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    63   5e-10
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    63   6e-10
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     63   7e-10
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    60   8e-10
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    59   8e-10
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    62   1e-09
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    59   1e-09
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    62   2e-09
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    61   2e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    59   2e-09
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    61   2e-09
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    60   3e-09
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    60   3e-09
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    60   4e-09
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    57   4e-09
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    60   5e-09
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    57   6e-09
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    60   6e-09
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    58   6e-09
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    59   1e-08
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    59   1e-08
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    58   1e-08
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    59   2e-08
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    59   2e-08
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    58   2e-08
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    58   2e-08
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    56   2e-08
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    58   2e-08
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    57   3e-08
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    57   3e-08
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    57   3e-08
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    57   4e-08
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    57   4e-08
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    57   5e-08
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    55   5e-08
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      57   5e-08
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    54   6e-08
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    55   6e-08
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    57   6e-08
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    57   7e-08
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    54   8e-08
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    56   9e-08
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    56   9e-08
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    56   9e-08
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    56   9e-08
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    55   1e-07
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    55   1e-07
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      54   1e-07
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    55   1e-07
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    55   2e-07
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    52   2e-07
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    55   2e-07
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    55   2e-07
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    55   2e-07
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    54   3e-07
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    52   4e-07
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    54   4e-07
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    54   5e-07
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    52   5e-07
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    54   5e-07
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    52   5e-07
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    49   5e-07
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    54   6e-07
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    54   6e-07
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    52   6e-07
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    50   7e-07
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    53   8e-07
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    52   8e-07
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    50   9e-07
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    53   9e-07
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    53   9e-07
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    52   1e-06
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    52   1e-06
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    52   2e-06
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    52   2e-06
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    50   3e-06
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    49   3e-06
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    51   3e-06
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    51   3e-06
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    51   3e-06
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    51   3e-06
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    51   4e-06
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    51   4e-06
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    49   4e-06
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    49   5e-06
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    50   7e-06
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    49   8e-06
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    50   8e-06
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    49   9e-06
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    49   1e-05
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    49   1e-05
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    47   2e-05
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    49   2e-05
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    49   2e-05
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    46   2e-05
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    46   2e-05
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    48   2e-05
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    48   2e-05
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    48   3e-05
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    48   3e-05
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    48   3e-05
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    48   3e-05
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    48   3e-05
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    48   3e-05
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    45   4e-05
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    47   5e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    47   5e-05
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    47   6e-05
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    47   7e-05
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    46   9e-05
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    46   1e-04
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    46   1e-04
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    44   1e-04
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    46   1e-04
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    46   1e-04
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    44   1e-04
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    45   2e-04
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    45   2e-04
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    44   2e-04
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    45   2e-04
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    45   2e-04
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    45   2e-04
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    45   2e-04
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    44   3e-04
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    44   3e-04
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       44   5e-04
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    44   7e-04
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    43   7e-04
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    44   7e-04
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    44   8e-04
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    43   8e-04
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    43   9e-04
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    43   0.001
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    42   0.001
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    43   0.001
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    42   0.002
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    42   0.002
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    42   0.002
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    40   0.002
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    42   0.002
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    42   0.003
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    42   0.003
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    42   0.003
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    41   0.004
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    41   0.004
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    41   0.005
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    39   0.005
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    40   0.005
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    40   0.005
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    40   0.006
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         40   0.007
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    40   0.008
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    40   0.008
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    40   0.009
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    40   0.009
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    40   0.010
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    40   0.010
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    39   0.014
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    39   0.015
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    39   0.015
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    39   0.015
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    39   0.017
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    39   0.019
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    39   0.022
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    39   0.022
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    39   0.022
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    38   0.024
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    38   0.027
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    39   0.027
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    38   0.034
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    38   0.038
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    37   0.049
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    37   0.051
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    37   0.066
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    36   0.086
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    36   0.11 
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    36   0.12 
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    36   0.14 
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    36   0.14 
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    36   0.15 
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    35   0.35 
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    33   0.77 
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    33   0.77 
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    33   1.3  
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    33   1.5  
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    32   2.0  
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    32   2.0  
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    32   2.4  
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    32   3.1  
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    32   3.7  
NDAI0D03610 Chr4 (859564..860136) [573 bp, 190 aa] {ON} Anc_4.10...    31   3.9  
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    31   4.1  
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    31   4.4  
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    31   4.4  
CAGL0L07656g Chr12 (845021..845980) [960 bp, 319 aa] {ON} highly...    30   7.2  
NDAI0G03870 Chr7 complement(926437..929220) [2784 bp, 927 aa] {O...    31   7.4  
SAKL0A06094g Chr1 complement(552634..553749) [1116 bp, 371 aa] {...    30   8.1  
TPHA0P01440 Chr16 (295961..298696) [2736 bp, 911 aa] {ON} Anc_3....    31   9.1  
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    30   9.2  
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    30   9.7  

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/414 (100%), Positives = 414/414 (100%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
           MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE
Sbjct: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60

Query: 61  EKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAHVPI 120
           EKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAHVPI
Sbjct: 61  EKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAHVPI 120

Query: 121 RLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGF 180
           RLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGF
Sbjct: 121 RLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGF 180

Query: 181 VTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEAD 240
           VTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEAD
Sbjct: 181 VTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEAD 240

Query: 241 EEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKL 300
           EEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKL
Sbjct: 241 EEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKL 300

Query: 301 KVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNLL 360
           KVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNLL
Sbjct: 301 KVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNLL 360

Query: 361 PQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESEPGPQCAQQ 414
           PQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESEPGPQCAQQ
Sbjct: 361 PQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESEPGPQCAQQ 414

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/415 (77%), Positives = 373/415 (89%), Gaps = 2/415 (0%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
           MDPY+TLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLR+ESEIKFKEVAAAYELLSNE
Sbjct: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60

Query: 61  EKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAHVPI 120
           EKR+NYDTYGDTNG+S  Y GFQDGDFASFFGNFAS RY+DE + ++   PRTDDAHV +
Sbjct: 61  EKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSL 120

Query: 121 RLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGF 180
           RLTMQ+LYNGKT+RFQ+ RNVVCNRCEG G+R+RARHASAC+ CEGHGVKQRLRRLGPGF
Sbjct: 121 RLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGF 180

Query: 181 VTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEAD 240
           VTRE VQC KC+GLGKNLRSED+CKKCHGKRVTPE+KNLNVYIPRGSRH DR+VL+GEAD
Sbjct: 181 VTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEAD 240

Query: 241 EEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKL 300
           EEPGK+ GDLVFDI+E+S +S+LERRGSDL+ KI ISLSDALTGFEKEVCTTLDGR L+L
Sbjct: 241 EEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRL 300

Query: 301 KVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNLL 360
           K+P GQV+RPGN++ + NEGWPLDD+G KFG+MYVQI+IEFPPDHW+SER ++++L+N++
Sbjct: 301 KIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNII 360

Query: 361 PQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESEP-GPQCAQQ 414
           PQ+ SSSA S   ++  DP NTE P  F I+KSAEELP YL +++E  GPQC+QQ
Sbjct: 361 PQSTSSSAASSSASAEPDPVNTEMP-TFDILKSAEELPNYLPDDAEQGGPQCSQQ 414

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  473 bits (1217), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 243/436 (55%), Positives = 315/436 (72%), Gaps = 30/436 (6%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE LGVAPDA+Q EIKKAYR+LALQHHPDKV+DE LR+ESE+KFKE+ AAYE+LS+E+ R
Sbjct: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64

Query: 64  QNYDTYGDT--NGFSGDYSGFQDGDFASFFGNFASNRYQDE----YEAQSPPSPRTDDAH 117
           + YD YGD       G    F D DF +FF  +A   + DE    Y  +   S RT DA 
Sbjct: 65  KKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSDAR 124

Query: 118 VPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRR----ARHASACSQCEGHGVKQRL 173
           +P++L+M+ELYNGKT +F++KRNV+C+RC+G+G+R++     R    C  CEGHG K+R+
Sbjct: 125 IPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERI 184

Query: 174 RRLGPGFVTREIVQCDKCKGLGKNL--RSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGD 231
           +R+  GFV RE V+C++C G G+    + ED CKKCHGK V  E K L VYIPRGSR+GD
Sbjct: 185 KRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRNGD 244

Query: 232 RVVLKGEADEEPGKIPGDLVFDIAEN-SASSSLERRGSDLYAKITISLSDALTGFEKEVC 290
            V L+GEAD+EP K+ GDL+F I EN   S++LERRG DL+ ++ ISLS+A+TGFEK V 
Sbjct: 245 IVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVT 304

Query: 291 TTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSER 350
           TTLD R+LKLK+P G+V+RPGN++R++NEGWPLDD G+KFGDMYVQ+ IEFPPD+WFSE+
Sbjct: 305 TTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWFSEK 364

Query: 351 SDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLS-------- 402
           SDV+ L+ LLP+  ++       A   D  NTET + +S+VKSA+ELP YLS        
Sbjct: 365 SDVEVLRTLLPEVPNARV-----ADTGDLNNTETVIDYSVVKSADELPDYLSYEKGEYQG 419

Query: 403 EESEPG----PQCAQQ 414
           +E E G    PQCAQQ
Sbjct: 420 QEQEYGAFEEPQCAQQ 435

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  394 bits (1013), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 205/445 (46%), Positives = 284/445 (63%), Gaps = 44/445 (9%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
           M  Y+TLGV+ DATQ EIKKAYR+LALQHHPDKV+D+S+R+ESE++FKE+ AAYE+LS+E
Sbjct: 1   MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60

Query: 61  EKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQS-----PPSPRTDD 115
           EKR  YDTYGDT     D   F+D  F +FF  F S    +           P   R+DD
Sbjct: 61  EKRSKYDTYGDT----ADGPDFEDESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDDRSDD 116

Query: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARH---ASACSQCEGHGVKQR 172
             VP++++M + YNGK  +FQ+KR +VC +CEG+G RRR+      + C  C+G G K++
Sbjct: 117 VQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGPPPQTNCKSCQGRGYKEQ 176

Query: 173 LRRLGPGFVTREIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYIPRGSR 228
           LRR+ PG V ++ V C  C G GK +      ++ CKKC G+ +  E+K L V IPRGSR
Sbjct: 177 LRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSR 236

Query: 229 HGDRVVLKGEADEEPGKI-PGDLVFDIAENSA---SSSLERRGSDLYAKITISLSDALTG 284
           HGDR+V +GEAD+E GK   GDL+F + E +       LERRG DL   I+ISL++A+TG
Sbjct: 237 HGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITG 296

Query: 285 FEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPD 344
            ++ +  TLDGR+LKL  P G+V+ PG  ++++ EGWPL+   +KFGD+YV +DI FP D
Sbjct: 297 LDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRD 356

Query: 345 HWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEE 404
           +WF+E+SD+  ++N+LP   S +A +D  A   DP NTE   + S +K  ++LP Y+   
Sbjct: 357 NWFAEKSDLLKIRNILP---SEAANNDVKA---DPGNTE---QVSDMKLVDQLPDYMGSN 407

Query: 405 SEP---------------GPQCAQQ 414
            +                 PQCAQQ
Sbjct: 408 GDQYAHEGHASGAFPDDGTPQCAQQ 432

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  390 bits (1001), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/415 (47%), Positives = 283/415 (68%), Gaps = 20/415 (4%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D YE LG+A  A++ E+K+AYR+LAL++HPDK+SDES R+ SE KFKE++AAY +LS+E+
Sbjct: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63

Query: 62  KRQNYDTYGDTNGFSG-DYSGFQDGDFASFF----GNFASNRYQDEYEAQSPPSPRTDDA 116
           KR  YD +G  +G  G D  G  D DF +FF    G       +D++E       RT D+
Sbjct: 64  KRAEYDQFGTVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVG----RTADS 119

Query: 117 HVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRR--ARHASACSQCEGHGVKQRLR 174
            VP++LT ++LY GKT +F+A+R V+C RC G+G+R+R  AR    C  CEG G K+R+ 
Sbjct: 120 TVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERIS 179

Query: 175 RLGPGFVTREIVQCDKCKGLGKNL--RSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDR 232
           R+GPG ++RE V C  C G GK +   + D CKKC GK V  E   ++VY+PRGS+HGDR
Sbjct: 180 RIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDR 239

Query: 233 VVLKGEADEEPGKIPGDLVFDIAENS-ASSSLERRGSDLYAKITISLSDALTGFEKEVCT 291
           +   G++D EPGK  GDLVF I E +  SSSLER+G+DLY  + ISL++ALTGF + V  
Sbjct: 240 LRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTR 299

Query: 292 TLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERS 351
           T D R+L++ +P G+V+RPGN+++  NEGWP++D G++FGDMYVQ+ IEFP D+WF+E++
Sbjct: 300 TFDERVLRINIPRGKVLRPGNYLKFTNEGWPIED-GARFGDMYVQVLIEFPKDNWFNEKA 358

Query: 352 DVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESE 406
           ++ +++N+LP    + +T        DP+NTE    +SI+ +   LP YL  E++
Sbjct: 359 ELDAIRNILPGLADAPST-----KTEDPSNTEEVRAYSIIANHTGLPDYLDRENQ 408

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  389 bits (1000), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 208/412 (50%), Positives = 273/412 (66%), Gaps = 29/412 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE LGV  DATQ EIKKAYR+ ALQHHPDKV+DESLR+ESE++FKE+AAAYE+L +EEKR
Sbjct: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64

Query: 64  QNYDTYGDTNG--FSGDYSGFQDGDFASFFGNFASN--RYQDEYEAQSPPSPRTDDAHVP 119
             YD YGD +G  F    + F+D  F +FF +F SN     D Y  Q     R+ D  VP
Sbjct: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQK--VDRSADVQVP 122

Query: 120 IRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASA-----CSQCEGHGVKQRLR 174
           + ++M + YNGK+ +FQ+KR +VC+RC G+G RRR  H        C +C G G KQR+R
Sbjct: 123 LNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIR 182

Query: 175 RLGPGFVTREIVQCDKCKGLGKNL----RSEDMCKKCHGKRVTPESKNLNVYIPRGSRHG 230
           RL PGF T E + C  C G GK        ++ CKKC G  VT ESK+L V +PRGSR  
Sbjct: 183 RLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLPRGSRQD 242

Query: 231 DRVVLKGEADEEPGKI-PGDLVFDIAENS---ASSSLERRGSDLYAKITISLSDALTGFE 286
           D++VLKGEAD+E GK   G+LVF I E +       L+R G DL   +T+SL++A+TGF 
Sbjct: 243 DQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFS 302

Query: 287 KEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHW 346
           K +  TLDGR+L+L++P G+V+RPGN ++I +EGWP+D   S  GD+YV + IEFPPD+W
Sbjct: 303 KTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS--GDLYVVVHIEFPPDNW 360

Query: 347 FSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELP 398
           FSERSD+  ++N+LP   +++A     A   DP NTET    +IV   EE+P
Sbjct: 361 FSERSDLTQVKNVLPGETNNNA-----AVEDDPGNTETVTNINIV---EEIP 404

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  387 bits (993), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 283/416 (68%), Gaps = 15/416 (3%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  LG+  +AT+ E+K+AYR LAL +HPDK+SDES R ESE KFKE++AAY++LS+E+
Sbjct: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63

Query: 62  KRQNYDTYGDTNGFSGDYSGFQDG------DFASFFGNFASNRYQDEYEAQSPPSPRTDD 115
           KR  YD YG  +  S  +  F D       DF +FF  + + RY    +A+   S +T D
Sbjct: 64  KRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF-RYGAGRYGQYEDAEQKTSQKTKD 122

Query: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHA--SACSQCEGHGVKQRL 173
             VP++L+ ++LY GKT +F+ KRNV+C++CEG G+R+RA H     C  C+G G K+R+
Sbjct: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182

Query: 174 RRLGPGFVTREIVQCDKCKGLGKNLRSE--DMCKKCHGKRVTPESKNLNVYIPRGSRHGD 231
            R+ PGF++RE V CD+C G G  +  +  D CKKCHGK V  E+  L +Y+PRG RH D
Sbjct: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242

Query: 232 RVVLKGEADEEPGKIPGDLVFDIAE-NSASSSLERRGSDLYAKITISLSDALTGFEKEVC 290
            + + G+AD E GK  GDLVF+I E     + LER+G+DL+  ITISL++ALTGF + V 
Sbjct: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302

Query: 291 TTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSER 350
            T D RLL++ +P G+V+RPGN+++  NEGWP+++ GS+FGD+YV+++IEFP D+W +E+
Sbjct: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINN-GSRFGDLYVKVNIEFPKDNWLNEK 361

Query: 351 SDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESE 406
           S++++++++LP   +SS +        DPANTE    + +++ +  LP YL++E +
Sbjct: 362 SELEAIKHILPGLKNSSNSH--QGDGDDPANTEDINSYYVIQDSSRLPDYLAQEGQ 415

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  373 bits (958), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 193/420 (45%), Positives = 267/420 (63%), Gaps = 25/420 (5%)

Query: 3   PYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEK 62
           PY+ LGV  DAT+ EI+KAYR+LAL++HPDK+ DE+ R+ SE  FKEV AAYE+LS+ E 
Sbjct: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132

Query: 63  RQNYDTYGDT------NGFSGDYSGFQDGDFASFFGNFASNR------YQDEYEAQSPPS 110
           +  YD YGD+      NGF  D   F D  F +FF  +   +      Y + ++   P S
Sbjct: 133 KSRYDMYGDSAFGSGGNGFPEDDHEFDD--FMNFFQQYQRQQHGPHASYSNRHQYGEPES 190

Query: 111 PRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRR--ARHASACSQCEGHG 168
            RT D+ +  ++T ++LY GKT+ FQ KR  +C  C GTG+R++   +   +C+ C G G
Sbjct: 191 KRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQG 250

Query: 169 VKQRLRRLGPGFVTREIVQCDKCKGLGKNLR--SEDMCKKCHGKRVTPESKNLNVYIPRG 226
            K+R+ RL  G++ ++   CD CKG G+  +  + D CK C GK +  E K+  VYIPRG
Sbjct: 251 FKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRG 310

Query: 227 SRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFE 286
           SRHGD   L   AD E GK  GD++  I E+S+ S LER+ +DL+  + ISL DALTGF 
Sbjct: 311 SRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFS 370

Query: 287 KEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHW 346
             VC T D R L++ VP G+V+RPGN+ +   EGWPL + G  FGDMYVQI+IEFP D+W
Sbjct: 371 TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSN-GDSFGDMYVQINIEFPKDNW 429

Query: 347 FSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESE 406
           F+E+S++ +L+N+LP  + S  T D      DP NTE  L +S++ S +ELP YL+EE E
Sbjct: 430 FNEKSEITALRNILP-GLKSKDTKD-----PDPLNTEDVLSYSVLHSHDELPDYLAEEKE 483

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  368 bits (945), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 202/446 (45%), Positives = 277/446 (62%), Gaps = 48/446 (10%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKV--SDESLRDESEIKFKEVAAAYELLSN 59
           D Y  LGVA +AT  +IKKAYR+LALQHHPDKV  S+   R+ SEIKFKE++AAYE+LS+
Sbjct: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62

Query: 60  EEKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSP-RTDDAHV 118
           E+KR +YD YG           +    F SFF     N  QDE  ++    P R+ D  +
Sbjct: 63  EDKRAHYDLYGSEEEQQRQQRQYDP--FESFF-----NFEQDEEPSRHYEDPKRSPDVKI 115

Query: 119 PIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASA------CSQCEGHGVKQR 172
           P+++T+QELYNGKT +F+ KRNV+C+ CEG G RRR            C  C+G G  ++
Sbjct: 116 PLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEK 175

Query: 173 LRRLGPGFVTREIVQCDKCKGLGKNL----RSEDMCKKCHGKRVTPESKNLNVYIPRGSR 228
           +R L PGF TRE  +C +C G GK+       ++ CKKCHG+ +  ESK L V +PRG R
Sbjct: 176 VRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLR 235

Query: 229 HGDRVVLKGEADEEPGK-IPGDLVFDIAENS---ASSSLERRGSDLYAKITISLSDALTG 284
            GD + +  EAD+E GK   GDL+F I E+        LER+GS+   ++ ISL++ALTG
Sbjct: 236 DGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTG 295

Query: 285 F-EKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPP 343
           F +K V  T DGR+L L +P G+V+RPGN ++I+ EGWPL+ + +KFGD+Y+ ++IEFPP
Sbjct: 296 FKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPP 355

Query: 344 DHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSE 403
           D+WF+E+SD+  ++N+LP+     +TSD    + DP NTE  LKF ++   E LP  L E
Sbjct: 356 DNWFTEKSDLTQIKNILPR-----STSDKTKLSDDPLNTELLLKFEVL---ETLPDTLKE 407

Query: 404 ESEPG---------------PQCAQQ 414
             + G               PQCAQQ
Sbjct: 408 GQDQGENNAESHGEYRGEGSPQCAQQ 433

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  367 bits (941), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 197/445 (44%), Positives = 279/445 (62%), Gaps = 46/445 (10%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  LGV   AT  EIKKAYR+LALQ+HPDKV D + R+E+EIKFKE+ +AYE+LS+EE
Sbjct: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62

Query: 62  KRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAHVPIR 121
           KR +YD YGD N    +Y+     DF +F  +      Q +Y++ +  + ++ D  +P++
Sbjct: 63  KRAHYDLYGDAN--ENEYNNQNANDFFNFETD------QPDYDSYAFDNDKSKDVKIPLK 114

Query: 122 LTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR------HASACSQCEGHGVKQRLRR 175
           L++QELYNGKT +FQ+KRN++C +CEG G RRR        H   C +C G G K+R R 
Sbjct: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174

Query: 176 LGPGFVTREIVQCDKCKGLG----KNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGD 231
           L PGFVT + ++C+ C G G    K    ++ CK CHGK +  E+K L V +PRG ++ D
Sbjct: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234

Query: 232 RVVLKGEADEEPGKI-PGDLVFDIAENSASSS---LERRGSDLYAKITISLSDALTGF-E 286
            + ++ EAD+E GK   GD++  I E++   S     R+G+D    +++SL++ALTGF +
Sbjct: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFKD 294

Query: 287 KEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHW 346
           K +  +LDGR+L L VP G+V+RPGN ++I  EGWP++ Q SKFGD+YV I IEFPPD+W
Sbjct: 295 KFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDNW 354

Query: 347 FSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEES- 405
           FSE+SD++ L+N+LP  ++    S       DP NTET   F I+   EELP  L+E + 
Sbjct: 355 FSEKSDIQLLRNVLPSGINGMMNS---WKIDDPLNTETVTTFDIL---EELPDTLNESNN 408

Query: 406 ----------------EPGPQCAQQ 414
                           E  PQC+QQ
Sbjct: 409 RSAYDTGDQSDANYDREGPPQCSQQ 433

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  310 bits (795), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/430 (42%), Positives = 246/430 (57%), Gaps = 44/430 (10%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D YE LGVA DAT +EIKK YR+LALQ+HPDK  DE  +  +EIKFK++ AAY+ LS+E+
Sbjct: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71

Query: 62  KRQNYDTYGDTNG-FSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAHVPI 120
           KR  YD   +    F  D++   DG++ S        RY+           R+ D  V +
Sbjct: 72  KRNEYDNKKNFEPYFESDFANNHDGNYNS--------RYR----------SRSKDIKVEL 113

Query: 121 RLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHAS------ACSQCEGHGVKQRLR 174
            L   ELYNGKTI+F   RN +C  C G G R +            C +C G G K    
Sbjct: 114 SLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKV 173

Query: 175 RLGPGFVTREIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYIPRGSRHG 230
           +L PGF T + V C  CKG GK  +     ++ CK C+GK +      + V IPRGS +G
Sbjct: 174 QLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNG 233

Query: 231 DRVVLKGEADEEPGKI-PGDLVFDIAENSASSS-LERRGSDLYAKITISLSDALTGFE-K 287
           D ++LKGEADEE GK   GDL+F+I E   S++ LER G+ L     ISL++A+TGFE K
Sbjct: 234 DNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENK 293

Query: 288 EVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWF 347
            +  T D R L L  P G+V+RPG+ + + NEGWP+D  G+ FG++YV ++IEFPPD+W 
Sbjct: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWI 353

Query: 348 SERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEES-- 405
           +E++D+  ++N+LP   +         +  DP N+E    F IVKS   LPQ   EE   
Sbjct: 354 NEKNDIIKIRNILPNEKTKR------NNIVDPINSEYISTFEIVKS---LPQEEGEEQTE 404

Query: 406 -EPGPQCAQQ 414
            +  P CAQ 
Sbjct: 405 HDTNPSCAQM 414

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  302 bits (774), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 175/427 (40%), Positives = 251/427 (58%), Gaps = 34/427 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV  DAT  EIK AYR+LAL+HHPDK  D+  ++ +EIKFKE+ AAYE+LS+ EK+
Sbjct: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70

Query: 64  QNYDTYGDTNGF--SGDYSGFQDGD------FASFFGNFASNRYQDEYEA-QSPPSPRTD 114
            +YD YGD NG   SG  +GF D D           G+   N +  EY+A +   S  + 
Sbjct: 71  SHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNSTSSK 130

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR----HASACSQCEGHGVK 170
           D  + I LT+++LY GK ++F  KR V+C +C G+G + + +    H   C  C G G K
Sbjct: 131 DIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSK 190

Query: 171 QRLRRLGPGFVTREIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYIPRG 226
           +RL+R GPG V  + V C+KC G GK  +     ++ C  C G  +  + + + V +  G
Sbjct: 191 ERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPG 250

Query: 227 SRHGDRVVLKGEADEEPGKIP-GDLVFDIAENSASSSLERR-----------GSDLYAKI 274
               D + +KG ADEE  K   GDL F + E     +LE++           G DLY  I
Sbjct: 251 HHFNDVITVKGMADEEIDKTTCGDLKFHLTEK--QENLEQKQIFLKNFDDGAGEDLYTSI 308

Query: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP-LDDQGSKFGDM 333
           TISLS+ALTGFEK +  T D RLL L V  G+VVRPG+ ++I NEGWP LD+   + GD+
Sbjct: 309 TISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDL 368

Query: 334 YVQIDIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFNA-SASDPANTETPLKFSIVK 392
           YV + IEFPPD+WF+E+S++ +++  LP + S ++ +  N    S+  N ET   F I+ 
Sbjct: 369 YVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRIIH 428

Query: 393 SAEELPQ 399
           + ++LP+
Sbjct: 429 T-DDLPE 434

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  297 bits (761), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 179/439 (40%), Positives = 250/439 (56%), Gaps = 41/439 (9%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y  LGV  DA   EIK AYR+LAL+HHPDK  D+  +D +EIKFKE+ AAYE+LS+ EK+
Sbjct: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70

Query: 64  QNYDTYGDTNGFS--GDYSGF------QDGDFASFFGNFASNRYQDEYEA-QSPPSPRTD 114
            +YD YGD NG +  G   GF         +     G    N + +EY+  +   S  + 
Sbjct: 71  SHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYEDNDSASSK 130

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR----HASACSQCEGHGVK 170
           D  + I LTM++LY GK +RF  KR VVC +C G+G + + R    H   C  C G G K
Sbjct: 131 DIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSK 190

Query: 171 QRLRRLGPGFVTREIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYIPRG 226
           +RL+R GPG V  + V C+KC G GK  +S    ++ C  C G  +  + + + V +  G
Sbjct: 191 ERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPG 250

Query: 227 SRHGDRVVLKGEADEEPGKIP-GDLVFDIAE-------------NSASSSLERRGSDLYA 272
               D + ++G ADEE GK   GDL F + E             N    ++E    D Y 
Sbjct: 251 HHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNME----DSYV 306

Query: 273 KITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP-LDDQGSKFG 331
            +TISLS+ALTGFEK +  T D RLL L +  G+V+RPG+ ++I NEGWP LDD   + G
Sbjct: 307 SVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCG 366

Query: 332 DMYVQIDIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIV 391
           D+YV I IEFPPD+WF+E+S++  ++  LP + SSS  S     A+D  N ET   F I+
Sbjct: 367 DLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCAS---GDANDLINNETVSNFQII 423

Query: 392 KSAEELPQYLSEESEPGPQ 410
            + ++LP+ + +  +P PQ
Sbjct: 424 HT-DDLPEGV-KTFKPKPQ 440

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  295 bits (754), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 168/428 (39%), Positives = 246/428 (57%), Gaps = 35/428 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV  DA+  EIK AYR+LAL+HHPDK  D++ ++ +EIKFKE+ AAYE+LS+ EK+
Sbjct: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70

Query: 64  QNYDTYGDTNGFSGDYS--GF------QDGDFASFFGNFASNRYQDEYEA-QSPPSPRTD 114
            +YD YGD  G +G     GF         +     G+   N +  EY+  +      + 
Sbjct: 71  SHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDTYEEDKCKSSK 130

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR----HASACSQCEGHGVK 170
           D  + I LT+++LY GK ++F+ KR +VC  C G+G + + +    H   C  C G G K
Sbjct: 131 DIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSK 190

Query: 171 QRLRRLGPGFVTREIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYIPRG 226
           +RL+R GPG V  + V C+KC G GK ++     ++ C  C G  +  + + + V +  G
Sbjct: 191 ERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPG 250

Query: 227 SRHGDRVVLKGEADEEPGKIP-GDLVFDIAENSASSSLERR-----------GSDLYAKI 274
               D + +KG ADEE  K   GDL F + E     +LE++             DLY   
Sbjct: 251 HHFNDVITIKGMADEELDKSACGDLKFHLVEK--QENLEQKQIFLKNFDEGSAEDLYTSA 308

Query: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP-LDDQGSKFGDM 333
           TISLS+ALTGFEK +  T D RLL L +  G+V+RPG+ ++I NEGWP +DD   + GD+
Sbjct: 309 TISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDL 368

Query: 334 YVQIDIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASD--PANTETPLKFSIV 391
           YV I IEFPPD+WF+E+S++ +++ +LP + S +  +  N    D  P N ET   F I+
Sbjct: 369 YVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNFQII 428

Query: 392 KSAEELPQ 399
            + EELP+
Sbjct: 429 -NMEELPE 435

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  290 bits (741), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 156/418 (37%), Positives = 251/418 (60%), Gaps = 46/418 (11%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVS-----DESLRDESEIKFKEVAAAYEL 56
           D Y  L V    TQDE+KK YR+LAL++HPDKV      ++ ++ E E+KFKE+ +AYE+
Sbjct: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70

Query: 57  LSNEEKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDA 116
           LS+EEKR+ YD              F+D +  S +G+  +  + ++          + D 
Sbjct: 71  LSDEEKRKQYDLQ----------KNFRDANQGSDYGDGINTAFGNQ---------TSKDI 111

Query: 117 HVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHA------SACSQCEGHGVK 170
            +P+++T+++LYNGK IR+  KRNV+C +C G G R R          + C  C+G G K
Sbjct: 112 SIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYK 171

Query: 171 QRLRRLGPGFVTREIVQCDKCKGLGKNLR----SEDMCKKCHGKRVTPESKNLNVYIPRG 226
           Q  +++ PGF T++ + C  C G G+  +    S++ C KC+GK +   S+++ V IPRG
Sbjct: 172 QVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRG 231

Query: 227 SRHGDRVVLKGEADEEPGKI-PGDLVFDIAE-NSASSSLERRG-SDLYAKITISLSDALT 283
           S   D +++  +AD+E GK   GDL+F + E +   ++L+R G  DL  ++TISL+DA+T
Sbjct: 232 SSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAIT 291

Query: 284 GF-EKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
           GF EK +  TLDGRLL+L +P+G+V+R G+ ++++ EGWPL+   ++ GD+Y++ +IEFP
Sbjct: 292 GFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351

Query: 343 PDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQY 400
            D+W SE +D+  ++NLLP A+S +          D         F+I  ++E++  Y
Sbjct: 352 ADNWNSEMNDIIKIRNLLP-AISDAKADILGDMPKDDI-------FNITMNSEDISNY 401

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  285 bits (728), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 162/435 (37%), Positives = 250/435 (57%), Gaps = 28/435 (6%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV  +A+  EIK AYR+LAL+HHPDK  D+  ++ +E KFKE+ AAYE+LS+ EK+
Sbjct: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70

Query: 64  QNYDTY-----GDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEA-QSPPSPRTDDAH 117
            +YD Y            GD       +     G   +N + +E+E  +   +  + D  
Sbjct: 71  SHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETTSSKDID 130

Query: 118 VPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR----HASACSQCEGHGVKQRL 173
           + +  TM++LY GK ++F+ KR ++C +C+G+G + + +    H   C  C G G K+RL
Sbjct: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190

Query: 174 RRLGPGFVTREIVQCDKCKGLGKNLR----SEDMCKKCHGKRVTPESKNLNVYIPRGSRH 229
           +R GPG V  + V C+KC G GK  +     ++ C  C    +  + + + V +P G   
Sbjct: 191 KRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHHF 250

Query: 230 GDRVVLKGEADEEPGK-IPGDLVFDIAE-----NSASSSLERRGS----DLYAKITISLS 279
            D V +KG ADEE  K + GDL+F + E           +++ G     DLY  IT+SLS
Sbjct: 251 NDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSLS 310

Query: 280 DALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP-LDDQGSKFGDMYVQID 338
           +ALTGFEK +  T D RLL L +  G+V+RPG+ ++I NEGWP LD    + GD+YV +D
Sbjct: 311 EALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVFVD 370

Query: 339 IEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFN-ASASDPANTETPLKFSIVKSAEEL 397
           IEFPPD+WF+E+S++ +++  LP + S  + +  N  S + P N+ET   F I+ S ++L
Sbjct: 371 IEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIHS-DDL 429

Query: 398 PQYLSEESEPGPQCA 412
           P+ + +   P PQ +
Sbjct: 430 PEGM-KTFNPKPQTS 443

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  270 bits (691), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 173/461 (37%), Positives = 245/461 (53%), Gaps = 56/461 (12%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKV-----SDESLRDESEIKFKEVAAAYE 55
           MD Y  LGV  DA+QDEIK+AYR+LAL+HHPDK       ++S  D  ++ FKEV AAY+
Sbjct: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60

Query: 56  LLSNEEKRQNYDT--------YGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQS 107
           +LS+   R  YD         YGD + F   +SGF  G        F S R    Y    
Sbjct: 61  VLSDASLRAEYDQKLAFEAQPYGDDD-FMNFFSGFNGGSHPGHRSGFDSGRGARRY---- 115

Query: 108 PPSPRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR---------HA 158
               ++DD  + +++   ELY GK + F  KR   C RC+GTG +  A            
Sbjct: 116 ----KSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFFW 171

Query: 159 SACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGK--NL-RSE-DMCKKCHGK---R 211
           + C  CEG GV+QRLR+L PGFVT E+++C +C G GK  NL +SE + C  C       
Sbjct: 172 NVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVG 231

Query: 212 VTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIP-GDLVFDIAE-NSASSSLERRGSD 269
           +  E+K + + I +G+  GD++VLKGEADE+      GDLV  I E       + R G D
Sbjct: 232 MVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYD 291

Query: 270 LYAKITISLSDALTGF-EKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGS 328
           L  K  I L+DA+ GF EK +  T DGR+LK     G+V+RP + VRI NEGWP  +  +
Sbjct: 292 LIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDAN 351

Query: 329 ------KFGDMYVQIDIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANT 382
                 K GD+YV +DI FPPD+W  E +D ++++N++P  ++   +S    S  +  N 
Sbjct: 352 DNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENI 411

Query: 383 ETPLKFSIVKSAEELPQY---LSEESEPG------PQCAQQ 414
                   + + +ELP++       ++ G      P C+QQ
Sbjct: 412 NVSEIVKEIPNCDELPKFQDTYDNTNDKGESPFWTPNCSQQ 452

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  265 bits (677), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 152/415 (36%), Positives = 235/415 (56%), Gaps = 29/415 (6%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
           ++PY+ LGV  D+T DEI+KAYR+LAL+ HPDKV D   +  +E+KFKE+  AYE+LSN 
Sbjct: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNG 63

Query: 61  EKRQNYDTYGDTNGFSGDYSGFQDGD-FASFFGNFASNRYQDEYEAQSPPSPRTDDAHVP 119
           E  +  +   +  G+     GF  GD F +FF N   N +      Q       +   + 
Sbjct: 64  EYVEEMEEEYEGQGY-----GFNFGDDFMNFF-NEGRNAHPMGGHPQREDESTNEATQIE 117

Query: 120 IRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARH------ASACSQCEGHGVKQRL 173
           I +T+++LYNGK ++FQ  RNV+C  C+G   RRR           +C++C+G G  +RL
Sbjct: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177

Query: 174 RRLGPGFVTREIVQCDKCKGLG----KNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRH 229
               P F   + + C KC G G    K    ++ CK CHG+ +  E + L V IPRGS +
Sbjct: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237

Query: 230 GDRVVLKGEADEEP-GKIPGDLVFDIAENSASSS------LERRGSDLYAKITISLSDAL 282
            + ++ K + DE+   +  GD+VF +  +   +       + + G+DL+  I I L +A+
Sbjct: 238 SNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAI 297

Query: 283 TGFEKEVCT-TLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEF 341
           +G +    T T D R+LKL +P G+V+RPG+ + I  EGWP    G++FGDM+V +++EF
Sbjct: 298 SGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEF 357

Query: 342 PPDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEE 396
           PPD+W SER+D+ +L N+LP    +  + D +A   D  N E    + I+K+ +E
Sbjct: 358 PPDNWISERNDITTLTNVLP----AGKSDDGHAQTGDANNAEFVKDYEILKATDE 408

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  222 bits (565), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 155/429 (36%), Positives = 226/429 (52%), Gaps = 45/429 (10%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV   AT  EIKKAYR+ AL++HPDK   E    E+  KFKE +AAYE+LS+ EKR
Sbjct: 8   YDILGVPVTATDVEIKKAYRKCALKYHPDKNPSE----EAAEKFKEASAAYEILSDPEKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQ---------DGDFASFFGNFASNRYQDEYEAQSPPSP-RT 113
             YD +G+ +G SG               D  F+ FFG            AQ P  P R 
Sbjct: 64  DIYDQFGE-DGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGG---------AQRPRGPQRG 113

Query: 114 DDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRL 173
            D    I  +++ELY G+T +    + ++C  CEG G ++ A     C+ C G G+K   
Sbjct: 114 KDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA--VKKCTSCNGQGIKFVT 171

Query: 174 RRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRV 233
           R++GP  + R   +CD C G G  +  +D CK C+GK+V  E K L V++  G + G R+
Sbjct: 172 RQMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRI 230

Query: 234 VLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTL 293
           V KGEAD+ P  IPGD+VF ++E     S +R G DL  +  I L  A+ G E  +   +
Sbjct: 231 VFKGEADQAPDVIPGDVVFIVSERP-HKSFKRDGDDLVYEAEIDLLTAIAGGEFAL-EHV 288

Query: 294 DGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDV 353
            G  LK+ +  G+V+ PG    I+ +G P+   G  +G++ ++  I+FP +H+ SE  ++
Sbjct: 289 SGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGG-YGNLIIKFTIKFPENHFTSE-ENL 346

Query: 354 KSLQNLLP----QAVSSSATSDFNASAS-DPANTETPLKFSIVKSAEELPQYLSEESE-- 406
           K L+ +LP     A+   AT D    A  DPA      K++  +++     Y S+E E  
Sbjct: 347 KKLEEILPPRIVPAIPKKATVDECVLADFDPA------KYNRTRASRGGANYDSDEEEQG 400

Query: 407 -PGPQCAQQ 414
             G QCA Q
Sbjct: 401 GEGVQCASQ 409

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  221 bits (563), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 153/429 (35%), Positives = 226/429 (52%), Gaps = 44/429 (10%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+  AT  EIKKAYR+ AL++HPDK   E    E+  KFKE ++AYE+LS+ EKR
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKYHPDKNPSE----EAAEKFKEASSAYEILSDSEKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQ---------DGDFASFFGNFASNRYQDEYEAQSPPSP-RT 113
             YD +G+ +G SG               D  F+ FFG            AQ P  P R 
Sbjct: 64  DVYDQFGE-DGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGG--------AQRPRGPQRG 114

Query: 114 DDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRL 173
            D    I  +++ELY G+T +    + ++C  CEG G ++ A     CS C G G+K   
Sbjct: 115 KDIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGA--VKKCSSCNGQGIKFVT 172

Query: 174 RRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRV 233
           R++GP  + R   +CD C G G  +  +D CK C+GK+V  E K L V++  G + G R+
Sbjct: 173 RQMGP-MIQRFQTECDVCHGTGDIVDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRI 231

Query: 234 VLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTL 293
           V KGEAD+ P  IPGD+VF ++E     S +R G DL  +  I L  A+ G E  +   +
Sbjct: 232 VFKGEADQAPDVIPGDVVFLVSERP-HKSFKRDGDDLVYEAEIDLLTAIAGGEFAL-EHV 289

Query: 294 DGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDV 353
            G  LK+ +  G+V+ PG    I+ +G P+   G  +G++ ++  ++FP +H F+   ++
Sbjct: 290 SGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIIKFTVKFPENH-FTAEENL 347

Query: 354 KSLQNLLP----QAVSSSATSDFNASAS-DPANTETPLKFSIVKSAEELPQYLSEESE-- 406
           K L+ +LP     A+   AT D    A  DPA      K++  +++     Y S+E E  
Sbjct: 348 KKLEEILPPRTVPAIPKKATVDECVLADFDPA------KYNRARASRGGANYDSDEEEQG 401

Query: 407 -PGPQCAQQ 414
             G QCA Q
Sbjct: 402 GEGVQCASQ 410

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  220 bits (561), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 153/429 (35%), Positives = 226/429 (52%), Gaps = 45/429 (10%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+  AT  EIKKAYR+ AL++HPDK   E    E+  KFKE ++AYE+LS+ EKR
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKYHPDKNPSE----EAAEKFKEASSAYEILSDSEKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQ---------DGDFASFFGNFASNRYQDEYEAQSPPSP-RT 113
           + YD +G+  G SG               D  F+ FFG            AQ P  P R 
Sbjct: 64  EVYDQFGE-EGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGG---------AQRPRGPQRG 113

Query: 114 DDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRL 173
            D    I  +++ELY G+T +    + ++C  CEG G ++ A     CS C G G+K   
Sbjct: 114 KDIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGA--VKKCSSCNGQGIKFVT 171

Query: 174 RRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRV 233
           R++GP  + R   +CD C G G  +  +D CK C+GK+V  E K L V++  G + G R+
Sbjct: 172 RQMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRI 230

Query: 234 VLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTL 293
           V KGEAD+ P  IPGD+VF ++E     + +R G DL  +  I L  A+ G E  +   +
Sbjct: 231 VFKGEADQAPDVIPGDVVFIVSERP-HKNFKRDGDDLVYEAEIDLLTAIAGGEFAL-EHV 288

Query: 294 DGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDV 353
            G  LK+ +  G+V+ PG    I+ +G P+   G  +G++ ++  I+FP +H F+   ++
Sbjct: 289 SGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYGG-YGNLVIKFTIKFPENH-FTTEENL 346

Query: 354 KSLQNLLP----QAVSSSATSDFNASAS-DPANTETPLKFSIVKSAEELPQYLSEESE-- 406
           K L+ +LP     A+   AT D    A  DPA      K++  +++     Y S+E E  
Sbjct: 347 KKLEEILPPRIVPAIPKKATVDECVLADFDPA------KYNRTRASRGGANYDSDEEEQG 400

Query: 407 -PGPQCAQQ 414
             G QCA Q
Sbjct: 401 GEGVQCASQ 409

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  219 bits (558), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 136/369 (36%), Positives = 200/369 (54%), Gaps = 32/369 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+P A++ EIKK YR+ AL++HPDK    +   E+  KFKE +AAYE+LS+ EKR
Sbjct: 8   YDILGVSPTASESEIKKGYRKAALKYHPDK----NPTAEAAEKFKECSAAYEVLSDPEKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQ----------DGDFASFFGNFASNRYQDEYEAQSPPSPRT 113
             YD YG+  G S    G            D  F+ FFG  AS R         P  P+ 
Sbjct: 64  DVYDQYGE-EGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQR---------PRGPQK 113

Query: 114 D-DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQR 172
             D    I  T++ELY G+T +    + ++C  CEG G   +A     CS C G G+K  
Sbjct: 114 GRDIKHEIAATLEELYKGRTAKLALNKQILCKSCEGRG--GKADAVKKCSSCGGQGIKFV 171

Query: 173 LRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDR 232
            +++GP  + R   +CD C G G  +  +  CK CHGK++  E K L V I  G + G R
Sbjct: 172 TKQMGP-MIQRFQTECDVCHGTGDIIDPKGRCKSCHGKKIANERKILEVKIEPGMKDGQR 230

Query: 233 VVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTT 292
           +V KGE+D+ P  IPGD+VF + E       +R G+DL     I L  A+ G E  +   
Sbjct: 231 IVFKGESDQAPDIIPGDVVFVVNEKP-HKHFQRSGNDLVYLAEIDLLTAIAGGEFAL-EH 288

Query: 293 LDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSD 352
           + G  LK+ +  G+V+ PG    I+ +G P+   G  +G++ +Q +I+FP +H F++ S+
Sbjct: 289 VSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGG-YGNLIIQFNIKFPENH-FTDESN 346

Query: 353 VKSLQNLLP 361
           +K L+ +LP
Sbjct: 347 LKKLEEILP 355

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  218 bits (554), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 138/395 (34%), Positives = 209/395 (52%), Gaps = 41/395 (10%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+P A+  EIKKAYR+ AL++HPDK   E    E+  KFKE ++AYE+LS+ EKR
Sbjct: 8   YDILGVSPTASDSEIKKAYRKQALKYHPDKNPSE----EAAEKFKEASSAYEVLSDSEKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQDGD--------FASFFGNFASNRYQDEYEAQSPPSP-RTD 114
             YD +G  +G SG+                F+ FFG   ++R         P  P R  
Sbjct: 64  DIYDQFG-QDGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASR---------PRGPQRGR 113

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLR 174
           D    I ++++ELY GKT +    + ++C  CEG G ++ A     CS C G G+K   R
Sbjct: 114 DIKHEISVSLEELYKGKTSKLALNKQILCKTCEGRGGKKGA--VKKCSSCNGQGIKFVTR 171

Query: 175 RLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVV 234
           ++GP  + R   +CD C G G  + ++D CK CHGK++  E K L V +  G ++G +VV
Sbjct: 172 QMGP-MIQRFQTECDVCHGTGDIIDAKDRCKDCHGKKIANERKILQVNVDPGMKNGQKVV 230

Query: 235 LKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLD 294
            KGEAD+ P  IPGD++F I+E       +R G DL  +  I L  A+ G E  +   + 
Sbjct: 231 FKGEADQAPDIIPGDVIFVISEK-PHKHFQRVGDDLIYEAEIDLLTAVAGGEFAL-EHVS 288

Query: 295 GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVK 354
           G  LK+ +  G+V+ P     ++ +G P+   G  +G++ ++  I+FP +H F++   +K
Sbjct: 289 GEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGG-YGNLIIKFSIKFPENH-FADEDTLK 346

Query: 355 SLQNLLP-----------QAVSSSATSDFNASASD 378
            L+ +LP             V     SD+N S  D
Sbjct: 347 KLEEILPARKPLPTFPKNAIVDDCVLSDYNPSRHD 381

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  217 bits (553), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 136/368 (36%), Positives = 199/368 (54%), Gaps = 30/368 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+  AT  EIKKAYR++AL+ HPDK   E    E+  KFKE ++AYE+LS+ +KR
Sbjct: 8   YDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSE----EAAEKFKEASSAYEVLSDADKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQ--------DGDFASFFGNFASNRYQDEYEAQSPPSP-RTD 114
             YD +G   G SG              D  F+ FFG            AQ P  P R  
Sbjct: 64  DTYDQFG-LEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAG---------AQRPRGPQRGR 113

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLR 174
           D    I +T++ELY GKT +    + ++C  CEG G ++ A     CS C G G+K   R
Sbjct: 114 DIKHEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGA--VKKCSSCNGQGIKFVTR 171

Query: 175 RLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVV 234
           ++GP  + R   +CD C G G  +  +D CK C+GK+V  E K L V++  G ++G +VV
Sbjct: 172 QMGP-MIQRFQTECDVCHGAGDIVDPKDRCKSCNGKKVASERKILEVHVDPGMKNGQKVV 230

Query: 235 LKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLD 294
            KGEAD+ P  IPGD+VF I E       +R G +L  +  + L  A+ G E  +   + 
Sbjct: 231 FKGEADQAPDVIPGDVVFVINEKP-HKHFQRSGDNLVYEAEVDLLTAIAGGEFAI-EHVS 288

Query: 295 GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVK 354
           G  LK+ +  G+V+ PG    ID +G P+   G  +G++ ++  ++FP  H F+   ++K
Sbjct: 289 GDWLKVAIVPGEVIAPGARKVIDGKGMPVAKYGG-YGNLIIKFTVKFPEPH-FTTEENLK 346

Query: 355 SLQNLLPQ 362
            L+ +LPQ
Sbjct: 347 KLEEILPQ 354

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  217 bits (552), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 135/366 (36%), Positives = 204/366 (55%), Gaps = 29/366 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+TLGV+P A+  EIKKAYR+ AL++HPDK   E    E+  KFKEV++AYE+LS+ +KR
Sbjct: 8   YDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSE----EAAEKFKEVSSAYEILSDSQKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQDGD-------FASFFGNFASNRYQDEYEAQSPPSP-RTDD 115
           + YD +G+  G SG+      G        F+ FFG     R         P  P R  D
Sbjct: 64  EVYDQFGE-EGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGR---------PRGPQRGRD 113

Query: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRR 175
               +  +++ELY G+T +    + ++C  CEG G +  A     CS C G G+K   R+
Sbjct: 114 IKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGA--VKKCSSCNGQGIKFVTRQ 171

Query: 176 LGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVL 235
           +GP  + R   +CD C G G  + ++D CK C+GK+V  E K L V I  G + G ++V 
Sbjct: 172 MGP-MIQRFQTECDVCHGTGDIIDAKDRCKSCNGKKVDNERKILEVRIEPGMKDGQKIVF 230

Query: 236 KGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDG 295
           KGEAD+ P  IPGD+VF I+E       +R G DL  +  I L  AL G +  +   + G
Sbjct: 231 KGEADQAPDVIPGDVVFVISEKP-HKHFQRAGDDLIYEAEIDLLTALAGGQFAL-EHVSG 288

Query: 296 RLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKS 355
             LK+ +  G+V+ PG    ++ +G P+   G  +G++ ++ +I+FP +H+ SE  ++K 
Sbjct: 289 DWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGG-YGNLLIKFNIKFPENHFTSEE-NLKK 346

Query: 356 LQNLLP 361
           L+ +LP
Sbjct: 347 LEEILP 352

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  216 bits (549), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/366 (36%), Positives = 203/366 (55%), Gaps = 28/366 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+P+A++ EIKK YR+ AL++HPDK    +  DE+  KFKE + AYE+LS+ +KR
Sbjct: 8   YDLLGVSPNASESEIKKGYRKAALKYHPDK----NPTDEAAEKFKECSGAYEVLSDSQKR 63

Query: 64  QNYDTYGD-------TNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSP-RTDD 115
           + YD YG+            G + GF D  F+ FFG   ++R         P  P R  D
Sbjct: 64  EIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASR---------PRGPQRGKD 114

Query: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRR 175
               I+ T++ELY G+T +    + ++C  CEG G +  A     CS C G GVK   R+
Sbjct: 115 IRHEIQNTLEELYKGRTAKLALNKQILCKGCEGRGGKEGA--VKKCSSCGGQGVKFVTRQ 172

Query: 176 LGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVL 235
           +GP  + R   +CD C G G  +  +D CK+C G +V  E K L V++  G R G +V  
Sbjct: 173 MGP-MIQRFQTECDVCHGSGDIIDPKDRCKECKGNKVANERKVLEVHVEPGMREGQKVTF 231

Query: 236 KGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDG 295
           KGEAD+ P  IPGD++F + E       +R G DL  +  + L  A+ G +  +   + G
Sbjct: 232 KGEADQAPDIIPGDVIFVVTEKP-HKHFKRSGDDLLYEAEVDLLTAIAGGDFAI-EHVSG 289

Query: 296 RLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKS 355
             LK+ +  G+V+ PG    ID +G P+   G  +G++ +   I+FP +H F++ + +K+
Sbjct: 290 DWLKVTIVPGEVISPGVRKVIDGKGMPVQKYGG-YGNLIITFKIKFPENH-FADEAKLKA 347

Query: 356 LQNLLP 361
           L+++LP
Sbjct: 348 LEDILP 353

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  215 bits (548), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 145/424 (34%), Positives = 222/424 (52%), Gaps = 35/424 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+  AT  EIKKAYR+ AL+ HPDK   E    E+  KFKE ++AYE+LS+ EKR
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKFHPDKNPSE----EAAEKFKEASSAYEVLSDSEKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQ---------DGDFASFFGNFASNRYQDEYEAQSPPSP-RT 113
           + YD +G+ +G SG               D  F+ FFG            AQ P  P R 
Sbjct: 64  EVYDQFGE-DGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGG---------AQRPKGPQRG 113

Query: 114 DDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRL 173
            D    I  +++ELY G+T +    + ++C  CEG G ++ A     C+ C G G+K   
Sbjct: 114 RDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA--VKKCTGCNGQGIKFVT 171

Query: 174 RRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRV 233
           R++GP  + R   +CD C G G  +  +D CK C+GK++  E K L V++  G + G ++
Sbjct: 172 RQMGP-MIQRFQTECDACHGTGDIVDPKDRCKSCNGKKIENERKILEVHVEPGMKDGQKI 230

Query: 234 VLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTL 293
           V KGEAD+ P  IPGD+VF ++E       +R G DL  +  I L  A+ G E  +   +
Sbjct: 231 VFKGEADQAPDVIPGDVVFLVSERP-HKHFKRDGDDLVYEAEIDLLTAIAGGEFAL-EHV 288

Query: 294 DGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDV 353
            G  LK+ +  G+V+ PG    I+ +G P+   G  +G++ V+  I+FP +H F+   ++
Sbjct: 289 SGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIVKFTIKFPENH-FTTEENL 346

Query: 354 KSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESE---PGPQ 410
           K L+ +LP   + +            A+ + P K++  +++     Y S+E E    G Q
Sbjct: 347 KKLEEILPPRATPTIPKKATVDECVLADFD-PAKYNRTRASRGGANYDSDEEEQGGEGVQ 405

Query: 411 CAQQ 414
           CA Q
Sbjct: 406 CASQ 409

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  213 bits (541), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 149/429 (34%), Positives = 220/429 (51%), Gaps = 42/429 (9%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+  A++ EIKKAYR+ AL++HPDK   E    E+  KFKE ++AYE+L + EKR
Sbjct: 8   YDLLGVSATASETEIKKAYRKTALKYHPDKNPSE----EAAEKFKEASSAYEVLMDAEKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQ------------DGDFASFFGNFASNRYQDEYEAQSPPSP 111
           + YD +G+  G SG  +               D  F+ FFG  AS           P  P
Sbjct: 64  EAYDQFGE-EGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASR----------PRGP 112

Query: 112 -RTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVK 170
            R  D    I +T++ELY G+T +    + ++C  CEG G +  A     C+ C G GVK
Sbjct: 113 QRGRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGA--VKKCTSCNGQGVK 170

Query: 171 QRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHG 230
              R++GP  + R   +CD C G G  +  +D CK C GK+V  E K L V++  G + G
Sbjct: 171 FITRQMGP-MIQRFQTECDACDGTGDIINPKDRCKACSGKKVANERKILEVHVDPGMKDG 229

Query: 231 DRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVC 290
            ++V KGEAD+ P  IPGD++F ++E        R   DL  +  I L  A+ G E  + 
Sbjct: 230 QKIVFKGEADQAPDIIPGDVIFVVSER-PHKHFRRDSDDLVYEADIDLLTAIAGGEFAI- 287

Query: 291 TTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSER 350
             + G  LK+++  G+V+ PG    I+ +G P+   G  FG++ V+ +I FP DH F+  
Sbjct: 288 EHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGG-FGNLLVKFNIVFPKDH-FTSL 345

Query: 351 SDVKSLQNLLPQAVSSSATSDFNASASDPANTE-TPLKFSIVKSAEELPQY-LSEESEPG 408
            ++K L+ +LP    +S  S   A   D   +E    K+S  +       Y   +E +PG
Sbjct: 346 ENMKKLEEILPPRKKTSIPS--KAHVDDCVLSEFDAAKYSSTRGGRSANSYDEDDEDQPG 403

Query: 409 P---QCAQQ 414
               QCA Q
Sbjct: 404 AEGVQCASQ 412

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  213 bits (541), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 132/366 (36%), Positives = 199/366 (54%), Gaps = 25/366 (6%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+P A+  EIKKAYR+ AL++HPDK   E    E+  KFKE +AAYE+LS++EKR
Sbjct: 8   YDILGVSPSASSSEIKKAYRKFALKYHPDKNPSE----EAAEKFKEASAAYEVLSDDEKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQ--------DGDFASFFGNFASNRYQDEYEAQSPPSPRTDD 115
           + YD +G      G              D  F+ FFG   +   +           R  D
Sbjct: 64  EMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQ------RGRD 117

Query: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRR 175
               +  T++ELY G+T +    + ++C  CEG G ++ A     CS C G GVK   R+
Sbjct: 118 IKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGA--VKKCSSCNGQGVKFVTRQ 175

Query: 176 LGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVL 235
           +GP  + R   +C+ C G G  +  +D CK C+ K+VT E K L V+I  G + G +VV 
Sbjct: 176 MGP-MLQRFQAECEVCHGTGDIIDPKDRCKTCNAKKVTNERKILEVHIEPGMKDGQKVVF 234

Query: 236 KGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDG 295
           KGEAD+ P  IPGD++F +++       +R G DL  +  I L  A+ G E  +   + G
Sbjct: 235 KGEADQAPDIIPGDVIFVVSQKP-HEHFQRAGDDLVYEAEIDLLTAIAGGEFAI-KHVSG 292

Query: 296 RLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKS 355
             LK+ +  G+V+ PG    I ++G P+   G  +G++ V+ +I+FPP+H+  E S +K 
Sbjct: 293 EWLKVAIVPGEVISPGARKIISDKGMPIPKYGG-YGNLIVKFNIKFPPNHFTDEES-LKK 350

Query: 356 LQNLLP 361
           L+ +LP
Sbjct: 351 LEEILP 356

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  209 bits (531), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 131/368 (35%), Positives = 193/368 (52%), Gaps = 30/368 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+PDA   +IKKAYR+ AL+ HPDK   E   D    KFKE+  AYE+LS+ +KR
Sbjct: 8   YDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAAD----KFKELTVAYEILSDSQKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQDGD---------FASFFGNFASNRYQDEYEAQSPPSPRTD 114
             YD  G+     G   G              F+ FFG   S R         P  P+  
Sbjct: 64  DIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQR---------PRGPQKG 114

Query: 115 -DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRL 173
            D    +  +++ELY G+T +    + ++C  CEG G   +A     CS C G G+K   
Sbjct: 115 RDIKHEMSASLEELYKGRTAKLALNKQILCKTCEGRG--GKAGAVKKCSSCNGQGIKFIT 172

Query: 174 RRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRV 233
           R++GP  + R   +CD C G G  +  +D CK C+GK++  E K L V+I  G + G ++
Sbjct: 173 RQMGP-MIQRFQAECDVCSGTGDIIDPKDRCKSCNGKKIDNERKILEVHIEPGMKDGQKI 231

Query: 234 VLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTL 293
           V +GEAD+ PG IPGD+VF I++       ER+G DL  +  + L  A+ G E  +   +
Sbjct: 232 VFQGEADQAPGIIPGDVVFVISQR-PHKHFERKGDDLLYQAEVDLLSAIAGGEFAI-EHV 289

Query: 294 DGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDV 353
            G  LK+ +  G+V+ PG    I+ +G P+   G  +G++ V   I FP +H+  E S +
Sbjct: 290 SGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGG-YGNLIVTFKINFPTNHFADEES-L 347

Query: 354 KSLQNLLP 361
           K L+ +LP
Sbjct: 348 KKLEEILP 355

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  209 bits (531), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 149/423 (35%), Positives = 220/423 (52%), Gaps = 35/423 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+P+A++ EIKK YR+ AL++HPDK   E    E+  KFKE +AAYE+LS+ +KR
Sbjct: 8   YDLLGVSPNASETEIKKGYRKQALKYHPDKNPSE----EAAEKFKECSAAYEVLSDSQKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQ-------DGDFASFFGNFASNRYQDEYEAQSPPSP-RTDD 115
           + YD YG+     G   GF        D  F+ FFG            AQ P  P R  D
Sbjct: 64  EVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAG---------AQRPSGPQRGRD 114

Query: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRR 175
               I+ T++ELY G+T +    + ++C  CEG G   +A     C+ C G G+K   R+
Sbjct: 115 IKHEIQNTLEELYKGRTAKLALNKQILCKTCEGRG--GKAGAVKKCTSCNGQGIKFVTRQ 172

Query: 176 LGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVL 235
           +GP  + R   +CD C G G  +  +D CK C GK++  E K L V++  G R G ++V 
Sbjct: 173 MGP-MIQRFQTECDVCHGSGDIIDPKDRCKDCKGKKIANERKVLEVHVEPGMREGQKIVF 231

Query: 236 KGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDG 295
           KGEAD+ P  IPGD++F + E       +R G DL  +  I L  A+ G E  +   + G
Sbjct: 232 KGEADQAPDVIPGDVIFVVVEK-PHKHFKRAGDDLLYEAEIDLLTAIAGGEFAI-QHVSG 289

Query: 296 RLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKS 355
             LK+    G+V+  G    I+ +G P+   G  +G++ V   I+FP +++ +E   +K 
Sbjct: 290 DWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGG-YGNLIVTFKIKFPENNFATE-DKLKE 347

Query: 356 LQNLLPQAVSSSATSDFNASASDPANTE-TPLKFSIVKSAEELPQYLSEESE---PGPQC 411
           L+N+LP     S  +   AS  +   ++  P K+S  K       Y S+E E    G QC
Sbjct: 348 LENILPARTPVSIPA--KASIDECVLSDFDPTKYSKSK-GRSGRSYDSDEEEQHGEGVQC 404

Query: 412 AQQ 414
           A Q
Sbjct: 405 ASQ 407

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  208 bits (529), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/366 (35%), Positives = 203/366 (55%), Gaps = 30/366 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+P A  ++IKKAYR+ AL+ HPDK   E    E+  KFKE+ +AYE+LS+ +KR
Sbjct: 8   YDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSE----EAAEKFKEITSAYEILSDSQKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQDGD-------FASFFGNFASNRYQDEYEAQSPPSPRTD-D 115
           + YD +G   G SG  +G   G        F+ FFG  +S           P  P+   D
Sbjct: 64  EVYDQFG-LEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSSR----------PRGPQKGRD 112

Query: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRR 175
               I  T+++L+ G+T +    + ++C  CEG G +  +     C+ C G G K   R+
Sbjct: 113 IRHEIPATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGS--VKKCTACSGQGFKFVTRQ 170

Query: 176 LGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVL 235
           +GP  + R  V+C+ C G G+ +  +  CK C GK+V  E K L V I  G + G R+V 
Sbjct: 171 MGP-MIQRFQVECESCHGAGEIIDPKGRCKVCSGKKVVNERKVLEVNIEPGMKDGQRIVF 229

Query: 236 KGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDG 295
           +GEAD+ PG IPGD+VF ++E       +R G+DL+    I L  A+ G +  V   + G
Sbjct: 230 QGEADQSPGIIPGDVVFVVSEQ-PHPVFKRDGNDLHYDAEIDLLSAIAGGQFAV-KHVSG 287

Query: 296 RLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKS 355
             LK+++  G+V+ PG+   I+ +G P+   G  +G++ ++ +I+FPP H F++   +K 
Sbjct: 288 EYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGG-YGNLLIKFNIKFPPAH-FTDDETLKK 345

Query: 356 LQNLLP 361
           L+ +LP
Sbjct: 346 LEEILP 351

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  208 bits (529), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/368 (34%), Positives = 196/368 (53%), Gaps = 30/368 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+PDA   +IKKAYR+ AL++HPDK   E   D    KFK++  AYE+LS+ +KR
Sbjct: 8   YDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAAD----KFKQITGAYEILSDSQKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQDGD---------FASFFGNFASNRYQDEYEAQSPPSPRTD 114
           + YD +G+     G   G              F+ FFG   ++R         P  P+  
Sbjct: 64  EMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASR---------PRGPQKG 114

Query: 115 -DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRL 173
            D    I  T++ LY G+  +    + V+C RCEG G   +A     C+ C G GVK   
Sbjct: 115 RDIRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRG--GKAGSVKKCTSCNGQGVKFVT 172

Query: 174 RRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRV 233
           R +GP  + R    C+ C G G  + + D CK C GK++  E K L V I  G +HG ++
Sbjct: 173 RHMGP-MIQRFQTTCEVCNGEGDVIPAADRCKDCDGKKIASERKILEVNIQPGMKHGQKI 231

Query: 234 VLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTL 293
           V +GEAD++PG+IPGD+VF + E        R G +L+ +  I L  A+ G +  +   +
Sbjct: 232 VFQGEADQQPGQIPGDVVFVVNEQE-HPRFVRNGDNLHYEAEIDLLTAIAGGQFAL-EHV 289

Query: 294 DGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDV 353
            G  LK+ +  G+V+ PG    I+ +G P+   GS +GD+ ++ +++FP  H F++   +
Sbjct: 290 SGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGDLLIKFNVKFPKSH-FADEEAL 347

Query: 354 KSLQNLLP 361
           K L+ +LP
Sbjct: 348 KKLEAILP 355

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  206 bits (525), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 133/395 (33%), Positives = 209/395 (52%), Gaps = 39/395 (9%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+ DA   +IKKAYR+ AL++HPDK    +   E+  KFK++ AAYE+LS+ +KR
Sbjct: 8   YDLLGVSADANDAQIKKAYRKAALKYHPDK----NPSSEAADKFKQMTAAYEILSDSQKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQDGD--------FASFFGNFASNRYQDEYEAQSPPSPRTD- 114
           + YD +G+     G       G         F+ FFG   ++R         P  P+   
Sbjct: 64  EVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASR---------PRGPQKGR 114

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLR 174
           D    I  T++ LY G+T +    + V+C  CEG G   ++     CS C GHGVK   R
Sbjct: 115 DIKHDISCTLENLYKGRTAKLALNKTVLCKSCEGRG--GKSGSVKKCSSCGGHGVKFVTR 172

Query: 175 RLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVV 234
           ++GP  + R    C+ C G G  +  +D C++C GK+++ E K L V I  G ++G +VV
Sbjct: 173 QMGP-MIQRFQTTCEACNGEGDVIDPKDRCRECSGKKISNERKILEVNIEPGMKNGQKVV 231

Query: 235 LKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLD 294
            +GEAD++PG+IPGD+VF + E        R G +L+ +  I L  A+ G +  +   + 
Sbjct: 232 FQGEADQQPGQIPGDVVFVVNEQE-HPKFVRNGDNLHYEAQIDLLTAVAGGQFAL-EHVS 289

Query: 295 GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVK 354
           G  LK+ +  G+V+ PG    I+ +G P+   GS +G++ ++ +++FP  H F+  +D+K
Sbjct: 290 GDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGNLLIKFNVKFPKSH-FASDADLK 347

Query: 355 SLQNLLP----------QAVSSSATSDFNASASDP 379
            L+ +LP            V     +DF  S  DP
Sbjct: 348 KLEEILPPRVLPGIPLKAEVEECVLADFEPSKHDP 382

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  203 bits (517), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/381 (35%), Positives = 201/381 (52%), Gaps = 30/381 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+P A   EIKKAYR+ AL++HPDK   E    E   KFKEV+AAYE+LS+ EKR
Sbjct: 8   YDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTE----EGAEKFKEVSAAYEILSDSEKR 63

Query: 64  QNYD---------TYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTD 114
           + YD               G  G + GF D  F+ FFG   +         +     R  
Sbjct: 64  EIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGA------GRPRGPQRGR 117

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLR 174
           D    I  T++ELY G+T +    + ++C  CEG G ++ A     CS C G GVK   R
Sbjct: 118 DIKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGA--VKKCSSCNGQGVKFVTR 175

Query: 175 RLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVV 234
           ++GP  + R   +CD C G G  +  +D CK C+ K+VT E K L V+I  G + G  +V
Sbjct: 176 QMGP-MIQRFQAECDVCSGTGDIIDPKDRCKTCNAKKVTNERKILEVHIEPGMKDGQNIV 234

Query: 235 LKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLD 294
            KGEAD+ P  IPGD++F +A+       +R G DL  +  I L  A+ G E  +   + 
Sbjct: 235 FKGEADQAPDVIPGDVIFVVAQK-PHKHFQRSGDDLVYEAEIDLLTAIAGGEFAL-EHVS 292

Query: 295 GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVK 354
           G  LK+ +  G+V+ PG+   I+ +G P+   G   G++ V   ++FP  H F++   +K
Sbjct: 293 GDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGG-HGNLIVHFTVKFPQKH-FADEDSLK 350

Query: 355 SLQNLLPQ----AVSSSATSD 371
            L+ +LP     ++ ++AT D
Sbjct: 351 KLEEILPPRKKISIPANATVD 371

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  202 bits (513), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 129/368 (35%), Positives = 190/368 (51%), Gaps = 31/368 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV  DA   +IKK YR+ AL+ HPDK       D    KFKE+  AYE+LS+ +KR
Sbjct: 8   YDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAAD----KFKELTVAYEVLSDSQKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQDGD---------FASFFGNFASNRYQDEYEAQSPPSPRTD 114
             YD  G+     G   G              F+ FFG  AS           P  P+  
Sbjct: 64  DIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASR----------PRGPQKG 113

Query: 115 -DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRL 173
            D    +  +++ELY G+T +    + V+C  CEG G +  A     C+ C G GVK   
Sbjct: 114 RDIKHEMSASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGA--VKKCASCNGQGVKFIT 171

Query: 174 RRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRV 233
           R++GP  + R   +CD C G G  +  +D CK C+GK++  E K L V+I  G + G ++
Sbjct: 172 RQMGP-MIQRFQAECDACNGTGDIVDPKDRCKTCNGKKIDNERKILEVHIEPGMKDGQKI 230

Query: 234 VLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTL 293
           V +GEAD+ PG IPGD++F I++       ER+G +LY +  + L  A+ G E  +   +
Sbjct: 231 VFQGEADQAPGVIPGDVIFVISQRP-HKHFERKGDNLYYQAEVDLLSAIAGGEFAI-EHV 288

Query: 294 DGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDV 353
            G  LK+ +  G+V+ PG    I+ +G P+   G  FGD+ V   + FP +H+  E S +
Sbjct: 289 SGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGG-FGDLIVTFKVNFPTNHFADEES-L 346

Query: 354 KSLQNLLP 361
           K L+ +LP
Sbjct: 347 KKLEEILP 354

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  199 bits (506), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 128/366 (34%), Positives = 195/366 (53%), Gaps = 26/366 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+  AT+ EIKKAYR+ AL++HPDK    +   E+  KFKEV++AYE+LS+ EKR
Sbjct: 8   YDLLGVSVSATEIEIKKAYRKSALKYHPDK----NPSAEAAEKFKEVSSAYEVLSDSEKR 63

Query: 64  QNYDTYGDTNGFSGDYSGFQ--------DGDFASFFGNFASNRYQDEYEAQSPPSPRTDD 115
           Q YD +G+     G              D  F+ FFG             +     R  D
Sbjct: 64  QVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGG-------GRPRGPQRGRD 116

Query: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRR 175
               I +T++ELY G+T +    + ++C  C G G +  A     CS C G G K   R+
Sbjct: 117 IKHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGA--VKKCSSCNGQGYKFVTRQ 174

Query: 176 LGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVL 235
           +GP  + R   +C+ C G G  +  +D CK C+GK+V  E K L V++  G + G ++V 
Sbjct: 175 MGP-MIQRFQTECEACAGTGDIIDPKDRCKSCNGKKVANERKILEVHVDPGMKDGQKIVF 233

Query: 236 KGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDG 295
           KGEAD+ P  IPGD++F ++E     + +R G DL  +  I L  A+ G E  +   + G
Sbjct: 234 KGEADQAPDVIPGDVIFVVSEKP-HKNFQRVGDDLVYEAEIDLLTAVAGGEFSL-EHVSG 291

Query: 296 RLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKS 355
             LK+ +  G+V+ PG    ++ +G P+   G  +G++ V   I FPP+H F+   ++K 
Sbjct: 292 DWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGG-YGNLLVTFKINFPPNH-FTSDENLKK 349

Query: 356 LQNLLP 361
           L+ +LP
Sbjct: 350 LEEILP 355

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  199 bits (506), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 134/370 (36%), Positives = 205/370 (55%), Gaps = 28/370 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ +GV+P A   +IKKAYR+ AL++HPDK   E    E+  KFKE+++AYE+LS+ +KR
Sbjct: 8   YDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTE----EAAEKFKEISSAYEILSDSQKR 63

Query: 64  QNYD--------TYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTD- 114
           + YD          G   G  G + GF D  F+ FFG            +  P  P+   
Sbjct: 64  EMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGG--------SSRPRGPQKGR 115

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLR 174
           D    I  T++ELY G+T +    + ++C  CEG G   +A     CS C G G K   R
Sbjct: 116 DIRHEISATLEELYKGRTAKLALNKQILCKSCEGRG--GKAGAVKKCSSCNGQGFKFITR 173

Query: 175 RLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVV 234
           ++GP  + R   +CD C G G  + ++D CK C+GK++  E K L V+I  G + G ++V
Sbjct: 174 QMGP-MIQRFQAECDACNGTGDIIDAKDRCKACNGKKIANERKILEVHIEPGMKDGQKIV 232

Query: 235 LKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLD 294
            +GEAD+ P  +PGD+VF ++E        R+G DLY +  + L  A+ G E  V   + 
Sbjct: 233 FQGEADQAPDVVPGDVVFVVSERP-HERFNRKGDDLYYEAEVDLLTAIAGGEFAV-QHVS 290

Query: 295 GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVK 354
           G  LK+++  G+V+ PG    I+ +G P+   G  FG++ V+  I+FPP+H F++ + +K
Sbjct: 291 GDWLKVEIVPGEVIAPGATKIIEGKGMPVQKYGG-FGNLIVKFKIKFPPNH-FADEASLK 348

Query: 355 SLQNLLPQAV 364
            L+N+LP  V
Sbjct: 349 QLENILPPRV 358

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  182 bits (461), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 116/369 (31%), Positives = 192/369 (52%), Gaps = 40/369 (10%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+  A++ +IKKAYR  AL+HHPDK       +ES++KF+++  AYE+L +E KR
Sbjct: 10  YDILGVSASASRQDIKKAYRVNALKHHPDK---NGHSEESKLKFQQICKAYEILKDERKR 66

Query: 64  QNYDTYG--DTNGFSGDYSGFQD------GD-FASFFGNFASNR--YQDEYE-------A 105
           + YD +G  D + +  + + +Q+      GD FA FFG  ++    + D+         A
Sbjct: 67  EMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFGKRQGA 126

Query: 106 QSPPS----PRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASAC 161
            + PS    PR  D    ++ T++E+Y+GK  +   KR  +C +C+G G       AS C
Sbjct: 127 HTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEG----GLKASQC 182

Query: 162 SQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNV 221
             C G G++   +R GP  V      C  C G G  ++ +D+C+ C+G+    E +  ++
Sbjct: 183 YTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFMKQKDICRDCNGQGCIRERRIFDI 241

Query: 222 YIPRGSRHGDRVVLKGEADEEPGK-------IPGDLVFDIAENSASSSLERRGSDLYA-K 273
            + +G  +G  VVL GEADE  G        IPGD++  + +    +    R + L    
Sbjct: 242 EVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQLPHKAFWRHRDASLVLDH 301

Query: 274 ITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDM 333
             + L  +L G    V +   G+LLK+ V  G++++PG    ++  G P    G +FG++
Sbjct: 302 CKVDLKTSLCGGPVWVDSHPSGKLLKIDVLPGEILKPGAIKCVEGMGMP--KSGGRFGNL 359

Query: 334 YVQIDIEFP 342
           Y++ D+ FP
Sbjct: 360 YIRFDVAFP 368

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  172 bits (436), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 192/377 (50%), Gaps = 51/377 (13%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y+TLGVA +A++ EIKKAYR  AL+HHPDK       ++S++KF+++  AYE+L +++
Sbjct: 8   DLYDTLGVAANASRQEIKKAYRLKALKHHPDK---NGHSEQSKLKFQQICKAYEILGDDK 64

Query: 62  KRQNYDTYGDTNGF-----SGDY---SGFQDGDFAS------------------FFGNFA 95
           KR+ YD +G  +       + +Y   SG   GD  S                  FFG  +
Sbjct: 65  KREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMDFFG--S 122

Query: 96  SNRYQDEYEAQSPPSPRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRA 155
           S  ++ +   +S P    D  H  ++ T++E+YNGK  +   KR  +C  C+G G ++  
Sbjct: 123 SRGFRAQGSRRSAPQRGPDIKHY-LKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSKK-- 179

Query: 156 RHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPE 215
             A++C  C G G++ + +R GP   T     C  C G G  ++  D+C  CHG+    E
Sbjct: 180 --ATSCYACRGKGMQTQTKRQGPIMQTWSST-CGTCGGSGTIVKPSDICNGCHGQGWVRE 236

Query: 216 SKNLNVYIPRGSRHGDRVVLKGEADE-------EPGKIPGDLVFDIAENSASSSLERRGS 268
            K   + + +G  +G  VV+  EADE           IPGD++  I E     SL +RG 
Sbjct: 237 RKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVII-ILEQLPHRSL-KRGH 294

Query: 269 D---LYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDD 325
           D   L ++  + L  +L G    V +   G++LK+ V  G++++PG    + + G P   
Sbjct: 295 DSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQSMGMPKSK 354

Query: 326 QGSKFGDMYVQIDIEFP 342
            G  +GD++++  + FP
Sbjct: 355 GG--YGDLFIKFKVIFP 369

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  167 bits (422), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 125/410 (30%), Positives = 191/410 (46%), Gaps = 90/410 (21%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ L V   AT+ EIKKAYR+ AL+HHPDK +  +   ES   F++++ AYE LSN  KR
Sbjct: 8   YDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSA---ESIKLFQDISHAYETLSNSNKR 64

Query: 64  QNYDTYGD-------------------TNGFSGDYSGFQDGD-FASFFG----------- 92
           + YD YG                    +NG S  +S    GD FA FFG           
Sbjct: 65  ELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSSGTGASG 124

Query: 93  -----------------NFASNRYQD-----EYEAQSPPSPRTDDAHVPIRLTMQELYNG 130
                            +F  N   D      +E  S P  R +     ++  + +L++G
Sbjct: 125 FGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMASGPGIRHN-----LKCNLYDLFHG 179

Query: 131 KTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDK 190
           K  +    R  +C RC+G G ++    A+ C  C+G G+    +R+GP   T +   C +
Sbjct: 180 KRAKLALNRTRLCQRCQGYGGKK----ATQCRGCQGTGLFTTTKRMGPMVQTWQTT-CKE 234

Query: 191 CKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEADE----EPGK- 245
           C G GK +RS+D C +C G     E K  +V +  G R+G+ ++L GEADE    E GK 
Sbjct: 235 CSGTGKYIRSKDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGEADEVINTEYGKE 294

Query: 246 --IPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTL---------- 293
             IPGD++  I       S  R     Y  +       L  FE ++ T+L          
Sbjct: 295 RVIPGDVIITIQLTRNEESNMR-----YKYLVHDHDLILDNFEVDLKTSLCGGTIIIEDH 349

Query: 294 -DGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
             G   K++V  G++++PG    ++N+G P+D  G+ FG++Y++  ++FP
Sbjct: 350 PSGNPFKIEVLSGELLKPGCIKCVENKGMPVDSNGN-FGNLYIRFRVKFP 398

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score =  167 bits (422), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 136/466 (29%), Positives = 201/466 (43%), Gaps = 74/466 (15%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+TL V+PDAT  EIK+AY+ +AL++HPDK       ++++ KF+EV  AYE+L++E+KR
Sbjct: 8   YDTLKVSPDATISEIKRAYKVMALKYHPDK---NHHSEDAKNKFQEVCKAYEILADEDKR 64

Query: 64  QNYDTYGDTNGFS----------------GDYSGFQDGD-FASFFGNFASN--------- 97
             YD YG  + ++                   S    GD FA FF NF  +         
Sbjct: 65  VMYDRYGTVDEYALQEQEESQGAPTTSSSFFGSSMSPGDLFAQFFDNFPGHSSFGRSPFG 124

Query: 98  -----------------------RYQDEYEAQSPPSPRTDDAHVPIRLTMQELYNGKTIR 134
                                             PS   D  H  ++ T+ ELY+GK  +
Sbjct: 125 SAFGGGSPFGGGFPFGSSFSHHSGGGRSSYGGGRPSRGPDIKH-NLKCTLAELYDGKITK 183

Query: 135 FQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGL 194
               R  +C  C+G G  RR      C  C G G +   RR GP  V      C  C GL
Sbjct: 184 LGLNRRRMCQSCQGQGSLRR----RTCKTCRGQGQQTETRRTGP-MVQTWTQTCPDCNGL 238

Query: 195 GKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGK-------IP 247
           G   +  D+C +C G+    E K  +V + +G  HG  +VL GEADE           IP
Sbjct: 239 GTYTKQADVCHECRGESYIKERKIFDVEVSKGMCHGQTIVLPGEADELIKTSFGVEKVIP 298

Query: 248 GDLVFDI--AENSASSSLERRGSDL-YAKITISLSDALTGFEKEVCTTLDGRLLKLKVPL 304
           GD+V  I   ++S    + R G DL     +I LS +L G +  +     G+LLK+ +  
Sbjct: 299 GDVVITIDQVKDSKFHRVNRYGCDLVMGSCSIDLSTSLCGGDIYIDGHPSGKLLKVSIVP 358

Query: 305 GQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP----PDHWFSERSDVKSLQNLL 360
           G+++ P     I+  G P        G++Y+Q  +E+P    PD     +S +  LQ+  
Sbjct: 359 GELIGPNCLKSIEGMGMPKYGHDGGKGNLYIQFQLEYPVGLEPDTIGRLQSVL--LQDKY 416

Query: 361 PQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESE 406
            Q    S  +       D A  +  +  S V S EE+    +  +E
Sbjct: 417 VQNQIQSQNAKVYQKLGDCAEVDEHVLSSFVPSMEEITSRTASSNE 462

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  166 bits (419), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 115/373 (30%), Positives = 181/373 (48%), Gaps = 42/373 (11%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ L V+P+A+  EI+KAYR LAL+HHPDK    +  +ES+ KF EV  AYE+L +E+KR
Sbjct: 8   YDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEILIDEKKR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQ-DGDFASFFGNF----------ASNRYQDEYEAQSPPS-- 110
             YD YG  +  +   S  Q D   +SFF             A + +   ++  S PS  
Sbjct: 65  SLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMSSPSFG 124

Query: 111 ---PRTDDAHVP-----IRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACS 162
               +    H P     ++ T+  LY GK  +    R  VC  C+G G    +     C 
Sbjct: 125 GKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRG----SMKVRTCK 180

Query: 163 QCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVY 222
            C G G + R R++GP   T     C  C G+G   +  D+C+ C G+    E K  +V 
Sbjct: 181 ACRGRGQQSRSRQMGPMMQTW-TQTCSDCNGMGTFTKDSDVCRDCEGEGCIRERKIFDVE 239

Query: 223 IPRGSRHGDRVVLKGEADE-------EPGKIPGDLVFDIAE--NSASSSLERRGSDLYAK 273
           +  G   G +++L GEADE           IPGD++  I +  +     + R G DL  +
Sbjct: 240 VKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDPKFQRVNRNGCDLMVR 299

Query: 274 -ITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSK--- 329
              I L  +L G +  +    +G+L+ + +  G++++P +F  I+N G P  ++      
Sbjct: 300 NCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNHFKSIENLGMPRYEEKRAPEG 359

Query: 330 FGDMYVQIDIEFP 342
           +G++Y+Q  +EFP
Sbjct: 360 YGNLYIQFQVEFP 372

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  161 bits (408), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 178/350 (50%), Gaps = 18/350 (5%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  LGV+  A   +IK AYR+L+ ++HPDK  D+   D +  KF EV  AYE+LS+ E
Sbjct: 20  DYYSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDD---DSAHNKFIEVGEAYEVLSDPE 76

Query: 62  KRQNYDTYG----DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAH 117
           KR+ YD YG      NG  G   G + G F   F  F           +     R  +  
Sbjct: 77  KRKIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGGGQRQRRRARGHNLE 136

Query: 118 VPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLG 177
               LT++E Y G +I F    N  C  CEG+G   +    + C  C+GHGV  ++ R+G
Sbjct: 137 TREELTLKEYYRGTSIDFNLNLNDFCEHCEGSG--SQDGKVTKCPDCKGHGVVVQIVRMG 194

Query: 178 PGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLK 236
           P  VT++I Q C KC+G G  ++++  CK CHG++V  + K+ +V +P G+      V +
Sbjct: 195 P--VTQQIQQMCGKCQGRGSTIKNK--CKHCHGEKVVRKPKSFHVDVPPGAPRNFVEVKQ 250

Query: 237 GEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALT-GFEKEVCTTLD 294
           GE+D+ P    GDL    +E S  +    RRG DL+    +SL +AL  G+E+E+     
Sbjct: 251 GESDKGPDFDAGDLFIKFSETSRDNLGYRRRGDDLFRTEALSLREALKGGWEREIEFLDA 310

Query: 295 GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPD 344
            R +K+K     V   G   RI   G P   + +KFGD+Y+   +  P D
Sbjct: 311 KRKVKIKRASSMVTNNGEIERIPGFGMP--KEHNKFGDLYIDYVVIVPDD 358

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  162 bits (410), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 120/403 (29%), Positives = 186/403 (46%), Gaps = 48/403 (11%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV P  +  E+KK+Y+  AL++HPDK       + S+ +F+++A AY +L +E  R
Sbjct: 8   YDVLGVQPGVSAAELKKSYKLAALRYHPDK---NGHSEASKQRFQQIADAYRVLGDERLR 64

Query: 64  QNYDTYGDTNGFSGDYS-----------GFQDGD-FASFFGN------FASNRYQDEYEA 105
           + YD YG  +   G+ +           G   GD FA FFG+      FA         A
Sbjct: 65  KIYDRYGTVD--EGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGESGASSA 122

Query: 106 QSPPSPRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCE 165
           +     R  D    +R T++ELY GK +R    R  +C  C G G  R    AS C+ C 
Sbjct: 123 RCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGGSR----ASTCTACS 178

Query: 166 GHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPR 225
           G G+  + +R G   V      C  C G G  ++  D C  C G     E K   V I  
Sbjct: 179 GQGICSQTKRQGS-LVQTWSSTCRVCSGSGTIVKDCDTCTSCGGAGYLRERKVFEVEIRP 237

Query: 226 GSRHGDRVVLKGEADEEP----GK---IPGDLVFDIAENSASSSLERRGSD--LYAKITI 276
           G R G  VV  GEADE      GK   +PGDL   I E + ++  + RG    L  ++ +
Sbjct: 238 GMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRYQCRGDANLLLTELHV 297

Query: 277 SLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQ 336
            L  +L G    +     G+L++L++  G+++ PG    I++ G P  D  S++G ++++
Sbjct: 298 DLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHPDDPSQYGHLFIK 357

Query: 337 IDIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDP 379
             ++FP           K+L +    A++ +  +D N     P
Sbjct: 358 FHVDFP-----------KTLADSTITAIAQALDADTNVRTRTP 389

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  155 bits (393), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 116/369 (31%), Positives = 178/369 (48%), Gaps = 40/369 (10%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+TL ++ DAT  EIKKAYR  AL+ HPDK    +  ++S+ KF+E+  AYE+L + +K+
Sbjct: 10  YDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRKFQEICKAYEILGDAKKK 66

Query: 64  QNYDTYGDTN----------GFSGDYSGFQDGD-FASFFG----NFASNRYQDEY----- 103
             YD YG  +          G     SG   GD F+ FFG      AS+ + D+      
Sbjct: 67  LLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDTMFFTG 126

Query: 104 --EAQSPPSPRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASAC 161
              +Q   S   D  H  +R +++ELY+GK  + +  R  +C  C+G G       +SAC
Sbjct: 127 KKNSQRRVSRGPDIKH-NLRCSLEELYHGKKSKLRLDRTRLCKTCKGNG----GTSSSAC 181

Query: 162 SQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNV 221
             C G G   + RR GP  V      C  C G G  +R +D+C +C G+    E K   +
Sbjct: 182 RACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFVRRKDVCSECKGQGCIKERKIFEI 240

Query: 222 YIPRGSRHGDRVVLKGEADE----EPGK---IPGDLVFDIAENSASSSLERRGSDLYAK- 273
            +  G  HG  +VL  EADE      GK    PGD++  + +           +DL    
Sbjct: 241 EVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQVKHPLFQIHNDTDLVMND 300

Query: 274 ITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDM 333
             + L  +L G E  +     G  LK++V  G++++PG    +++ G P   Q   FG++
Sbjct: 301 CHVDLKTSLCGGEVLIENHPCGSALKIEVLPGEILKPGCVKCVESMGMP-HPQSQGFGNL 359

Query: 334 YVQIDIEFP 342
           Y++  ++FP
Sbjct: 360 YIRFQVDFP 368

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  153 bits (386), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 114/355 (32%), Positives = 178/355 (50%), Gaps = 24/355 (6%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y+ LGV  DA   EIK AYR+L+ ++HPDK   +   +E+  KF EV  AY++LS+ E
Sbjct: 22  DYYKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGD---EEAHNKFIEVGEAYDVLSDSE 78

Query: 62  KRQNYDTYG--------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRT 113
           KR  YD YG        +     G  S F D  F  F   F  N +            R 
Sbjct: 79  KRNIYDQYGADAIKNGGNGQRPGGGGSPFHD-PFEMFEKMFNGNPFGGAARGGPGGRGRP 137

Query: 114 DDAHVPIR--LTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQ 171
              ++ +R  +++ + YNG+  ++  + N  C +C GTG   +    + C  C+G GV  
Sbjct: 138 RGQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTG--SKDGKVTRCPDCQGRGVIV 195

Query: 172 RLRRLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHG 230
           ++ ++G   +T++I   CD+C G G+ +++   C  CHG +V    K   V +P G++  
Sbjct: 196 QVIQMG--IMTQQIQHVCDRCSGSGEIIKNP--CPHCHGHKVAKMDKEFTVKLPNGAQRN 251

Query: 231 DRVVLKGEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALT-GFEKE 288
              +  GEA++      GDL+F+  ENS ++    RRG  LY    +S+ +AL  G+E+E
Sbjct: 252 YVDIKHGEAEKGADFDAGDLMFEFRENSMNNMGYRRRGDHLYRTEVLSVQEALKGGWERE 311

Query: 289 VCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP-LDDQGSKFGDMYVQIDIEFP 342
           +      + +KLK    QVV  G    +   G P L+ QG KFGD+++   I  P
Sbjct: 312 LEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLFIDYVILMP 366

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  152 bits (384), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 121/361 (33%), Positives = 182/361 (50%), Gaps = 33/361 (9%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  LGV   A+  +IK AYR+L+ ++HPDK   +   +++  +F EV  AYE LS+ E
Sbjct: 21  DYYAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGD---EDAHNRFIEVGEAYEALSDPE 77

Query: 62  KRQNYDTYG--------DTNGFSGDYSGFQD--GDFASFFGNFASNRYQDEYEAQSPPSP 111
           KR+ YD +G        D  G  G   GF D    F   FG  A +R+            
Sbjct: 78  KRKIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGG--GGQRRKQ 135

Query: 112 RTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHG-VK 170
           R     V   L +++ Y+G +I F    N  C+ C+G+G   +      C QC G G V 
Sbjct: 136 RGQSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSG--SQDGKVEKCGQCGGRGMVV 193

Query: 171 QRLRRLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRH 229
           Q +R+   GF+T++I Q C KC+G G+ ++++  CK CHG +V  ++K+ +V +P G+  
Sbjct: 194 QVIRQ---GFITQQIQQMCQKCEGRGEVIKNK--CKTCHGSKVVKKNKSFHVDVPAGAPR 248

Query: 230 GDRVVLKGEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALTGFEKE 288
               V++GEA++ P   PGD+   + E+   +    RRG DL+    +SL++AL G    
Sbjct: 249 DFVAVIRGEAEKSPDTEPGDIYVKVVESPVQNMGYRRRGPDLFRTEVLSLTEALKGGWVR 308

Query: 289 VCTTLDGRLLKLKVPL----GQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPD 344
               LD    K KV L    G  V+ G    I   G PL+  G+K+GD+YV   I  P  
Sbjct: 309 ELEFLDS---KKKVVLSRSKGTPVQHGEVECIKGFGMPLES-GTKYGDLYVDYVIVMPSK 364

Query: 345 H 345
           +
Sbjct: 365 Y 365

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score =  155 bits (392), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 125/433 (28%), Positives = 187/433 (43%), Gaps = 88/433 (20%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y++L V   A+  EIKKAYR  AL++HPDK    +  +ES+ KF+E+  AYE+L +   R
Sbjct: 8   YDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEVLKDNHLR 64

Query: 64  QNYDTYGDTN------------------------------GFSGDYSGFQD---GD-FAS 89
             YD YG T+                              GF  +   F D   GD FA 
Sbjct: 65  SLYDQYGTTDEALIQEQYQQQAYPQTQTQRQQSSVFNPSAGFDTEGMSFPDLSPGDLFAQ 124

Query: 90  FFG-------NFASNRYQDEYEAQSPP--------------SP--------------RTD 114
           FF        N A N +   +   S P              SP              R  
Sbjct: 125 FFSSSASSSSNGAKNSFNFSFNGSSTPNFPFGNGSGMNSLYSPSSKYNTTGEEHHLNRGP 184

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLR 174
           D    ++ T++ELY GKT +    R  +C+ C+G G  R+      C  C+G G++ + +
Sbjct: 185 DIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLRKY----TCKPCKGQGIQTQTK 240

Query: 175 RLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVV 234
           R+GP  V      C  C G G  ++++D+C++C G     + K L V +  GS H   +V
Sbjct: 241 RMGP-LVQSWSQTCADCGGAGTFVKNKDICEQCQGLGFIKQRKILQVTVQPGSCHNQLIV 299

Query: 235 LKGEADEEPGK--------IPGDLVFDIAENSASSSLERRGSDLYA-KITISLSDALTGF 285
           L GE DE            IPGD+V  I              DL   K  + L  +L G 
Sbjct: 300 LTGEGDEVISTKGGGREKVIPGDVVITILRLKDPKFQITDNCDLICKKCEVDLMTSLCGG 359

Query: 286 EKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP--LDDQGSKFGDMYVQIDIEFPP 343
              +     G+L+K+ +  G+V++PG F  ++N G P  ++   S FG +YV+ D+ +P 
Sbjct: 360 IVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHLYVKFDVTYPE 419

Query: 344 DHWFSERSDVKSL 356
                  + VKS+
Sbjct: 420 RLEPENAAKVKSI 432

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score =  154 bits (390), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 121/430 (28%), Positives = 192/430 (44%), Gaps = 84/430 (19%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y++L V   A+  EIKKAYR  AL++HPDK    +  +ES+ KF+E+  AYE+L +   R
Sbjct: 8   YDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEILKDNRLR 64

Query: 64  QNYDTYGDTN-----------------------GFSGDYSGFQD---GD-FASFFGNFAS 96
             YD YG T+                        F  +   F D   GD FA FF + A+
Sbjct: 65  ALYDQYGTTDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFFNSSAT 124

Query: 97  ---------------------------NRYQDEYEAQSPPSPRTDDAHVP--------IR 121
                                      +   + Y + +  +   +D H+         ++
Sbjct: 125 PSSNGSKSSFNFSFNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLDRGPDIKHNLK 184

Query: 122 LTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFV 181
            T++ELY GKT +    R  +C+ C+G G  ++      C  C+G G++ + RR+GP  V
Sbjct: 185 CTLKELYMGKTAKLGLNRTRICSVCDGHGGLKKC----TCKTCKGQGIQTQTRRMGP-LV 239

Query: 182 TREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEADE 241
                 C  C G G  ++++D+C++C G     E K L V +  GS H   +VL GE DE
Sbjct: 240 QSWSQTCADCGGAGVFVKNKDICQQCQGLGFIKERKILQVTVQPGSCHNQLIVLTGEGDE 299

Query: 242 --------EPGKIPGDLVFDIAENSASSSLERRGSDLYA-KITISLSDALTGFEKEVCTT 292
                       IPGD+V  I      +      S+L   K  I    +L G    +   
Sbjct: 300 VISTKGGGHEKVIPGDVVITILRLKDPNFQVINYSNLICKKCKIDFMTSLCGGVVYIEGH 359

Query: 293 LDGRLLKLKVPLGQVVRPGNFVRIDNEGWP--LDDQGSKFGDMYVQIDIEFPPDHWFSER 350
             G+L+KL +  G++++PG F  +++ G P  ++   S FG +YV+ D+ +P      E 
Sbjct: 360 PSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSGFGHLYVKFDVTYPER---LEP 416

Query: 351 SDVKSLQNLL 360
            + K +QN+L
Sbjct: 417 ENAKKIQNIL 426

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score =  153 bits (386), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 121/422 (28%), Positives = 177/422 (41%), Gaps = 91/422 (21%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y++L V   A+  EIKKAYR  AL++HPDK    +  +ES+ KF+E+  AYE+L +   R
Sbjct: 8   YDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKDNHLR 64

Query: 64  QNYDTYGDTN---------------------------GFSGDYSGFQDGD---------- 86
             YD YG T+                           G     +GF  G           
Sbjct: 65  SLYDQYGTTDEVLIQEQHQAQAQAQAQQQQQQQQQQAGIFSSSAGFDTGGVTFPDLSPGS 124

Query: 87  -FASFFG------------------------NFASNRYQDEYEAQSPPSP---------- 111
            FA FF                         NF           QSPPS           
Sbjct: 125 LFAQFFNSSASASSNGSKNNFSFSFNGSSTPNFPFGNGGGMNNLQSPPSKYGSDDDEHHL 184

Query: 112 -RTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVK 170
            R  D    ++ T++ELY GKT +    R  +C+ CEG G  ++      C  C+G GV+
Sbjct: 185 NRGPDIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQKY----TCKTCKGQGVQ 240

Query: 171 QRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHG 230
            + + +GP  V      C  C G G  + S+D+C++C G     + K L V +  G+ H 
Sbjct: 241 TQTKCMGP-LVQSWSQTCADCGGAGIFVESKDICQQCQGLGFIKQRKILQVTVQPGTSHN 299

Query: 231 DRVVLKGEADEEPGK-------IPGDLVFDIAE-NSASSSLERRGSDLYAKITISLSDAL 282
             +VL GE DE   K       IPGD+V  I         +    S +Y K  + L  +L
Sbjct: 300 QLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLKDPKFQVTDNCSLIYKKCKVDLMTSL 359

Query: 283 TGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP--LDDQGSKFGDMYVQIDIE 340
            G    +     G+L+KL +  G+V++P  F  I+  G P  ++   S FG +YV+ D+ 
Sbjct: 360 CGGIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRSGFGHLYVKFDVS 419

Query: 341 FP 342
           +P
Sbjct: 420 YP 421

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  149 bits (377), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 179/364 (49%), Gaps = 23/364 (6%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y+ LG+A DAT  EIK AYR+L+ + HPDK       +++  KF EV  AYE+LS+ +
Sbjct: 21  DYYQILGIAKDATDKEIKSAYRQLSKKFHPDK---NPGNEDAHQKFIEVGEAYEVLSDPQ 77

Query: 62  KRQNYDTYG------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDD 115
           KRQ +D +G         G  G  + F D  F  F   F                PR  +
Sbjct: 78  KRQTFDQFGADAVKNGGQGQPGGGAQFHD-PFDIFEQMFGGQGGGGNPFGGQRQKPRGPN 136

Query: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRR 175
                 +++++ Y G  + F    N +C+ C GTG        + C  C+G GV  +L R
Sbjct: 137 IMAREEISLKDYYTGYELNFTLNVNDLCDHCHGTG--SDDGKLTPCPDCQGRGVIIQLIR 194

Query: 176 LGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVV 234
           +G   +T++I Q C +C G G+  + +  C+KCHG +V P+ K   V +P+G++     V
Sbjct: 195 MG--MMTQQIQQMCGRCGGKGQLFKKQ--CRKCHGNKVMPQKKEFQVKLPKGAKRHYMDV 250

Query: 235 LKGEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALT-GFEKEVCTT 292
             GEAD+ P    GDL+ +  EN  S+    RRG +LY    +++++AL  G+++E+   
Sbjct: 251 KHGEADKNPDLEAGDLLIEFNENDKSNMGYRRRGQNLYRTEVLNVTEALYGGWQREIPFL 310

Query: 293 LDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSK--FGDMYVQIDIEFPPDHWFSER 350
              + L++      VV  G   RI   G P   +G K  FGD+++   +   P  W    
Sbjct: 311 DPKKKLQVGRESNIVVSHGEVERIPGFGMPT-GKGKKETFGDLFIDY-VVIMPKQWNKVS 368

Query: 351 SDVK 354
           S ++
Sbjct: 369 SSIR 372

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score =  152 bits (384), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 177/416 (42%), Gaps = 85/416 (20%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y++L V   A+  EIKKAYR  AL++HPDK    +  +ES+ KF+E+  AYE L +   R
Sbjct: 8   YDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKDNHLR 64

Query: 64  QNYDTYGDTN---------------------------GFSGDYSGFQD---GD-FASFFG 92
             YD YG T+                           GF      F D   GD FA FF 
Sbjct: 65  SLYDQYGTTDEVLIQEQQAQTQSQRQRQQASVFSPSAGFGTGGMSFPDLSPGDLFAQFFN 124

Query: 93  ------------------------NFASNRYQDEYEAQSPPS-----------PRTDDAH 117
                                   NF            SPPS            R  D  
Sbjct: 125 SSASASSNGSKDNFNFSFDGSTTPNFPFGSGGGMNNLYSPPSRYNSEGEGRHLNRGPDIK 184

Query: 118 VPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLG 177
             ++ T++ELY GKT +    R  +C  C+G G  ++     AC  C+G GV+ +  R+G
Sbjct: 185 HNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLKKY----ACKTCKGQGVQTQTNRMG 240

Query: 178 PGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKG 237
           P  V      C  C G G  + S+D+C++C G     + K L V +  GS H   +VL G
Sbjct: 241 P-LVQSWSQTCADCGGAGIFVESKDICQQCQGLGFVKQRKILQVAVQPGSCHNQLIVLTG 299

Query: 238 EADEEPGK--------IPGDLVFDIAE-NSASSSLERRGSDLYAKITISLSDALTGFEKE 288
           E DE            IPGD+V  I         +    + +Y K  + L  +L G    
Sbjct: 300 EGDEVISSKGGGHEKIIPGDVVITILRLKDPRFQIVDDYNLIYKKCKVDLMTSLCGGVVY 359

Query: 289 VCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP--LDDQGSKFGDMYVQIDIEFP 342
           +     G+L+KL +  G+V++PG F  ++N G P  ++   S FG MYV+ ++ +P
Sbjct: 360 IEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHMYVKFEVTYP 415

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  145 bits (366), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 181/352 (51%), Gaps = 23/352 (6%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKV-SDESLRDESEIKFKEVAAAYELLSNE 60
           D Y  LGV+ DA++ EIK AYR+L+ ++HPDK   DE+    +  KF EV  AYE+LS++
Sbjct: 24  DYYAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGDET----AHHKFIEVGEAYEVLSDD 79

Query: 61  EKRQNYDTYGD---TNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAH 117
           +KRQ Y+ YG     NG  G   G           +   + ++  + AQ     R     
Sbjct: 80  QKRQIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFGAQRGGGGRGRPRG 139

Query: 118 VPIR----LTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRL 173
             +     +T++E Y G ++ F    N  C+ C+GTG +      + CS C+G GV  ++
Sbjct: 140 HNLEAREEITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDGK--TTRCSDCQGQGVVIQI 197

Query: 174 RRLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDR 232
            R+GP  +T++I Q C  C+G G+ ++++  CK+CHG +V  ++K+ +V +P G+     
Sbjct: 198 IRMGP--ITQQIQQMCGACQGKGQIIKNK--CKQCHGAKVERKTKHFHVDVPAGAPRDFV 253

Query: 233 VVLKGEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALTGFEKEVCT 291
            V  GEAD+ P    GD+    +E+S  +    RRG  L+    ++L +AL G  K    
Sbjct: 254 DVKNGEADKGPDFDAGDVYIKFSESSRDNMGYRRRGVHLHRTEVLTLKEALQGGWKREIE 313

Query: 292 TLD-GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
            LD  + +KL    G  VR G   R+   G P D  G  FGD++V   +  P
Sbjct: 314 FLDHTKKVKLHRDAGVPVRHGETERVPGFGMPKD--GRHFGDLFVDYVVLTP 363

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  144 bits (362), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/414 (28%), Positives = 185/414 (44%), Gaps = 68/414 (16%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ L V  DA+Q  IKKA+   AL+ HPDK    +  +ES+ +F+E++ AYE+LS+ + R
Sbjct: 8   YDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQFQEISKAYEVLSDPKSR 64

Query: 64  QNYDTYGDTNG--------FSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSP---- 111
           + YD YG T+         F    S +  G+    FG  A + +   + +     P    
Sbjct: 65  EMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGDAGPSFGF 124

Query: 112 --RTD------------DAHVP--------IRLTMQELYNGKTIRFQAKRNVVCNRCEGT 149
             R D            D H+         ++  + +LY GK  +    R  VC+ C+G 
Sbjct: 125 GSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRVCSSCDGK 184

Query: 150 GVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHG 209
           G  R A    +C  C+G G   + RR+GP  V      C+ C G G  ++  D+C  C G
Sbjct: 185 GGMRVA----SCRTCKGQGEVVKTRRVGP-MVQTMSSTCNSCHGTGTFIKDSDLCFVCKG 239

Query: 210 KRVTPESKNLNVYIPRGSRHGDRVVLKGEADE----EPGKI---PGD--LVFDIAENSAS 260
             V+ E K  +V +  G  H   +VL GEADE      G I   PGD  +V D+ +N+  
Sbjct: 240 SGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKVQPGDVVIVIDLVKNTQF 299

Query: 261 SSLERRGSDLYAK-ITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNE 319
             +     DL  K   + L   L G E  +     G+++KL +   ++++P  F  ++  
Sbjct: 300 QVVNDH--DLVLKNCEVPLKTCLCGGEIMIEGHPSGKIIKLSIIPNELLKPSCFKTVEGL 357

Query: 320 GWPLDDQGSK-----------FGDMYVQIDIEFPPDHWFSERSDVKSLQNLLPQ 362
           G P     S            +G++YVQ  ++FP      E + +  LQ +L Q
Sbjct: 358 GMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFPER---LEDTTITKLQEILEQ 408

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score =  143 bits (360), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 112/388 (28%), Positives = 187/388 (48%), Gaps = 59/388 (15%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y  L + P A+Q +IKKAYR  AL++HPDK ++ES  +ES+ KF++++ AY +L +E +R
Sbjct: 8   YNALNIPPTASQSDIKKAYRVQALRYHPDK-NNES--EESKKKFQDISEAYSILRDENQR 64

Query: 64  QNYDTYGD------------TNGFSGDYSGFQDGD-FASFFGNFASNRYQ---------- 100
           + YD YG             TN    D  G    D F+ FF     N  Q          
Sbjct: 65  KMYDKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQSNSSPPFGFP 124

Query: 101 --------------------DEYEAQSPPSPRTDDAHVPIRLTMQELYNGKTIRFQAKRN 140
                               D +  +S P  +  D +  ++ T+++LY GK  + + +R+
Sbjct: 125 FNSSRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKRSKLRLERS 184

Query: 141 VVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRS 200
            +C+ C+G G  +R    S C+QC G G      RLGP   T     C+ C G G  + S
Sbjct: 185 KLCSICKGDGGVKR----SMCNQCHGDGNITETTRLGPMLQTFTHT-CNICNGNGWVIIS 239

Query: 201 EDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGK---IPGDLVFDIAEN 257
           ++ C+ C+G     E K  +V I  G + G ++V   E DE   K   IPG+++  I E 
Sbjct: 240 QETCQGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRRVIPGNVIIHINE- 298

Query: 258 SASSSLER--RGSDLYA-KITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFV 314
              +  +R   G DLY     I L  +L G    +    + +L+K+ +  G+++  G+  
Sbjct: 299 IEDNKFKRVNDGQDLYYWNYEIDLFTSLCGGVIYIKGHPNNKLIKVDILPGEIIESGSVK 358

Query: 315 RIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
            +++ G P  ++G+++G +Y+Q  +++P
Sbjct: 359 GVESLGMP-KNKGNEYGILYIQFQVKYP 385

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  141 bits (356), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 100/350 (28%), Positives = 171/350 (48%), Gaps = 18/350 (5%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y+ L +  DAT  +I+ AYR+L+ ++HPDK  ++   +++  KF EV  AYE+LS+ E
Sbjct: 22  DYYKILELDKDATDKDIRSAYRQLSKKYHPDKNPND---EDAHHKFIEVGQAYEILSDPE 78

Query: 62  KRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSP----RTDDAH 117
           KRQ YD +G       +  G     F   F  F               +P    R    +
Sbjct: 79  KRQRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQQRQRGQN 138

Query: 118 VPIR--LTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRR 175
           V  R   +++  YNG  ++F    N +C+ C G+G       ++ C  C+G GV  ++ R
Sbjct: 139 VVARESTSLKNYYNGYVLKFSINLNDICDHCHGSG--SNDGKSTKCPDCQGRGVTVQVIR 196

Query: 176 LGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVV 234
           +  G +T++I Q C KC G G+ +++   CK CHG +V  + K+  + +P G+       
Sbjct: 197 M--GMMTQQIQQVCGKCGGKGQIIKNP--CKTCHGSKVVQKPKDFEIELPAGAPRKFVHA 252

Query: 235 LKGEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALT-GFEKEVCTT 292
             G AD+ P    GD+  +  EN   +    RRG  LY    ++ ++AL  G+E+++   
Sbjct: 253 EHGAADKHPDYDSGDVYIEFTENDKDNMGYRRRGPHLYRTEVLNATEALYGGWERQLAFL 312

Query: 293 LDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
              +++ +K    ++++ G   RI   G PL +    FGD+++   +  P
Sbjct: 313 DSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYVVVMP 362

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  141 bits (355), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 114/371 (30%), Positives = 177/371 (47%), Gaps = 32/371 (8%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  L +  DAT+ EIK AYR+L+ ++HPDK    +  +E+  KF EV  AY++LS+ E
Sbjct: 23  DYYAILEIDKDATEKEIKSAYRQLSKKYHPDK---NAGSEEAHQKFIEVGEAYDVLSDPE 79

Query: 62  KRQNYDTYG---------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPR 112
           K++ YD +G                   GF D  F  F   F                 R
Sbjct: 80  KKKIYDQFGADAVKNGGGGGGPGGPGAGGFHD-PFDIFERMFQGGHGGPGGGFGQRQRQR 138

Query: 113 TDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQR 172
                V  +L++++ Y+G +I F    N  C+ C G+G        + C  C+G GV  +
Sbjct: 139 GPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSG--SADGKLAQCPDCQGRGVIIQ 196

Query: 173 LRRLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGD 231
           + R+G   +T++I Q C +C G G+ +++E  CK CHGK+VT ++K  +V +P G+    
Sbjct: 197 VLRMG--IMTQQIQQMCGRCGGTGQIIKNE--CKTCHGKKVTKKNKFFHVDVPPGAPRNY 252

Query: 232 RVVLKGEADEEPGKIPGDLVFDIAE-NSASSSLERRGSDLYAKITISLSDALTGFEKEVC 290
                GEA++ P    GDLV +  E ++ +    RRG +LY    +S ++AL G  +   
Sbjct: 253 MDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAAEALYGGWQRTI 312

Query: 291 TTLD-GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSE 349
             LD  + +KL  P   VV  G    +   G P   +G  +GD+Y+   +  P       
Sbjct: 313 EFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKG--YGDLYIDYVVVMP------- 363

Query: 350 RSDVKSLQNLL 360
               KS QN+L
Sbjct: 364 -KTFKSGQNML 373

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  141 bits (355), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 108/351 (30%), Positives = 170/351 (48%), Gaps = 20/351 (5%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  LG+  DA+  EIK +YR+L+ + HPDK   +   +E+  KF E+  AYE+LS+ E
Sbjct: 21  DYYAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGD---EEAHHKFIEIGEAYEVLSDPE 77

Query: 62  KRQNYDTYG-------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTD 114
           KR+ +D YG          G  G   GF D  F  F   F                PR  
Sbjct: 78  KRKIFDQYGADALKNGGPGGPGGGGGGFND-PFDIFEQMFNRGGGGGGGGFGRMQRPRGH 136

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLR 174
           +  V  +L+++E Y G T+ F    N +C+ C+GTG        + CS C+G GV  ++ 
Sbjct: 137 NLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTG--SADGKVAKCSDCQGRGVVIQVI 194

Query: 175 RLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRV 233
           R+G   +T++I Q C +C G G  +++   CK CHG +V  + K  +V +P G+      
Sbjct: 195 RMG--MMTQQIQQMCGRCGGKGSVIKNH--CKTCHGSKVVKKQKPFHVEVPPGAARHYTE 250

Query: 234 VLKGEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALTG-FEKEVCT 291
              GE+D+      GD+  +  E + ++    RRG  LY    +S  +AL G +++EV  
Sbjct: 251 TRSGESDKGADFDAGDVFIEFNEKTTNNLGYRRRGPHLYRTEVLSAREALKGDWQREVEF 310

Query: 292 TLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
             + + +K+      VV  G   RI   G P  +    FGD++++  +  P
Sbjct: 311 LDEKKKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGDLFIEYVVVMP 361

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  143 bits (361), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 112/405 (27%), Positives = 179/405 (44%), Gaps = 74/405 (18%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ L ++ +A   +IKKAYR LAL++HPDK    +  +ES++ F++++ AYE+L + EKR
Sbjct: 8   YDILNISSNADAKDIKKAYRVLALKYHPDK---NNHSEESKVMFQKISEAYEVLIDVEKR 64

Query: 64  QNYDTYGDTNG----------------------------------FSGDYSGFQDGDFAS 89
           + YD YG  +                                   F  D +      FA 
Sbjct: 65  KLYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLAASAGDLFAQ 124

Query: 90  FFGNFASN---------------RYQDEYE-AQSPPSPRTDDAHVPIRLTMQELYNGKTI 133
           FFGN   N                + + +E   S    R  D    +R ++++LY GK  
Sbjct: 125 FFGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVELERGPDIKHTLRCSLKDLYYGKKT 184

Query: 134 RFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKG 193
           + +  R  +C  C G G  ++++    C  C G G   + RR+GP   T     C  C+G
Sbjct: 185 KLRLDRTRLCVLCMGQGSMKKSK----CFTCNGLGSLTQTRRMGPMIQTFS-QSCPDCQG 239

Query: 194 LGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEADE----EPGK---I 246
            G  ++  D C+ C G     E K  +V I  G  +G  ++L GEADE      GK   I
Sbjct: 240 SGMFVKRSDTCQSCSGNGYVEERKIFDVEIQPGMVNGQVIILPGEADEVVNTSFGKQKVI 299

Query: 247 PGDLVFDIAENSASSSLERRGSDLYA-KITISLSDALTGFEKEVCTTLDGRLLKLKVPLG 305
            GD+V  I +   ++       DL     +++LS AL G    +     G L+K+ +  G
Sbjct: 300 AGDIVLTINQLKDNNFEVINDCDLLLDNFSVNLSKALCGGTIFISNHPSGNLIKIDIIPG 359

Query: 306 QVVRPGNFVRIDNEGWPLDDQ--------GSKFGDMYVQIDIEFP 342
           +++ PG    + N G P +++            G++YV+ DI+FP
Sbjct: 360 EILSPGVIKTVANLGMPKEEKRDPDVSIINISKGNLYVKFDIKFP 404

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  140 bits (353), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 167/350 (47%), Gaps = 24/350 (6%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  LGV   A++ EIK AYR+L+ ++HPDK       DE+   F EV  AY++LS+ E
Sbjct: 20  DYYAILGVDKQASEKEIKSAYRQLSKKYHPDK---NPGNDEAHHHFIEVGEAYDVLSDPE 76

Query: 62  KRQNYDTYG------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDD 115
           KRQ YD +G         G  G  +GF D  F  F   F SN Y      ++   PR  +
Sbjct: 77  KRQIYDRHGADALKNGHPGGPGGGNGFHD-PFDLFEQMFGSNMYN-----RARGKPRGQN 130

Query: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRR 175
             V   ++++  Y G    F    N +C+ C+G+G          C  C G G   ++ R
Sbjct: 131 LQVNHDISLKTFYLGTEFEFTLNLNDICDACDGSG--SEDGKTETCPDCGGSGQIMKVFR 188

Query: 176 LGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVV 234
            GP  + + + Q C +C+G G+ ++   +CKKC G +V  +SK     +  G       V
Sbjct: 189 AGP--IEQRVRQPCSRCQGRGQLIKH--VCKKCKGVKVVQKSKVFTAKVEPGMERNHIHV 244

Query: 235 LKGEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALT-GFEKEVCTT 292
           ++G++++ P   PGDL     E+   S    RRG+ LY    +S  +AL  G+E+ +   
Sbjct: 245 MQGQSEKHPDIEPGDLYQYFRESEKDSMGYRRRGNTLYRTEILSFKEALQGGWERNIEFF 304

Query: 293 LDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
              + L L  P+G  V+ G    I + G P+     KFGD+ +   I  P
Sbjct: 305 DKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDLIIDYVILLP 354

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score =  142 bits (359), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 121/393 (30%), Positives = 182/393 (46%), Gaps = 64/393 (16%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YETL V   AT  +IKKAY++LAL++HPDK    +  ++S+ KF+ V  AYE+L++++ R
Sbjct: 8   YETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSKTKFQAVCQAYEILNDKQSR 64

Query: 64  QNYDTYGDTN-------------------GFSGDYSGFQDGD-FASFFGN---------- 93
             YD  G T+                   G      G   GD FA FF N          
Sbjct: 65  AIYDALGITDEALIEQQKKQQQQQHQQQGGMEFPPMGMSPGDLFAQFFDNNNNAAKQPSQ 124

Query: 94  --------FASNRYQDEYEAQSPPSPRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNR 145
                   F S  +    +A  P     D  HV ++ T++ELYNGK  +    R  +C  
Sbjct: 125 SQMHAYPNFKSESHVTNGKADHPLHRGPDIKHV-LKCTLRELYNGKMAKLALNRTRLCLP 183

Query: 146 CEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCK 205
           C G G  +R    + C  C+G G + + RR+GP  V      C  C G G  ++  D+C 
Sbjct: 184 CNGFGGLQR----TTCESCQGDGFQTQTRRMGP-MVQTWTQTCASCDGAGCFIKPNDVCP 238

Query: 206 KCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEADE-------EPGKIPGDLVFDIA--- 255
            CHG+    E K  +V +  G + G  V+++GEADE       +   IPGD+V  I    
Sbjct: 239 HCHGEGFIRERKIFHVEVKPGFQDGKDVIMQGEADEIMLNNLVKEKVIPGDVVITIKQSR 298

Query: 256 -ENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFV 314
            EN+    +  +   L     + L  +L G E  +     G+L+KL +  G++++P  F 
Sbjct: 299 DENNCFQMINNKDL-LMNGCPVDLVTSLCGGEVYIDNHPSGKLIKLDIIPGEILKPNCFK 357

Query: 315 RIDNEGWPL-----DDQGSKFGDMYVQIDIEFP 342
            I+  G P      DD   + GD+Y+Q  I++P
Sbjct: 358 IIEGLGMPYLEDGKDDTMLRRGDLYIQFKIQYP 390

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  140 bits (352), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 107/352 (30%), Positives = 174/352 (49%), Gaps = 24/352 (6%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  L +  DA++ EIK AYR+L+ ++HPDK +     DE+  KF E+  AYE+LS+ E
Sbjct: 23  DYYAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGS---DEAHHKFIEIGEAYEVLSDPE 79

Query: 62  KRQNYDTYG-------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTD 114
           K++ YD +G                 GF D  F  F   F   +             R  
Sbjct: 80  KKKIYDQFGADAVKNGGGGAGGPGGGGFHD-PFDIFERMFQGGQGGPGGGFGQRQRQRGP 138

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLR 174
              V   L++++ Y+G +I F    N  C+ C G+G        + C  C+G G+  ++ 
Sbjct: 139 TIKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSG--SADGKLAQCPDCQGRGIIVQVV 196

Query: 175 RLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRV 233
           R+G   +T++I Q C +C G G+ ++++  CK CHGK+VT ++K  +V +P G+      
Sbjct: 197 RMG--IMTQQIQQICGRCAGTGQVIKNQ--CKTCHGKKVTKKNKFFHVDVPPGAPRNYMD 252

Query: 234 VLKGEADEEPGKIPGDLVFDIAE-NSASSSLERRGSDLYAKITISLSDALT-GFEKEVCT 291
              GEA++ P    GDLV +  E ++ +    RRG +LY    +S ++AL  G+E+ +  
Sbjct: 253 TRAGEAEKGPDFDAGDLVIEFREMDTENMGYRRRGHNLYRTEVLSAAEALYGGWERTIEF 312

Query: 292 TLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSK-FGDMYVQIDIEFP 342
             + + +KL  P   VV  G    +   G P   +GS+  GD+Y+   +  P
Sbjct: 313 LDENKPVKLSRPAHAVVSTGEIEVVKGFGMP---KGSRDHGDLYIDYVVVMP 361

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  142 bits (357), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 114/355 (32%), Positives = 176/355 (49%), Gaps = 34/355 (9%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGVA DA+Q EIKKAYR+LAL++HPDK + +    E+   F++++ AY +L +  +R
Sbjct: 5   YDVLGVASDASQSEIKKAYRKLALRYHPDKNNGDEKCHEA---FQKISHAYGVLGDVAQR 61

Query: 64  QNYDTYGDTNGFSGDYSGFQDGD-FASFF--GNFASNRYQDEYEAQSPPSPRTDDAHVPI 120
           Q YD  GD N  S   +G    D F+SFF  G    +           PS   +  H  +
Sbjct: 62  QRYDQSGDENE-SLQPTGSNAADLFSSFFNGGGVYPSGSSGGPGPSRGPSRGPNIIH-EL 119

Query: 121 RLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGF 180
           + T+Q+LY GK I+   +R   C RC           A+ CS C G G   R+ R+GP  
Sbjct: 120 KCTLQDLYRGKVIKLALRRTAPCERCSLGA-------ANVCSSCNGSGNITRIERVGPLT 172

Query: 181 VTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEAD 240
            T     C+ C+G G   R    C +C G +   E     V++  G   G  +VL GEAD
Sbjct: 173 QTWSST-CNACQGQG---RMSVDCSQCGGAQYLNERVVFKVHVKPGMHDGQTIVLDGEAD 228

Query: 241 E----EPGKIP----GDLVFDIAENSAS----SSLERRGSDLYAKITISLSDALTGFEKE 288
           +      G +     GD+V  I E + +    S+L +R +    ++ + L+ ALTG    
Sbjct: 229 QCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKRENLFVDQVKVDLTTALTGGNVL 288

Query: 289 VCTTLDGRLLKLKVPLGQVVRPGNFVR-IDNEGWPLDDQGSKFGDMYVQIDIEFP 342
           +     G L+K+ +  G+ + P N ++ ++  G P+DD G + GD+Y++     P
Sbjct: 289 LEDHPSGNLMKINILPGEFL-PENCIKCVEGLGMPIDDTGQR-GDLYIRFCTHSP 341

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  140 bits (352), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 110/361 (30%), Positives = 172/361 (47%), Gaps = 34/361 (9%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  LGVA DA++ +IK AYR+++ + HPDK + +   DE+  KF E+  AYE+LS+ E
Sbjct: 19  DYYAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGD---DEAHHKFIEIGEAYEVLSDSE 75

Query: 62  KRQNYDTYG---------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPR 112
           KR  YD +G            G  G + G    D    F     + +      +   +  
Sbjct: 76  KRATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQNVRKGSNLI 135

Query: 113 TDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQR 172
             D+     +T+   Y+G         N  C  C G+G        + C  C+G GV  +
Sbjct: 136 VKDS-----VTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDN--QFATCETCQGRGVIIQ 188

Query: 173 LRRLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGD 231
           + ++G  F+T++I Q C  C+G GK ++   +CK C G RV    K   + +P G++   
Sbjct: 189 VIQMG--FMTQQIQQVCGACQGKGKTIKH--VCKICRGARVVKTPKTFEISVPAGAQRNY 244

Query: 232 RVVLKGEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALT-GFEKEV 289
            VV  G+A++ P    GDLVF   ENS  +    RRG  LY    +   +AL  G+E+ +
Sbjct: 245 NVVKSGQAEKVPDMQSGDLVFVFEENSHENLGYRRRGDHLYRTEVLHWKEALLGGWERRI 304

Query: 290 CTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP-LDDQG---SKFGDMYVQIDI----EF 341
               D + + +K     V  PG   R+ N G P L+ +G   + +GD++++  I    EF
Sbjct: 305 AFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGDLFIEYVIVSPKEF 364

Query: 342 P 342
           P
Sbjct: 365 P 365

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score =  139 bits (350), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 119/445 (26%), Positives = 192/445 (43%), Gaps = 96/445 (21%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y  L V   AT  EIK AY++LAL++HPDK    +  +ES++KF+E+  AYE+L +++K+
Sbjct: 15  YSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEICKAYEVLHDKDKK 71

Query: 64  QNYDTYGD-----------TNGFSGDY--SGFQDGD-FASFF------------------ 91
             YDTYG             N    D+  +    GD FA FF                  
Sbjct: 72  LLYDTYGTLDESLIDKQRGNNDQKDDFDTTELSPGDLFAKFFDKSSRVNNNNYNSNSSPF 131

Query: 92  -----GNFASNRYQDEYEAQSPPSPRT-------------DDAHVPIRLTMQELYNGKTI 133
                 N  +N   + +  Q+  SP T             D  HV +  T++ELY GK  
Sbjct: 132 NNVPSTNTNTNSAGNRFMTQALNSPSTTGTLFEKGLSRGPDIKHV-LNCTLKELYQGKKC 190

Query: 134 RFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKG 193
           +    R   C+ C G G      +   C++C+G G+    + LGP  V      C  C G
Sbjct: 191 KLGLNRTRSCHSCNGMG----GMNTIICNECQGKGINTETKMLGP-MVQSWSSTCFNCSG 245

Query: 194 LGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEADE--------EPGK 245
           +G  + S+  CK+C G+    E     V +  G R+  ++VLKGEAD+        +   
Sbjct: 246 MGYFIDSQSGCKECQGEGYLRERTIFTVTVKPGMRNNQKIVLKGEADQVMLVGKLNKEKV 305

Query: 246 IPGDLVFDIAENSASSSLERRGSD------------------LYAKITISLSDALTGFEK 287
           IPGD++  I +    S       D                  L     I L  +L G E 
Sbjct: 306 IPGDVIIVINQIEGKSWKNDSNIDQGENKNKFHFEIINEKDLLLRNCQIDLITSLCGGEI 365

Query: 288 EVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP--LDDQ---GSKF---GDMYVQIDI 339
            +     G+L+KL +   ++++P     ++N G P  ++D+   G ++   GD+Y+Q  +
Sbjct: 366 YIKNHPSGKLIKLDIIPSEILKPDCLKCVENLGMPRYIEDETNNGEEYLPNGDLYIQFKV 425

Query: 340 EFPPDHWFSERSDVKSLQNLLPQAV 364
           ++P      E   +  L+++L + +
Sbjct: 426 KYPTK---LENETIDKLRSILSEDI 447

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  135 bits (339), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 104/357 (29%), Positives = 168/357 (47%), Gaps = 28/357 (7%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDK-VSDESLRDESEIKFKEVAAAYELLSNE 60
           D Y  LG+  DA+  ++K AYR+L+ ++HPDK   DES    +  +F EV  AYE+LS+ 
Sbjct: 19  DYYSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDES----AHQRFIEVGEAYEVLSDP 74

Query: 61  EKRQNYDTYGDTNGFSGDYSG----------FQDGDFASFFGNFASNRYQDEYEAQSPPS 110
           EKR  +D YG  +G      G          F D  F  F   F        +       
Sbjct: 75  EKRGIFDQYG-ADGLKNGAGGGGGPGGGFGGFHD-PFDIFEQMFNRGGGGGGFGGGFGGM 132

Query: 111 PRTDDAHVPIR--LTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHG 168
            R     + +   L++++ Y+G  + F+   N +C+ CEG+G          C  C G G
Sbjct: 133 HRGKGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSG--SEDGKVETCPDCGGQG 190

Query: 169 VKQRLRRLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGS 227
           +  ++ R+G   +T+ I Q C +C G G  ++++  CK C G +V  + K+  V +P G+
Sbjct: 191 ILIQIIRMG--IMTQRIQQPCGRCSGRGHIIKNQ--CKACGGHKVVKKPKSFQVEVPAGA 246

Query: 228 RHGDRVVLKGEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALTG-F 285
                 V   EAD+      GD+  +  E+  ++    RRG  L+    +S  +AL G +
Sbjct: 247 PRDHVEVRHQEADQSTDMEAGDIFVEFTESDKNNMGYRRRGDHLFRTEVLSAREALAGGW 306

Query: 286 EKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
            +E+    D + +KL+ P G +V  G   +I   G P    G  FGD++V+  +  P
Sbjct: 307 SREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFGDLFVEYAVVMP 363

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score =  134 bits (337), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 104/355 (29%), Positives = 170/355 (47%), Gaps = 30/355 (8%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y+ LG++ +  + EIK AYR+L+ + HPDK  ++   +++  KF E+  AYE+LS+ E
Sbjct: 23  DYYKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPND---EDAHNKFIEIGEAYEVLSDPE 79

Query: 62  KRQNYDTYG----------------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEA 105
           KR+ YD +G                   GF   +  F+        G F        +  
Sbjct: 80  KRRMYDQFGADAVKNGGPGGPGGPGGPGGFHDPFDLFEQMFGGGHGGGFGGFGGFGGFGG 139

Query: 106 QSPPSPRTDDAHVPIR--LTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQ 163
                 +     + +R  LT+++ YNG +I F    N  C+ C G+G          C  
Sbjct: 140 GQQHQGKQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSG--SEDGKVKKCPD 197

Query: 164 CEGHGVKQRLRRLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVY 222
           C G GV  ++ R+G   VT+++ Q C++C G G+ ++++  CK C G +V  + K+++V 
Sbjct: 198 CGGRGVVIQVIRMG--IVTQQVQQRCNRCAGSGEIIQNK--CKVCSGAKVQKKEKDISVS 253

Query: 223 IPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAEN-SASSSLERRGSDLYAKITISLSDA 281
              G       V +GEA++ PG  PGDL+ +  E   A+    RRG DL+    ++L +A
Sbjct: 254 FDSGIERNHISVQQGEAEKGPGIEPGDLIVEFFEVPEANMGYRRRGKDLFRTEVLTLQEA 313

Query: 282 LTGFEKEVCTTLD-GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYV 335
           + G        LD  + L+LK     +V  G   +I   G P+     KFGD+Y+
Sbjct: 314 INGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGSKGKFGDLYI 368

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  133 bits (335), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 167/354 (47%), Gaps = 25/354 (7%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  L V  DA++ EIK AYR+L+ ++HPDK S     +E+  KF EV  AY++LS+ E
Sbjct: 23  DYYAILEVDKDASEKEIKSAYRQLSKKYHPDKNSGS---EEAHHKFIEVGEAYDVLSDPE 79

Query: 62  KRQNYDTYG----------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSP 111
           K++ YD +G                    GF D  F  F   F                 
Sbjct: 80  KKKIYDQFGADAVKNGGGGGGGAGGPGGGGFHD-PFDIFEHMFQGGHGGPGGGFGQRQRQ 138

Query: 112 RTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQ 171
           R     V  +L++++ Y+G +I F    N  C+ C G+G        + C  C+G GV  
Sbjct: 139 RGPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSG--SADGKLAQCPDCQGRGVII 196

Query: 172 RLRRLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHG 230
           ++ R+G   +T++I Q C +C G G+ ++++  CK CHGK+V  ++K  +V +P G+   
Sbjct: 197 QVLRMG--IMTQQIQQMCGRCGGTGQIIKNQ--CKTCHGKKVIKKNKFFHVDVPPGAPRN 252

Query: 231 DRVVLKGEADEEPGKIPGDLVFDIAE-NSASSSLERRGSDLYAKITISLSDALTGFEKEV 289
                 GEA++ P    GDLV +  E ++ +    RRG +LY    +S  +AL G  +  
Sbjct: 253 YLDTRAGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAEEALYGGWQRT 312

Query: 290 CTTLD-GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
               D  + +KL  P   VV  G    +   G P   +G   GD+Y+   +  P
Sbjct: 313 IEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMPKSGKGH--GDLYIDYVVIMP 364

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  131 bits (329), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 105/351 (29%), Positives = 168/351 (47%), Gaps = 22/351 (6%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  L +   A++ EIK AYR+L+ + HPDK +     +E+  KF EV  AY++LS+ E
Sbjct: 23  DYYAILEIDKGASEKEIKSAYRQLSKKFHPDKNAGS---EEAHQKFIEVGEAYDVLSDPE 79

Query: 62  KRQNYDTYG-------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTD 114
           K++ YD +G                 GF D  F  F   F                 R  
Sbjct: 80  KKKIYDQFGAEAVKNGGDGAGGPGAGGFHD-PFDIFERMFQGGHGGTGGGFGQRQRQRGP 138

Query: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLR 174
              V  +L++++ Y+G +I F    N  C+ C G+G        + C  C+G GV  ++ 
Sbjct: 139 MIKVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSG--SADGKLAQCPDCQGRGVIIQVL 196

Query: 175 RLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRV 233
           R+G   +T++I Q C +C G G+ +++E  CK CHG +VT  +K  +V +P G+      
Sbjct: 197 RMG--IMTQQIQQMCGRCGGTGQVIKNE--CKTCHGNKVTKRNKFFHVDVPPGAPRNYMD 252

Query: 234 VLKGEADEEPGKIPGDLVFDIAE-NSASSSLERRGSDLYAKITISLSDALT-GFEKEVCT 291
              GEA++ P    GDLV +  E +S +    RRG +LY    +S+ +AL  G+E+ +  
Sbjct: 253 TRAGEAEKGPDFDAGDLVIEFKEKDSENMGYRRRGDNLYRTEVLSIEEALYGGWERTIEF 312

Query: 292 TLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
             + + +KL  P    V  G    +   G P   +G  +GD+Y+   +  P
Sbjct: 313 LDENKPVKLSRPAYVGVSNGEIEVMKGFGMPKGGKG--YGDLYIDYVVIMP 361

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  130 bits (326), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 104/349 (29%), Positives = 177/349 (50%), Gaps = 26/349 (7%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  LG++ DA+  EIK AYR+L+ ++HPDK   +   +E+  KF EV  AY++L + E
Sbjct: 20  DYYAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGD---EEAHHKFIEVGEAYDILGDPE 76

Query: 62  KRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSP---PSPRTDDAHV 118
           KR+ YD +G  + F     G + G F   F     + ++  +  Q      + R+ +  V
Sbjct: 77  KRKTYDVHG-ADAFKNGGQGQRGGGFHDPF-----DMFEQMFGRQGGGFRQTQRSQNYQV 130

Query: 119 PIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGP 178
             +++++E Y+G  + F+   N +C+ C G+G          C  C+G GV  ++ R+GP
Sbjct: 131 RNQVSLKEFYSGGEVEFEIPLNDICDSCHGSG--SADGKVKVCPACQGRGVVVQVIRMGP 188

Query: 179 GFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRG--SRHGDRVVLK 236
                + +Q    +  GK    E+ CK C G +V  ++K  +   P G    H D+    
Sbjct: 189 ---ITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPRNHIDK--KS 243

Query: 237 GEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALT-GFEKEVCTTLD 294
           GE+D+ P    GD++ +  E+   +    RRG++LY    I+ ++A+  G+ +E+    +
Sbjct: 244 GESDKSPDMESGDIIIEYNESEKENLGYRRRGNNLYRTEIITANEAINGGWTREIEFLDE 303

Query: 295 GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSK-FGDMYVQIDIEFP 342
            + +KL  P G +V  G+  RI   G P+   GSK FGD+Y+   +  P
Sbjct: 304 KKKVKLSRPKGSIVNNGDIERIKGFGMPI--MGSKNFGDLYIDYVVLVP 350

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  130 bits (328), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 108/366 (29%), Positives = 175/366 (47%), Gaps = 40/366 (10%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y+ LG+  +A++  IK AYR+L+ ++HPDK  ++   +E+   F E+  AYE+LS+ E
Sbjct: 29  DYYKILGIPKEASEKAIKSAYRQLSKKYHPDKNQND---EEAHNHFIEIGEAYEVLSDPE 85

Query: 62  KRQNYDTYGDTNGFSGDYSG------------FQDGDFASFFGNFASNRYQDEYEAQSPP 109
           KR+ YD +G ++ F     G            F D  F  F   F  N+           
Sbjct: 86  KRRTYDQFG-SDAFQNGGQGQGGPGGPGGPGGFHD-PFDLFNQMFGGNKGNFGGFGGFGG 143

Query: 110 SPRTDD-------AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACS 162
               DD         V   L+++E + G  + FQ      C+ C+G+G          C 
Sbjct: 144 GGFADDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSG--SEDGKVDKCK 201

Query: 163 QCEGHGVKQRLRRLGPGFVTREI-VQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNV 221
           +C G+G   ++ R+GP  VT+++  QC KC G G  +++   CKKCHG+++  +SK +NV
Sbjct: 202 ECGGNGFVVQVIRMGP--VTQQMHTQCPKCHGAGSTIKNH--CKKCHGQKLVTKSKEINV 257

Query: 222 YIPRGSRHGDRVVLKGEADEEPGKIPGDLVF---DIAENSASSSLERRGSDLYAKITISL 278
            +P G+      +++   D+E     GDL+    +IA+N+      RRG+DL+    +  
Sbjct: 258 KVPAGAPRDFLKIVENGGDKELNAEAGDLLVQFQEIAQNNL--GYRRRGNDLFRTEALVF 315

Query: 279 SDALTGFEKEVCTTLD-GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGS-KFGDMYVQ 336
            DA+ G         D  R +K+    G  V      ++   G P+  QGS +FGD+Y+ 
Sbjct: 316 KDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPI--QGSDRFGDLYID 373

Query: 337 IDIEFP 342
             I  P
Sbjct: 374 YVIIVP 379

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score =  125 bits (314), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 110/349 (31%), Positives = 164/349 (46%), Gaps = 21/349 (6%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  LGV  +AT+ +IK AYR+L+ ++HPDK   ++    +   F EV  AYE LS+ E
Sbjct: 21  DYYAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHN---FIEVGEAYEALSDPE 77

Query: 62  KRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFAS-NRYQDEYEAQSPPSPRTDDAHVPI 120
           KR+ YD YG     +G  +    G F   F  F         +        R+    V  
Sbjct: 78  KRRIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQSLQVQE 137

Query: 121 RLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGF 180
            LT+++ Y+G  + F    N  C+ C  TG   +      C+QC   GV  ++ R   GF
Sbjct: 138 ELTLRQYYHGTAVEFTLSLNDHCDHCGATG--SQDGKVERCTQCSVRGVIVQVGR--QGF 193

Query: 181 VTREIVQ-CDKCKG-LGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGE 238
           +T++  Q C +  G   K L  +  CK C G +   ++K+  V +P G+      V +GE
Sbjct: 194 MTQQFQQVCPRLLGPWPKALPKK--CKVCQGHKAIKKNKSFRVEVPPGAPRDFVAVQQGE 251

Query: 239 ADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRL 297
           A++ P   PGD+   + EN+  +    R+G++L+    +SL +AL G  K     LD   
Sbjct: 252 AEKVPDMDPGDIYVKVFENTRDNMGYRRQGANLFRTEVLSLKEALHGDWKRELEFLDP-- 309

Query: 298 LKLKVPL----GQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
              KVP     GQ V+ G   R+   G PL D    FGD+YV   +  P
Sbjct: 310 -SKKVPFSRKKGQTVQHGEVERVPGFGMPLPDSAG-FGDLYVDYVVILP 356

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score =  123 bits (308), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 121/421 (28%), Positives = 184/421 (43%), Gaps = 53/421 (12%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+TLGV+ DA+  +IK+AY +LA ++HPD ++ E   D++   F  +  AYE+LS+E+
Sbjct: 48  DPYKTLGVSRDASPSDIKRAYYKLAKKYHPD-INKEPGADKT---FHNLQNAYEILSDEK 103

Query: 62  KRQNYDTYG----DTNG---FSGDYSGFQDGDFASFFGNFASNRYQDEYEA---QSPPSP 111
           K+  YD YG    D NG    +G ++ F  G  AS F +F    ++D + A   +S    
Sbjct: 104 KKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSGFRN 163

Query: 112 RTDDAHVPIRLTMQELYNGKTIRFQ----------AKRNVV--------CNRCEGTGVRR 153
             D      R  +   Y G +I  Q             NV         C  C G+G++ 
Sbjct: 164 GGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPCGTCHGSGLKN 223

Query: 154 RARHA-SACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRV 212
             +H    CS C G G +  ++    GF  +    C  C G G  +  ED C  C G  V
Sbjct: 224 GEQHKRKTCSYCNGTGTQVHVK---SGF--QMASTCMHCHGEGTTIAREDTCSACDGDGV 278

Query: 213 TPES-KNLNVYIPRGSRHGDRV----------VLKGEADEEPGKIPGDLVFDIAENSASS 261
              S K+LNV  P G   GD +          +  GE D+      GDL+  I   S   
Sbjct: 279 KINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRIRVKSDPK 338

Query: 262 SLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGW 321
              +   D++    I ++ A  G   E+  T+DG+ ++LKV  G   +      I N G 
Sbjct: 339 FFVKNKYDIWTIKEIPITTAALGGTVEI-ETVDGKNIRLKVISG--TQHDQVTSIPNMGI 395

Query: 322 PLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPAN 381
           P  + G+  G+M VQ  I         ER   + L ++    ++     + + S  D A+
Sbjct: 396 PYRN-GTGRGNMNVQYKIVIKKPQSNIERCLWEGLADVTNDKMAKRTIVNGSGSIMDQAS 454

Query: 382 T 382
           T
Sbjct: 455 T 455

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score =  123 bits (308), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 141/282 (50%), Gaps = 21/282 (7%)

Query: 112 RTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQ 171
           R  D    ++  ++ELY+GK  +    R  +C+RC G G    +  +S C +C G GV  
Sbjct: 151 RGPDIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSGHG----SMTSSVCGECRGQGVYS 206

Query: 172 RLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGD 231
           + RR GP  V      C  C G G  ++S D+C+ C G     E K   V I  G  +  
Sbjct: 207 QTRRHGP-LVQTWSSSCRNCSGAGTFVKSNDVCQTCRGTGYIRERKIFEVEIKPGLSNKS 265

Query: 232 RVVLKGEADEEP----GK---IPGDLVFDIAENSASSSLER-RGSDL-YAKITISLSDAL 282
            ++L GEAD+      GK   IPGD++  + E  ++    R R SDL   +  + L  +L
Sbjct: 266 EIILPGEADQVISTVYGKQQVIPGDVIIIVQEQCSTGRYRRFRESDLVLTRCVVDLRTSL 325

Query: 283 TGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
            G    +     GR +KL+V  G+++ PG+   ++N G P  D  S++GD+Y++  + FP
Sbjct: 326 CGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNPSQYGDLYIKFCVNFP 385

Query: 343 PDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTET 384
                 ER + +++ N++  A++S +      + ++P++ +T
Sbjct: 386 ------ERLEPETM-NVISSALASDSNIIRQENITEPSSAQT 420

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V+P  +  E+KK+Y+  AL++HPDK       + ++  F+++  AY +LS+E KR
Sbjct: 8  YDLLNVSPTVSPQELKKSYKLAALRYHPDK---NGHSESAKQAFQQITEAYGILSDERKR 64

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 65 KIYDRYG 71

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
           YFL016C
          Length = 500

 Score =  122 bits (307), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 117/394 (29%), Positives = 188/394 (47%), Gaps = 71/394 (18%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY  LGV   A+Q EIKKAY +LA Q+HPD ++ E+    +E KF ++  AYE+LS+E 
Sbjct: 35  DPYGVLGVKSSASQGEIKKAYYKLAKQYHPD-INKEA---GAEKKFHDLQNAYEILSDES 90

Query: 62  KRQNYD-----TYGDTNGFSGDYSGFQDGD----FASF-------FGNFASNRYQDEY-- 103
           KR+ +D      +G   G  G  SG+  G     FAS+       FG+F    ++D +  
Sbjct: 91  KRKQFDQFGPAAFGAGAGAGGPGSGYPQGQGFNPFASYTSSSSSPFGDFGGINFEDLFGA 150

Query: 104 -----------------EAQSPPSP------RTDDAHVPIRLTMQELYNGKTIRFQAKRN 140
                             +++P S       + D  HV   ++ ++   GK+   + K N
Sbjct: 151 AFSGSGGAGGAKAGGAGASRNPFSSSGYRQYKGDSVHVSYNMSFKDAVFGKS-GVKLKFN 209

Query: 141 VV--CNRCEGTGVRRRA-RHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKN 197
           V   C+ C G+G+++ A RH   C  C+G G K  +R    GF  + +  C++C+G G  
Sbjct: 210 VFDPCDTCSGSGIKKGASRH--QCPGCQGSGTKIHVR---GGF--QMMSTCNECQGEGTT 262

Query: 198 LRSEDMCKKCHGKRVT-PESKNLNVYIPRGSRHGDRVVLKG-----EADEEP---GKIP- 247
           + S D+C  CHG+ V     K + V +P G + GD + + G     E   +P   G +  
Sbjct: 263 VNSSDLCGACHGEGVHFHRGKEITVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSVKL 322

Query: 248 --GDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLG 305
             GD++ ++      +   R  SD++  + I ++ A  G   +V  T+DG  ++LKV  G
Sbjct: 323 TRGDVLVNVRVEEDPTFTIRDKSDIWYTMEIPITTAALGGTVQV-PTVDGSHIRLKVAPG 381

Query: 306 QVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDI 339
              + G+ + + N G P  +     G M VQ  I
Sbjct: 382 --TQSGDVITVPNMGVPRSNLTRSRGAMKVQYRI 413

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score =  117 bits (293), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 97/367 (26%), Positives = 173/367 (47%), Gaps = 42/367 (11%)

Query: 2   DPYETLGVAPD-ATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
           D Y+ LG+  +   + EIK AYR+L+ ++HPDK  ++    +++  F +V  AY++L + 
Sbjct: 24  DYYKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDK---DAQQNFIKVGEAYDVLGDP 80

Query: 61  EKRQNYDTYGDTNGFSGD-----------YSGFQDGDFASFFGNF-----------ASNR 98
           +K++ YD  G  + F  +              F D  F  F   F             N 
Sbjct: 81  DKKRQYDQMG-HDAFVNNAQHGGPEGGPGGQPFHD-PFDMFEKMFHGGGPGGGNPFGGNP 138

Query: 99  YQDEYEAQSPPSPRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHA 158
           +      +  PS + +      +L++++ Y G   +F    +  C+ C GTG        
Sbjct: 139 FGGGGGQRRGPSLKVEQ-----QLSLKQYYQGFDFQFALNLHDDCDHCHGTG--SEDGKT 191

Query: 159 SACSQCEGHGVKQRLRRLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESK 217
             C  C+G G+  ++ R+G   +T++I Q C +C+G G  ++  + CK C+G +V  + K
Sbjct: 192 KVCPDCKGSGIIIQIIRMG--MMTQQIQQPCGRCRGQGHLIK--NFCKVCNGAKVQQKLK 247

Query: 218 NLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITI 276
           +  VY+P GS      V  G+A++ P   PGD++ +  E    +    RRG++L+    I
Sbjct: 248 DFKVYVPPGSPRNHVEVKAGQAEKNPNYEPGDVIIEFNELPLDNLGYRRRGNNLFRTEYI 307

Query: 277 SLSDALTGFEKEVCTTLD-GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYV 335
           SL++AL G  +     LD  + + LK      +  G    +   G P+ ++ +KFGD+Y+
Sbjct: 308 SLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPNKKNKFGDLYI 367

Query: 336 QIDIEFP 342
              +  P
Sbjct: 368 DYKVIIP 374

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score =  106 bits (265), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 116/224 (51%), Gaps = 10/224 (4%)

Query: 122 LTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFV 181
           LT+++ Y G ++ F    N  C  C G+G   +    + CS+C G GV  ++ R+GP  +
Sbjct: 147 LTLKQYYQGTSLDFTLNLNDFCENCHGSG--SQDGKTTHCSECRGQGVVIQVVRMGP--L 202

Query: 182 TREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEAD 240
           T++I Q C  C+G G+ ++++  CK+CHG +V  ++K+ +V +P G+      V  GEAD
Sbjct: 203 TQKIQQMCGACQGKGQVIKNK--CKRCHGAKVERKAKHFHVDVPAGAPRDFVDVKAGEAD 260

Query: 241 EEPGKIPGDLVFDIAENSASS-SLERRGSDLYAKITISLSDALTGFEKEVCTTLD-GRLL 298
           + P    GD+    +E+S  +    RRG  LY    +SL +AL G  K      D  + L
Sbjct: 261 KGPDFDSGDVFIKFSESSRDNMGYRRRGPHLYRTEVLSLKEALLGGWKREIEFFDPNKKL 320

Query: 299 KLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
           KL+   G  VR G   R+   G P    G K GD++V   +  P
Sbjct: 321 KLQRGQGVPVRNGEIERVPGFGMPTGGHG-KHGDLFVDYVVVIP 363

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score =  105 bits (263), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 107/384 (27%), Positives = 175/384 (45%), Gaps = 59/384 (15%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+TLG+  +A+Q +IKKAY +LA ++HPD   +E+    +E KF ++  AYE+LS+E+
Sbjct: 47  DPYKTLGINSNASQSDIKKAYYKLAKKYHPDINKEEN----AEAKFHDLQNAYEILSDEQ 102

Query: 62  KRQNYD------------TYGDTNGFSGD----------YSGFQDGDFASFFGNFASNRY 99
           KR+ YD            T G++N F+ D          +S F   +F   FGN    ++
Sbjct: 103 KRKQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFGGINFEDLFGNAFKQQH 162

Query: 100 QDEYEAQSPPSPRT---DDAHVPIRLTMQE-LYNGKTIRFQAKRNVVCNRCEGTGVRRRA 155
            +     +    R    D  H+   L  ++ ++  K ++        CN C G+G++  A
Sbjct: 163 SNNTSNSNRNFFREFKGDTIHLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNGSGLKHNA 222

Query: 156 RHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVT-P 214
            H S C  C G G +  +R    GF  + +  C+ C G G  +   D C  CHG  V   
Sbjct: 223 -HKSTCQTCNGTGTRVHIR---GGF--QMMSTCNDCNGEGTKIDPNDYCNHCHGDGVEFK 276

Query: 215 ESKNLNVYIPRGSRHGD--RVVLKG---EADEEPGKIP--------GDLVFDIAENSASS 261
            +K + V +P   + GD  RV  KG   +   +P  I         GD++  I   + + 
Sbjct: 277 RNKEITVDLPNALQDGDVIRVSNKGSYPQMAMDPDLINNNNVRMTRGDILIKINVINDTK 336

Query: 262 SLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGW 321
              R   D++  + I ++ A  G    +  ++DG  ++L+V  G   +    + I N G 
Sbjct: 337 FKIRDKYDIWYTMEIPITTAALGGIVTI-PSIDGTNVRLRVSPG--TQNDQIISIPNMGV 393

Query: 322 PLDDQGSKF------GDMYVQIDI 339
           P  +  S+       G+M VQ  I
Sbjct: 394 PRSNIFSRSTNTTNRGNMKVQYKI 417

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score =  103 bits (256), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 107/391 (27%), Positives = 166/391 (42%), Gaps = 71/391 (18%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+ LG+  DA   EIKKAY +LA ++HPD   D+     S+ KF ++  AYE+LS+E+
Sbjct: 47  DPYKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKG----SDKKFHDITNAYEILSDEK 102

Query: 62  KRQNYDTYGDT----------------NGFSGDYSGFQDGDFASFFGNFASNRYQDEYEA 105
           K+  YD +G                  N F+G  + F +     F   F    ++D + A
Sbjct: 103 KKMQYDQFGSAAFDNSQGGGSGGFSGGNPFAGGANPFANAGGNPF--GFGGINFEDLFGA 160

Query: 106 QSPPSP--------------------------RTDDAHVPIRLTMQE-LYNGKTIRFQAK 138
               +                           R D+  V   L+ ++ ++  + +     
Sbjct: 161 AFSKANGAAGRGGGRSSGRGNGSPFGGFYSEVRGDNVEVIHTLSFKDAVFGSRNVTLNVS 220

Query: 139 RNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNL 198
               C  C G+G++    H S CS C G G    +R    GF  +    C  C G G+N+
Sbjct: 221 SIEQCKTCTGSGMKP-GSHRSECSSCHGTGTTVHVR---AGF--QMASTCMSCGGTGENI 274

Query: 199 RSEDMCKKCHGKRVTPE--SKNLNVYIPRGSRHGDRVVLKGE--------ADEEPGKIP- 247
             ED+C+ C G+   P    + + V +P G   GD + + G+        A E+  ++  
Sbjct: 275 AREDVCRNCDGEGTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPEQRDQVKV 334

Query: 248 --GDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLG 305
             GDL+  I          R G++L+    I ++ A+ G    V  TLDG  L+L+V  G
Sbjct: 335 TRGDLLVRIRVKQDKVFSIRNGNELWQTREIPVTTAVLG-GNVVIPTLDGNQLRLRVRSG 393

Query: 306 QVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQ 336
              R G  V +  +G P    G   GDM VQ
Sbjct: 394 --TRDGETVSVPGQGVPRGRGGLSRGDMKVQ 422

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 99.4 bits (246), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 126/270 (46%), Gaps = 30/270 (11%)

Query: 112 RTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQ 171
           R  D    ++ T+  LY+GK  + + +R   C +C+G G    + +  +CS+C G G   
Sbjct: 229 RGPDIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFG----SLNIKSCSKCNGRGSLT 284

Query: 172 RLRRLGPGFVTREIVQ-CDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHG 230
           + ++ GP  +T+   Q CD C G G    ++D+C +C G+    E K   V I  G   G
Sbjct: 285 QTKKFGP--MTQTFTQTCDGCGGNGTFADAQDICNECQGEGFLNEKKIFEVEITPGMTDG 342

Query: 231 DRVVLKGEADE----EPGK---IPGDLVFDIAENSASSSLERRGSD-LYAKITISLSDAL 282
             ++L GEADE      GK   IPGD++  I      +    +G+D LYA   I+L  +L
Sbjct: 343 QLIILTGEADEVISTNLGKERVIPGDIILTINLLPDPTFKVVQGADLLYANYKINLLTSL 402

Query: 283 TGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPL---------DDQGSK---F 330
            G    +       L+K+ +  G++++ G    ++N G P          D Q +K    
Sbjct: 403 CGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSVGHSNDIQANKPTLK 462

Query: 331 GDMYVQIDIEFPPDHWFSERSDVKSLQNLL 360
           G++ +  +I +P      E   V  LQN+L
Sbjct: 463 GNLVIHFEIVYPD---MLETDTVIELQNIL 489

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V  D+ +  IKKAYR LAL++HPDK    +L +ES+  F++++ AY +LSN++KR
Sbjct: 8  YDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQMFQKISEAYVVLSNKDKR 64

Query: 64 QNYDTYG 70
          Q YD YG
Sbjct: 65 QMYDKYG 71

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 97.1 bits (240), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 104/390 (26%), Positives = 174/390 (44%), Gaps = 66/390 (16%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY  LGV   A+  EIKKAY +LA ++HPD     + + ++E KF ++  AYE+LS+E 
Sbjct: 79  DPYSVLGVNNSASTSEIKKAYYKLAKKYHPDI----NKQPDAEKKFHDLQNAYEILSDEN 134

Query: 62  KRQNYDTYGDT----------------------------------NGFSGDYSGFQDGDF 87
           KR+ YDT+G +                                  N F+     F+D  F
Sbjct: 135 KRKQYDTFGPSAFQDAQQGGAGGPGGGPGGFPGGYPFGQTSSGSGNPFADFGINFEDL-F 193

Query: 88  ASFFGN--FASNRYQDEYEAQSPPSPRTDDAHVPIRLTMQE-LYNGKTIRFQAKRNVVCN 144
            + FGN   A+   +   ++      + D   +   L  ++ ++  + +  +      CN
Sbjct: 194 GAAFGNGPHATGGGRARRQSNIYREFKGDPIEIVHNLNFKDAVFGVQNVNLKFNSMDPCN 253

Query: 145 RCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMC 204
           +C G+G+ R A+  + C  C G G K  +R    GF  + +  C+ C G G  + S+D+C
Sbjct: 254 KCSGSGLNRNAKR-TTCPSCHGSGQKVHIRS---GF--QMVSTCNHCHGEGTIIDSKDIC 307

Query: 205 KKCHGKRV-TPESKNLNVYIPRGSRHGDRVVLKGE-------ADEEPGKIP------GDL 250
             CHG  V    +K+++V +P G + GD + + G+       A  +P  +       GDL
Sbjct: 308 SSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGNYPQTGASIDPAMMNSIKLSRGDL 367

Query: 251 VFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRP 310
           +  +  N   +   R   D++    I ++ A+ G   ++  T+DG  ++LKV  G   + 
Sbjct: 368 LVRVRVNKDPNFSIRDKYDIWFTKQIPITTAILGGVVKI-PTVDGTQIRLKVSPG--TKH 424

Query: 311 GNFVRIDNEGWPLDD-QGSKFGDMYVQIDI 339
              + I N G P         G+M VQ  I
Sbjct: 425 DQIISIPNLGVPRSSINKDNRGNMKVQYKI 454

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 108/377 (28%), Positives = 166/377 (44%), Gaps = 52/377 (13%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+TLGVA  A+Q EIKKAY +LA ++HPD ++ E    ++E  F  +  AYE+LS+E+
Sbjct: 56  DPYKTLGVARSASQSEIKKAYYKLAKKYHPD-INKEP---DAEKTFHNLQNAYEILSDED 111

Query: 62  KRQNYDTYGDT--------NGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRT 113
           KR  +D +G +        +G SG ++ F +G+   F      N       A    +   
Sbjct: 112 KRAQFDQFGASAFSQNAGPSGGSGGFNPFANGNGGGFGDFGGLNFEDLFGAAFGGGASGR 171

Query: 114 DDAHVPIRLTMQELYNGKTIRFQ----------AKRNVV--------CNRCEGTGVRRRA 155
            +     R+ M   Y G TI                NV         C+ C G+G+++  
Sbjct: 172 SNGGFGSRVNMVREYKGDTIEIIHNLSFKDAVFGVNNVSLTFNALDPCDTCHGSGLKKGE 231

Query: 156 RHA-SACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTP 214
            H   +CS C G G +  +R    GF  +    C+ C G G  +  EDMC KCHG  V  
Sbjct: 232 NHKRRSCSYCNGTGTQIHVR---SGF--QMASTCNHCHGEGTIIAFEDMCTKCHGDGVKL 286

Query: 215 ES-KNLNVYIPRGSRHGDRVVLKGEADEEPGKIP-----------GDLVFDIAENSASSS 262
           ++ K +NV +P     GD + + GE       +P           GDL+  I        
Sbjct: 287 DAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKDRVKLSRGDLLVRIRVKPDPDY 346

Query: 263 LERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP 322
             +   D+++   I ++ A  G    +  T+D + ++LKV  G   +      I N G P
Sbjct: 347 TIKNKYDIWSVKEIPITTAALGGTITI-KTIDDKQIRLKVMAG--TQHDQVTSIPNMGVP 403

Query: 323 LDDQGSKFGDMYVQIDI 339
             + G   GDM +Q  +
Sbjct: 404 RRN-GLGRGDMKIQYKV 419

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 92.8 bits (229), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 110/399 (27%), Positives = 176/399 (44%), Gaps = 59/399 (14%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+TLGV   A+  EIKKAY +LA ++HPD   ++   D    KF ++  AYE+LS+ +
Sbjct: 33  DPYDTLGVGKSASPSEIKKAYYKLAKKYHPDINKEQGAGD----KFHDLQNAYEILSDAD 88

Query: 62  KRQNYD------------------TYGDTNGFSGDYSGFQDGDFASF-FGNFASNRYQDE 102
           K+  YD                        GFS D+SGF  G+F    F +     +   
Sbjct: 89  KKSQYDQFGAAAFGQGGAGGGPGGPGAGYGGFS-DFSGF--GNFGGINFEDLFGAAFGGG 145

Query: 103 YEAQSPPSP---------RTDDAHVPIRLTMQE-LYNGKTIRFQAKRNVVCNRCEGTGVR 152
               S  SP         R D   V  R+  ++ ++  K +  + +    C+ C+G+G++
Sbjct: 146 GGRSSRGSPFGSSMFREYRGDPIEVSYRMPFKDAVFGAKDVNLKFRALDPCHTCDGSGMK 205

Query: 153 RRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRV 212
             A+  S C  C G G    +R    GF  +    C +C G G   + ED+C  CHG  V
Sbjct: 206 TGAKPQS-CPSCHGTGTTVHVR---AGF--QMATTCQQCGGEGTTTKREDLCGSCHGDGV 259

Query: 213 -TPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIP-----------GDLVFDIAENSAS 260
              + K++ V +P+G + GD V + G+       +P           GD++  I  +   
Sbjct: 260 EWTKDKSVRVDLPQGLQDGDVVRVPGQGSYPNMAVPPEMKSSIRLRRGDVLVRIRVDKDP 319

Query: 261 SSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEG 320
               R   D++    I ++ A  G   +V  T+DG  ++L+V  G   +    + I N G
Sbjct: 320 RFSIRDKWDIWFIQDIPITTAALGGTVQV-PTVDGSHVRLRVQPG--TQHDQIISIPNMG 376

Query: 321 WPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNL 359
            P    G++ G M VQ  I+       +ER   ++L N+
Sbjct: 377 VPR-VAGTR-GSMKVQYKIQVKKPQSKAERCLWEALANI 413

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 93.2 bits (230), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 107/375 (28%), Positives = 165/375 (44%), Gaps = 70/375 (18%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPYETLGV   ++Q +IKKAY +LA ++HPD ++ E+    +E KF ++  AYE+LS+E 
Sbjct: 47  DPYETLGVKKSSSQSDIKKAYYKLAKKYHPD-INKEA---GAEKKFHDLQNAYEILSDES 102

Query: 62  KRQNYDTYGDT------------------------NGFSGDYS-------------GFQD 84
           KR+ YD +G                          NGF  D+S              F+D
Sbjct: 103 KRKQYDQFGAAAFSGGAGAGPGGPGAGPGGFNPFGNGFGFDFSGGQAGGAGGFGGINFED 162

Query: 85  GDFASFFGN--FASNRYQDEYEAQSPPSPRTDDAHVPIRLTMQELYNGK---TIRFQAKR 139
             F + FG   F S+       +      + D   V   L  ++   GK   +I+F+A  
Sbjct: 163 -LFGTAFGGGPFGSSSNSGRRSSSMFREYKGDTIEVIQNLDFKDAVFGKKNVSIKFRALD 221

Query: 140 NVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLR 199
              C  C G+G++  A   + C  C G G    +R    GF  + +  C  C G G  + 
Sbjct: 222 --PCGTCNGSGLKSGASK-TTCPSCHGSGTTVHVR---AGF--QMMSTCQTCGGEGTTVN 273

Query: 200 SEDMCKKCHGKRVTPES-KNLNVYIPRGSRHGDRVVLKGE-------ADEEPGKIP---- 247
           + D CK CHG+ V   + K + V +P G + GD V + G+        D+E  K      
Sbjct: 274 ASDFCKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMAKSVKLSR 333

Query: 248 GDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQV 307
           GD++  I  N       +   D++    I ++ A  G    +  T++G  +++KVP G  
Sbjct: 334 GDILVRIRVNKDPHFSIKNKYDIWYTKEIPITTAALGGTVSI-PTIEGTKIRIKVPAGTA 392

Query: 308 VRPGNFVRIDNEGWP 322
             P   + I N G P
Sbjct: 393 --PEQVISIPNMGVP 405

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 111/406 (27%), Positives = 181/406 (44%), Gaps = 63/406 (15%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+TLG+   AT  EIKKAY +LA ++HPD ++ E    ++E KF ++  AYE+LS++ 
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEP---DAEKKFHDLQNAYEILSDDT 116

Query: 62  KRQNYDTYGDTNGFSG-----------------DYSGFQDGDFASFFG--NF-------- 94
           KRQ +D +G      G                 D+SGF +    S FG  NF        
Sbjct: 117 KRQQFDQFGPAAFGGGGGGGAGGAGSPFGSQFHDFSGFTNASGGSPFGGINFEDLFGAAF 176

Query: 95  ---ASNRYQDEYEAQSPPSP-----RTDDAHVPIRLTMQE-LYNGKTIRFQAKRNVVCNR 145
               +        +    SP     R D   +  +++ ++ ++  K ++ +      C  
Sbjct: 177 GGGGAGAGAGRGGSGGRSSPMYRQYRGDPIEIVHKVSFKDAVFGAKNVQLKFSALDPCGT 236

Query: 146 CEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCK 205
           C GTG++    H  +C+ C G G    +R    GF  + +  C  C G G   R +D C 
Sbjct: 237 CSGTGMKPNT-HKVSCTTCHGSGSTVHVRG---GF--QMMSTCPTCNGEGTMKRPQDNCT 290

Query: 206 KCHGKRVTPE-SKNLNVYIPRGSRHGDRVVLKG---------EAD-EEPGKIP-GDLVFD 253
            CHG+ V     K++ V +P G + GD V + G         EAD ++  K+  GD++  
Sbjct: 291 SCHGEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLQDSIKLSRGDILVR 350

Query: 254 IAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNF 313
           I  +   S   R   D++    I ++ A  G    +  T+DG+ +++KV  G   +    
Sbjct: 351 IRVDKDPSFSIRNKYDIWYDKEIPITTAALGGTITI-PTVDGQKIRIKVAPG--TQYNQV 407

Query: 314 VRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNL 359
           + I N G P     +  GDM VQ  I        +E+   ++L ++
Sbjct: 408 ISIPNMGVPR--TATLRGDMKVQYKIVVKKPQSLAEKCLWEALADV 451

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 109/402 (27%), Positives = 178/402 (44%), Gaps = 59/402 (14%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+TLG+   AT  EIKKAY +LA ++HPD ++ E    ++E KF ++  AYE+LS+E 
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEP---DAEKKFHDLQNAYEILSDET 116

Query: 62  KRQNYDTYGDTNGFSG-------------------DYSGFQDGDFASFFG-NFASNRYQD 101
           KRQ YD +G      G                   D+SGF     + F G NF       
Sbjct: 117 KRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAGGSPFGGINFEDLFGAA 176

Query: 102 EYEAQSPPSP-----------RTDDAHVPIRLTMQE-LYNGKTIRFQAKRNVVCNRCEGT 149
                                R D   +  +++ ++ ++  K ++ +      C+ C GT
Sbjct: 177 FGGGGRGSGGASRSSSMFRQYRGDPIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGT 236

Query: 150 GVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHG 209
           G++    H  +CS C G G    +R    GF  + +  C  C G G   R +D C KCHG
Sbjct: 237 GMKPNT-HKVSCSTCHGTGTTVHIR---GGF--QMMSTCPTCNGEGTMKRPQDNCTKCHG 290

Query: 210 KRV-TPESKNLNVYIPRGSRHGDRVVLKG---------EAD-EEPGKIP-GDLVFDIAEN 257
           + V    +K + V +P G + GD V + G         EAD ++  K+  GD++  I  +
Sbjct: 291 EGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD 350

Query: 258 SASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRID 317
              +   +   D++    I ++ A  G    +  T++G+ +++KV  G   +    + I 
Sbjct: 351 KDPNFSIKNKYDIWYDKEIPITTAALGGTVTI-PTVEGQKIRIKVAPG--TQYNQVISIP 407

Query: 318 NEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNL 359
           N G P     +  GDM VQ  I        +E+   ++L ++
Sbjct: 408 NMGVP--KTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADV 447

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 87.4 bits (215), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 106/401 (26%), Positives = 179/401 (44%), Gaps = 58/401 (14%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+TLG+   AT  EIKKAY +LA ++HPD ++ E    ++E KF ++  AYE+LS+E 
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEV---DAEKKFHDLQNAYEILSDEN 116

Query: 62  KRQNYDTYGDTNGFSG------------------DYSGFQDGDFASFFGNFASNRYQDEY 103
           KRQ YD +G      G                  D+SGF +   + F G    + +   +
Sbjct: 117 KRQQYDQFGPAAFGGGGAAGGPGSGGSPFGSQFHDFSGFTNAGGSPFGGINFEDLFGAAF 176

Query: 104 EAQSPPSP------------RTDDAHVPIRLTMQE-LYNGKTIRFQAKRNVVCNRCEGTG 150
                 S             R D   +  +++ ++ ++    ++ +      C+ C GTG
Sbjct: 177 GGAGRSSGGGPRSSSMFRQYRGDPIEIVHKVSFKDAVFGSNNVQLKFSALDPCSTCSGTG 236

Query: 151 VRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGK 210
           ++    H   CS C G G    +R    GF  + +  C  C G G   R +D C KCHG+
Sbjct: 237 MKPNT-HKVNCSTCHGTGTTVHIR---GGF--QMMSTCPTCNGEGTMKRPQDSCTKCHGE 290

Query: 211 RV-TPESKNLNVYIPRGSRHGDRVVLKG---------EAD-EEPGKIP-GDLVFDIAENS 258
            V    +K + V +P G + GD V + G         EAD ++  K+  GD++  I  + 
Sbjct: 291 GVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDTVKLSRGDILVRIRVDK 350

Query: 259 ASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDN 318
             +   +   D++    I ++ A  G    +  T++G+ +++KV  G   +    + I N
Sbjct: 351 DPNFSIKNKYDIWYDKEIPITTAALGGTVTI-PTVEGQKIRIKVAPG--TQYNQVISIPN 407

Query: 319 EGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNL 359
            G P     +  GDM +Q  I        +E+   ++L ++
Sbjct: 408 MGVP--KTTTIRGDMKIQYKIVVKKPQSLAEKCLWEALADV 446

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 103/388 (26%), Positives = 164/388 (42%), Gaps = 66/388 (17%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+ LG+   AT  EIKKAY +LA ++HPD   + +    +E KF ++  AYE+LS+E 
Sbjct: 51  DPYKVLGINKSATSSEIKKAYYKLAKKYHPDINKEPT----AEKKFHDLQNAYEILSDET 106

Query: 62  KRQNYDTYGDTNGFSGDYSGFQDGDFASF--------------FGNFASNRYQDEYEAQS 107
           K+  YDT+G    F+ D SG        F              F +F  N ++D + A  
Sbjct: 107 KKSQYDTFGSA-AFNQDGSGGASSANNPFAGGFSSSGGPGGNPFTDFGIN-FEDLFGAAF 164

Query: 108 PPSP---------------------RTDDAHVPIRLTMQELYNGKTIRFQAKRNVV--CN 144
                                    + D   +  R+  ++   G       K NV+  C+
Sbjct: 165 GGGAGTGPGGARSGGARRSNMYREFKGDPLEITHRIPFKDAVFG-LANVSLKYNVMDPCH 223

Query: 145 RCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMC 204
            C G+G+++ A+    C  C G G K  +R    GF  + +  C++C G G  L + D C
Sbjct: 224 TCHGSGIKQGAQ-KHQCPSCHGSGQKVHIRS---GF--QMVSTCNECHGEGTILNASDYC 277

Query: 205 KKCHGKRVT-PESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIP-----------GDLVF 252
             CHG  V      ++NV +P G + GD + + G+ +     +            GD++ 
Sbjct: 278 GTCHGDAVEFTRDHSINVNLPNGLQDGDVIRIPGQGNYPQMALDPELKNSVKLTRGDVLV 337

Query: 253 DIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGN 312
            I  +  +    +   D++    I ++ A  G    +  T+DG  L+LKV  G   +   
Sbjct: 338 RIRVDKDNRFSIKDKYDIWFTKDIPITTAALGGIVTI-PTVDGTTLRLKVQAG--TQHDQ 394

Query: 313 FVRIDNEGWPLDD-QGSKFGDMYVQIDI 339
            + I N G P         G+M VQ  I
Sbjct: 395 VISIPNLGVPRSSINKENRGNMKVQYRI 422

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 110/407 (27%), Positives = 174/407 (42%), Gaps = 64/407 (15%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+TLG+   AT  EIKKAY +LA ++HPD ++ E    ++E KF ++  AYE+LS+E 
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEP---DAEKKFHDLQNAYEILSDES 116

Query: 62  KRQNYDTYGDTNGFSG------------------DYSGFQDGDFASFFG--NFASNRYQD 101
           KRQ YD +G      G                  D+SGF +   +S FG  NF       
Sbjct: 117 KRQQYDQFGPAAFGGGDAAGGPSGGGSPFGSQFHDFSGFSNAGGSSPFGGINFEDLFGAA 176

Query: 102 EYEAQSPPSP----------------RTDDAHVPIRLTMQE-LYNGKTIRFQAKRNVVCN 144
              A    S                 R D   +   ++ ++ ++    ++ +      C 
Sbjct: 177 FGGAGRGSSSSGGGGSTRSSSMFRQYRGDPIEIVHNVSFKDAVFGSNNVQLKFSALDPCG 236

Query: 145 RCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMC 204
            C GTG++    H   C  C G G    +R    GF  + +  C  C G G   R +D C
Sbjct: 237 TCSGTGMKPNT-HKVNCGTCHGTGTTVHIRG---GF--QMMSTCPTCNGEGTMKRPQDSC 290

Query: 205 KKCHGKRV-TPESKNLNVYIPRGSRHGDRVVLKGE------ADEEPGKIP-----GDLVF 252
            KCHG+ V     K + V +P G + GD V + G+      A EE  K       GD++ 
Sbjct: 291 SKCHGEGVQVNRGKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEEDLKDSVKLSRGDILV 350

Query: 253 DIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGN 312
            I  +   +   +   D++    I ++ A  G    +  T++G+ +++KV  G   +   
Sbjct: 351 RIRVDKDPNFSIKNKYDIWYNKEIPITTAALGGTVTI-PTVEGQKIRIKVAPG--TQYNQ 407

Query: 313 FVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNL 359
            + I N G P     +  GDM VQ  I        +E+   ++L ++
Sbjct: 408 VISIPNMGVP--KTPTIRGDMKVQYKIVVKKPQSLAEKCLWEALADV 452

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (62%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P AT  EIKKAYR+ A+Q HPDK  D+    E+E KF+ V  AY++LS+ E R
Sbjct: 8  YDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDP---EAETKFQAVGEAYQVLSDTELR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD +G  +       GF+D +  F++ FG
Sbjct: 65 SRYDQFGKDDAVPQ--QGFEDAEEYFSAIFG 93

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPYETLGVA DA+  +IKKAY +LA Q HPD   DE     +E KF ++  AYE+LS+E 
Sbjct: 41  DPYETLGVAKDASASQIKKAYYKLAKQFHPDINKDEG----AEKKFHDLQNAYEILSDEN 96

Query: 62  KRQNYDTY 69
           KR+ YD +
Sbjct: 97  KRRQYDQF 104

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.157
           YIR004W
          Length = 425

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 7/103 (6%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE LGV P AT  EIKKAYR+ ++Q HPDK  D+ +  E   +F+ ++ AY++LS+E+ R
Sbjct: 8   YEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATE---RFQAISEAYQVLSDEDLR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRYQDEYE 104
             YD +G T        GF+D    F+  FG  A   Y  E +
Sbjct: 65  GKYDRFGKTEAVPK--GGFEDAAEQFSVIFGGDAFASYIGELQ 105

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {ON}
           Anc_7.157 YIR004W
          Length = 470

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 60/98 (61%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LG+ P ATQ EIKKAYR+ +++ HPDK  ++    E   +F++++ AY++LS+E  R
Sbjct: 8   YDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATE---RFQQISEAYQVLSDEHLR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQD-GD-FASFFGNFASNRY 99
            NYD +G       +  GF+D GD F+  FG  A   Y
Sbjct: 65  NNYDQFGKEQAIPKE--GFEDAGDLFSVIFGGDAFESY 100

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG++P AT  EIKKAYRR A++ HPDK  D+    E+E KF+ V  AY++LS+E  R
Sbjct: 8  YDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDP---EAENKFQAVGEAYQVLSDESLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD YG  +       GF+D +  F   FG
Sbjct: 65 ARYDEYGKDDAVP--QQGFEDANEYFTVIFG 93

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (61%), Gaps = 7/94 (7%)

Query: 1  MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
          M+ Y+ LG+ PDAT  EIKKAYRR A+Q HPDK  D+    +++ KF+ V  AY++LS+ 
Sbjct: 5  MEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDP---DAQSKFQAVGEAYQVLSDP 61

Query: 61 EKRQNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
          + +  YD +G  +      +GF+D +  F   FG
Sbjct: 62 QLKSRYDQFGKDDAVP--QAGFEDAEEYFTVIFG 93

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 49/67 (73%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG++P A + EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+ +KR
Sbjct: 8  YDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAQKR 61

Query: 64 QNYDTYG 70
          + YDTYG
Sbjct: 62 EVYDTYG 68

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKI 274
           E   +++ +  G + G ++  KGE D  P       +  + +        R+ +DL   +
Sbjct: 215 EKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVLQEKPHEFFTRQDNDLIYTL 274

Query: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMY 334
            +S  ++L GF K+V  T+DG+   + +   Q ++P        +G  L    S+ GD+ 
Sbjct: 275 PLSFKESLLGFSKQV-QTIDGK--TIPITRTQPIQPTQTSTYPGQGMTLSKNPSQRGDLI 331

Query: 335 VQIDIEFP 342
           ++  I++P
Sbjct: 332 IKFKIDYP 339

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV P AT  EIKKAYRR A+Q HPDK  D+    E++ KF+EV  AY++LS+   R
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDP---EAQAKFQEVGEAYQVLSDPGLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD +G          GF+D +  F + FG
Sbjct: 65 SRYDEFGKDEAVPQ--QGFEDANEYFTAIFG 93

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
           {ON} similar to uniprot|P40564 YIR004W Saccharomyces
           cerevisiae DJP1 Cytosolic J-domain-containing protein,
           required for peroxisomal protein import
          Length = 433

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGVA DA Q +IKKAYR+ +++ HPDK  D+    E   +F+ ++ AY++LS+EE R
Sbjct: 8   YDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATE---RFQAISEAYQVLSSEELR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRY 99
             YD +G       +  GF+D    FA+ FG  A   Y
Sbjct: 65  MKYDKFGKEEAMPKN--GFEDAGEQFAAIFGGEAFTSY 100

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 57/91 (62%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG++P+AT  EIKKAYR++A+  HPDK  D+    E++ KF+ V  AY++L++   R
Sbjct: 8  YDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDP---EAQAKFQAVGEAYQVLNDPALR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
          + YD +G  N       GF+D +  F + FG
Sbjct: 65 KQYDEFGKDNAVPQ--QGFEDAEEYFTAIFG 93

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 49/67 (73%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK YR+ AL++HPDK S ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDAE------KFKEISEAFEILNDPQKR 61

Query: 64 QNYDTYG 70
          + YDTYG
Sbjct: 62 EVYDTYG 68

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 64/130 (49%), Gaps = 7/130 (5%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKI 274
           E + +++ +  G + G ++  K E D  P       +  I +    S+  R G+DL   +
Sbjct: 214 EKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQEKPHSNYTRDGNDLIYSL 273

Query: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQV--VRPGNFVRIDNEGWPLDDQGSKFGD 332
            ++  ++L GF K +  T+DGR L    P+ +V  V+P +      +G P+    S+ G+
Sbjct: 274 PLTFKESLLGFSKTI-QTIDGRTL----PISRVQPVQPSDSSTYPGQGMPIAKTPSQRGN 328

Query: 333 MYVQIDIEFP 342
           + V+  I++P
Sbjct: 329 LIVKYKIDYP 338

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 59/94 (62%), Gaps = 7/94 (7%)

Query: 1  MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
          ++ Y+ LGV+P A+  EIKKAYR+ A++ HPDK  D+    +++ KF+ V  AY++LS+E
Sbjct: 5  LEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDP---DAQAKFQRVGEAYQVLSDE 61

Query: 61 EKRQNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
          E R+ YD +G    ++    GF D    F + FG
Sbjct: 62 ELRKRYDEFG--KDYAIPQQGFTDAQEYFTAIFG 93

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A   EIKK YR+ ALQ+HPDK +  +       KFK+++ AYE+LS+  KR
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTE------KFKQISEAYEILSDSNKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EVYDQYG 68

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKI 274
           E K +++ + RG + G ++  K E D  P       +  + +  A    +R G +L   +
Sbjct: 201 EKKQIDIQLKRGWKAGTKITYKNEGDFNPRTGGRKTLQFVLQEKAHPLFKRDGENLLYTV 260

Query: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMY 334
            +S  ++L GF K V  T+DGR L L     Q ++P        +G P     ++ GD+ 
Sbjct: 261 PLSFQESLLGFSKTV-QTIDGRSLSLS--RTQPIQPTETTTYPGQGMPNPKNPNQRGDLI 317

Query: 335 VQIDIEFP 342
           +   I++P
Sbjct: 318 ITYKIDYP 325

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {ON}
           similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 395

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 58/99 (58%), Gaps = 8/99 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LG+ PDA+  EIKKAYR+ A+  HPDK  D+    E++ KF+ +  AY++LS+ E R
Sbjct: 8   YDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDP---EAQAKFQAIGQAYQVLSDPELR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDGDFASFFGN-FASNRYQD 101
             YD +G  +       GF+D   A FF   F  + +QD
Sbjct: 65  SRYDEFGKEDAVP--QQGFEDA--AEFFSTIFGGDAFQD 99

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV P A + EIKK YR+ AL++HPDK + ++       KFK+++ AYE+LS+  KR
Sbjct: 8  YDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKQISEAYEILSDSNKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EIYDQYG 68

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 66/145 (45%), Gaps = 3/145 (2%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKI 274
           E   +++ +  G + G ++  K + D  P       +  I +     + +R   +L   +
Sbjct: 222 EKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKTLQFIIDEKPHPTFQREDDNLVCTV 281

Query: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMY 334
            ++  ++L GF K V  T+DGR   L +   Q ++P    R   +G P+  +  + GD+ 
Sbjct: 282 PLTFKESLLGFSKTV-QTIDGR--NLPISRSQPIQPTEITRYPGQGMPISKKPGQRGDLI 338

Query: 335 VQIDIEFPPDHWFSERSDVKSLQNL 359
           V+  I +P     ++R  +K+  N+
Sbjct: 339 VKYKIAYPITLTQAQRDAIKTNFNV 363

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG++P A + EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+ +KR
Sbjct: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EVYDQYG 68

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 57/134 (42%), Gaps = 3/134 (2%)

Query: 209 GKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGS 268
           G    PE   +++ +  G + G ++  K   D  P       +  I +        R G+
Sbjct: 204 GPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGN 263

Query: 269 DLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGS 328
           DL   + ++  ++L GF K +  T+DGR L   V   Q ++P        +G P+     
Sbjct: 264 DLIYTLPLTFKESLLGFNKTI-QTIDGRTLP--VSRIQPIQPSEKSTYPGQGMPIPKTPG 320

Query: 329 KFGDMYVQIDIEFP 342
           + GDM V   +++P
Sbjct: 321 QRGDMIVNYKVDYP 334

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV PDAT ++IKKAYR+ A+Q HPDK  ++    E++ KF+EV+ AY++LS+ E R
Sbjct: 8  YDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDP---EAQAKFQEVSKAYKVLSDGELR 64

Query: 64 QNYDTYG 70
            YD  G
Sbjct: 65 SRYDEVG 71

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A+  E+KK YR+ AL++HPDK + ++       KFKE++ A+E+LS+  KR
Sbjct: 8  YDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPNKR 61

Query: 64 QNYDTYG 70
          + YDTYG
Sbjct: 62 EVYDTYG 68

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 66/134 (49%), Gaps = 3/134 (2%)

Query: 209 GKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGS 268
           G+   PE K +++ +  G + G ++  K E D  P       +  I +       +R G+
Sbjct: 204 GQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQEKPHEFFKRDGN 263

Query: 269 DLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGS 328
           DL   + ++  ++L GF+K V  T+DGR  ++ +   Q V+P   +R   +G PL    S
Sbjct: 264 DLIYTLPLTFKESLLGFDKTV-RTIDGR--QISIHKTQPVQPSEEMRYPGQGMPLSKNPS 320

Query: 329 KFGDMYVQIDIEFP 342
           + GD+ V+   ++P
Sbjct: 321 ERGDLIVKYKTDYP 334

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK Y++ AL++HPDK + ++       KFKE++ AYE+LS+  KR
Sbjct: 8  YDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTE------KFKEISEAYEILSDSSKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EIYDQYG 68

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 61/130 (46%), Gaps = 7/130 (5%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERR-GSDLYAK 273
           E   +++ +  G + G ++  K E D  P +  G           S  L +R G +L   
Sbjct: 218 EKTQIDIQLKPGWKAGTKITYKNEGDYNP-QTGGRKTLQFVLQEKSHPLYKRDGDNLIYS 276

Query: 274 ITISLSDALTGFEKEVCTTLDGRLLKL-KVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGD 332
           + +S  ++L GF K +  T+DGR L + K+   Q V+P        +G P+  +  + GD
Sbjct: 277 LPLSFKESLLGFSKTI-QTIDGRTLPISKI---QPVQPTEVSSYPGQGMPVSKRPGQRGD 332

Query: 333 MYVQIDIEFP 342
           + V+  I++P
Sbjct: 333 LVVKYKIDYP 342

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/91 (43%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV PDAT  EIKKAYRR A+Q HPDK  D+    +++ KF+ V  AY++LS+   R
Sbjct: 8  YDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SRYDEFGKDDAVPK--QGFEDAGEYFTAIFG 93

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A   EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS++ KR
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDKNKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EVYDQYG 68

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 62/134 (46%), Gaps = 3/134 (2%)

Query: 209 GKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGS 268
           G+   PE   +++ +  G + G ++  K + D  P       +  + +       +R G 
Sbjct: 214 GQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQTGGRKTLQFMLQEKNHPVFKREGD 273

Query: 269 DLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGS 328
           DL   + ++  ++L GF K++  T+DGR   L +   Q ++P        +G P+    S
Sbjct: 274 DLTCTLPLTFKESLLGFNKQI-QTIDGRT--LPISRTQPIQPSETSVYPGQGMPIPKTPS 330

Query: 329 KFGDMYVQIDIEFP 342
           + G++ V+  I++P
Sbjct: 331 QRGNLIVRYKIDYP 344

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+PDA   EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LS++E R
Sbjct: 8   YDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLSSDELR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRY 99
             YD +G       +  GF+D    FA+ FG  A   Y
Sbjct: 65  AKYDKFGKEEAVPQN--GFEDAGEQFAAIFGGEAFASY 100

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V+P A + EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+ EKR
Sbjct: 8  YDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAEKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EVYDQYG 68

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 60/130 (46%), Gaps = 7/130 (5%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKI 274
           E   + + +  G + G ++  K + D  P       +  I +   +++ +R   +L   +
Sbjct: 218 EKAQIEIALKAGWKAGTKITYKNQGDYNPSTGGRKTLQFILKEKPNTNFKRDEDNLIYTL 277

Query: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQV--VRPGNFVRIDNEGWPLDDQGSKFGD 332
            ++  ++L GF+K +  T+DG+ L    P+ +V  V+P        +G P+     + GD
Sbjct: 278 PLTFKESLLGFQKTI-KTIDGKTL----PISRVQPVQPSECTTYPGQGMPISKSVGQRGD 332

Query: 333 MYVQIDIEFP 342
           M V+  + +P
Sbjct: 333 MIVKFKVGYP 342

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
           Anc_7.157
          Length = 414

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 57/98 (58%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE LG++P AT  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LS++  R
Sbjct: 8   YELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSDDTLR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRY 99
             YD YG          GF+D    F++ FG  A + Y
Sbjct: 65  LKYDKYGKKEAVPT--GGFEDAAEQFSAIFGGDAFSSY 100

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {ON}
           similar to uniprot|P40564 YIR004W Saccharomyces
           cerevisiae DJP1 Cytosolic J-domain-containing protein,
           required for peroxisomal protein import
          Length = 429

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 12/100 (12%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+P+A   EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LSNEE R
Sbjct: 8   YDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATE---RFQSISQAYQVLSNEELR 64

Query: 64  QNYDTYGD-----TNGF---SGDYSGFQDGD-FASFFGNF 94
             YD +G       NGF   +  +S    GD FAS+ G  
Sbjct: 65  TKYDKFGKEEAVPQNGFEDAAEQFSAIFGGDAFASYVGEL 104

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 56/91 (61%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG+ P AT  EIKKAYR+ A++ HPDK  D+    +++ KF+ V  AY++LS+++ R
Sbjct: 8  YDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDP---DAQSKFQSVGEAYQVLSDDDLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
          + YD +G  N       GF+D    F + FG
Sbjct: 65 KRYDEFGKDNAVPQ--HGFEDAGEYFTAIFG 93

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG+ PDAT  EIKKAYRR A++ HPDK  D+    +++ KF+ V  AY++LS+   R
Sbjct: 8  YDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SKYDEFGKEDAVPQ--QGFEDASEYFTAIFG 93

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVS---DESLRDESEIKFKEVAAAYELL 57
            DPYE LGV   +T+ EIKKAYR L+L+ HPDK+     E  R   E  F +++ AYE L
Sbjct: 120 FDPYEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEAL 179

Query: 58  SNEEKRQNYDTYGDTNG 74
           +N   ++NY  YG  +G
Sbjct: 180 TNPATKENYLLYGHPDG 196

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
           {ON} highly similar to uniprot|P40564 Saccharomyces
           cerevisiae YIR004w DJP1
          Length = 425

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 56/98 (57%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LG+ P AT  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LS+EE R
Sbjct: 8   YDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSSEELR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRY 99
             YD +G          GF+D    F++ FG  A   Y
Sbjct: 65  AKYDKFGKQEAIPK--GGFEDAAEQFSAIFGGEAFASY 100

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 56/91 (61%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV P+AT  +IKKAYR+ A+Q HPDK  D+    E++ KF+ V  AY++LS+   R
Sbjct: 8  YDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDP---EAQSKFQAVGEAYQVLSDPGLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD +G  +      +GF+D    F++ FG
Sbjct: 65 SKYDQFGKDDAVPN--AGFEDAQEFFSTIFG 93

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG+ P AT  EIKKAYRR A++ HPDK  D+    E   +F++V  AY++LS+ + R
Sbjct: 8  YDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASE---RFQQVGEAYQVLSDPDLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
          + YD +G  N       GF+D    F+  FG
Sbjct: 65 KQYDEFGKDNAVPQ--QGFEDAGEYFSMIFG 93

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {ON}
           Anc_7.157
          Length = 482

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 58/98 (59%), Gaps = 12/98 (12%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LG+ P ATQ EIKKAYR+ +++ HPDK  ++    E   +F+ ++ AY++LS+E  R
Sbjct: 8   YDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATE---RFQAISEAYQVLSDESLR 64

Query: 64  QNYDTYGDT-----NGF---SGDYSGFQDGD-FASFFG 92
             YD YG       NGF   +  +S    GD FAS+ G
Sbjct: 65  LKYDKYGKKEAIPQNGFEDAAEQFSAIFGGDAFASYIG 102

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 55/91 (60%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG+ P+AT  EIKKAYRR A++ HPDK  D+    +++ KF+ V  AY++LS++  R
Sbjct: 8  YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDQGLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SKYDEFGKEDAVPQ--QGFEDASEYFTAIFG 93

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EIYDQYG 68

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 71/152 (46%), Gaps = 15/152 (9%)

Query: 201 EDMC---KKCH-----GKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVF 252
           ED+C   KK       G   T E   +++ + +G + G ++  K E D  P       + 
Sbjct: 208 EDLCAGKKKSFKIGRKGPNGTSEKTQIDIQLKQGWKAGTKITYKNEGDYNPRTGGRKTLQ 267

Query: 253 DIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQV--VRP 310
            + +  A    +R G +L   + +S  ++L GF K +  T+DGR L    P+ +V  ++P
Sbjct: 268 FVLQEKAHPLFKRDGDNLIYTLPLSFKESLLGFSKTI-QTIDGRTL----PISRVQPIQP 322

Query: 311 GNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
               R   +G P+  +  + GD+ V+  I++P
Sbjct: 323 SESSRYPGQGMPITKKPGQRGDLIVKYKIDYP 354

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EIYDQYG 68

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 61/130 (46%), Gaps = 7/130 (5%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKI 274
           E   +++ +  G + G ++  K + D  P       +  + +  +  + +R G DL   +
Sbjct: 227 EKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTL 286

Query: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQV--VRPGNFVRIDNEGWPLDDQGSKFGD 332
            +S  ++L GF K +  T+DGR L    PL +V  V+P        +G P     S+ G+
Sbjct: 287 PLSFKESLLGFSKTI-QTIDGRTL----PLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGN 341

Query: 333 MYVQIDIEFP 342
           + V+  +++P
Sbjct: 342 LIVKYKVDYP 351

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A   EIKK YR+ AL++HPDK +  +       KFKE++ A+E+LS+  KR
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTE------KFKEISEAFEILSDSNKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EVYDQYG 68

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 62/136 (45%), Gaps = 7/136 (5%)

Query: 209 GKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGS 268
           G+    E   +++ +  G + G ++  K   D  P       +  + +     + +R   
Sbjct: 210 GQNGVQEKVQVDIQLKAGWKAGTKITFKNYGDYNPSTGGRKTLQFVIKEKVHPNFKREDD 269

Query: 269 DLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQV--VRPGNFVRIDNEGWPLDDQ 326
            L   + ++  ++L GF+K +  T+DGR L    P+ +V  V+P +      +G P+  +
Sbjct: 270 TLVYYLPLTFKESLLGFQKTI-QTIDGRTL----PISRVQPVQPNDSSTYPGQGMPMTKK 324

Query: 327 GSKFGDMYVQIDIEFP 342
             + GDM V+  IE+P
Sbjct: 325 PGQRGDMIVKYKIEYP 340

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 49/67 (73%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++++KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTE------KFKEISEAFEILNDKQKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EIYDQYG 68

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 7/130 (5%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPG--DLVFDIAENSASSSLERRGSDLYA 272
           E   +++ +  G + G +V  K   D  P +  G   L F I E +     +R G DL  
Sbjct: 224 EKVQIDIQLKAGWKAGTKVTYKNHGDYNP-RTGGRKTLQFVIQEKT-HPLYKRNGDDLEY 281

Query: 273 KITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGD 332
            + ++  ++L GF K +  T+DGR L L       V+P    R   +G P+    S+ GD
Sbjct: 282 TLPLTFKESLLGFSKTI-QTIDGRTLPLS--RSSPVQPTETSRYPGQGMPMPKMPSQRGD 338

Query: 333 MYVQIDIEFP 342
           + V+  I++P
Sbjct: 339 LVVRFKIDYP 348

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EIYDQYG 68

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 61/130 (46%), Gaps = 7/130 (5%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKI 274
           E   +++ +  G + G ++  K + D  P       +  + +  +  + +R G DL   +
Sbjct: 213 EKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTL 272

Query: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQV--VRPGNFVRIDNEGWPLDDQGSKFGD 332
            +S  ++L GF K +  T+DGR L    PL +V  V+P        +G P     S+ G+
Sbjct: 273 PLSFKESLLGFSKTI-QTIDGRTL----PLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGN 327

Query: 333 MYVQIDIEFP 342
           + V+  +++P
Sbjct: 328 LIVKYKVDYP 337

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 49/67 (73%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 64 QNYDTYG 70
          + YD+YG
Sbjct: 62 EIYDSYG 68

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 63/136 (46%), Gaps = 7/136 (5%)

Query: 209 GKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGS 268
           G    PE K +++ +  G + G ++  K E D          +  + +       +R G+
Sbjct: 203 GPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQTMQFVIQEKLHPHFKRDGN 262

Query: 269 DLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQV--VRPGNFVRIDNEGWPLDDQ 326
           +L   + +S  ++L GF K +  T+DGR L    P+ +V  ++P        +G PL   
Sbjct: 263 NLIYTLPLSFKESLLGFSKTI-QTIDGRTL----PISRVQPIQPSETSTYPGQGMPLPKT 317

Query: 327 GSKFGDMYVQIDIEFP 342
            ++ GD+ ++  +++P
Sbjct: 318 PAQRGDLIIKYKVDYP 333

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+PDA Q +IKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++L ++E R
Sbjct: 8   YDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLGSDELR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRY 99
             YD +G       +  GF+D    FA+ FG  A   Y
Sbjct: 65  AKYDKFGKDEAVPQN--GFEDAGEQFAAIFGGEAFASY 100

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EIYDQYG 68

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 75/172 (43%), Gaps = 15/172 (8%)

Query: 178 PGFVTREIVQCDKCKGL-----GKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDR 232
           P +   E VQ +    L     GK    +   K  HG   T E   +++ +  G + G +
Sbjct: 181 PSYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHG---TSEKTQIDIQLKPGWKAGTK 237

Query: 233 VVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTT 292
           +  K + D  P       +  + +  +  + +R G DL   + +S  ++L GF K +  T
Sbjct: 238 ITYKNQGDFNPQTNRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTI-QT 296

Query: 293 LDGRLLKLKVPLGQV--VRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
           +DGR L    PL +V  V+P        +G P     S+ G++ V+  +++P
Sbjct: 297 IDGRTL----PLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 344

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAE------KFKEISEAFEILNDPQKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EIYDNYG 68

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 64/131 (48%), Gaps = 7/131 (5%)

Query: 214 PESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAK 273
           PE + +++ +  G + G ++  K E D  P       +  I +     +  R G+DL   
Sbjct: 210 PEKQQVDIQLRPGWKAGTKITYKNEGDYNPRTGRRQTMQFIIQEKPHENYTRDGNDLIYT 269

Query: 274 ITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQV--VRPGNFVRIDNEGWPLDDQGSKFG 331
           + ++  ++L GF K +  T+DGR L    P+ +V  V+P +      +G P+    S+ G
Sbjct: 270 LPLTFKESLLGFNKTI-QTIDGRTL----PISRVQPVQPSDVSTYPGQGMPVAKNPSQRG 324

Query: 332 DMYVQIDIEFP 342
           ++ V+  I++P
Sbjct: 325 NLIVKYKIDYP 335

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 50/77 (64%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDES---EIKFKEVAAAYELL 57
            DPY+ LGV+  A+  EIK AYR+L+L+ HPDKV+ +   +E    E  + +++ AYE L
Sbjct: 119 FDPYDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEAL 178

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  +QNY  YG  +G
Sbjct: 179 TDELVKQNYLMYGHPDG 195

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV P+AT  EIKKAYRR A++ HPDK  D+    E++ KF+ V  AY++LS+   R
Sbjct: 8  YDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDP---EAQSKFQAVGEAYQVLSDPGLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SRYDEFGKDDAVP--QHGFEDATEFFTTIFG 93

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEI---KFKEVAAAYELL 57
            DPYE LG++  A+  +IK AYR+L+++ HPDKV+     DE  +    + ++  AYE L
Sbjct: 124 FDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYESL 183

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  RQNY  YG  +G
Sbjct: 184 TDELVRQNYLKYGHPDG 200

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EIYDQYG 68

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 76/174 (43%), Gaps = 19/174 (10%)

Query: 178 PGFVTREIVQCDKCKGL-----GKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDR 232
           P +   E VQ +    L     GK    +   K  HG     E   +++ +  G + G +
Sbjct: 190 PTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHG---AAEKTQIDIQLKPGWKAGTK 246

Query: 233 VVLKGEAD--EEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVC 290
           +  K + D   + G+    L F I E     + +R G DL   + +S  ++L GF K + 
Sbjct: 247 ITYKNQGDFNSQTGR-RKTLQFVIQEK-GHPNFKRDGDDLIYTLPLSFKESLLGFSKTI- 303

Query: 291 TTLDGRLLKLKVPLGQV--VRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342
            T+DGR L    PL +V  V+P        +G P     S+ G++ V+  +++P
Sbjct: 304 QTIDGRTL----PLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 50/77 (64%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVS---DESLRDESEIKFKEVAAAYELL 57
            DPYE LG++  A+  +IK AYR+L+L+ HPDK+     E+ R+  E ++ ++  AYE L
Sbjct: 120 FDPYELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESL 179

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  R NY TYG  +G
Sbjct: 180 TDELIRFNYLTYGHPDG 196

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG+ P+AT  EIKKAYRR A++ HPDK  D+    +++ KF+ V  AY++LS+   R
Sbjct: 8  YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SKYDEFGKEDAVPQ--QGFEDASEYFTAIFG 93

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEI---KFKEVAAAYELL 57
            DPYE LG++  A+  +IK AYR+L+++ HPDK++     DE ++    + ++  AYE L
Sbjct: 124 FDPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESL 183

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  RQNY  YG  +G
Sbjct: 184 TDELVRQNYLKYGHPDG 200

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDE---SLRDESEIKFKEVAAAYELL 57
            DPY  LGV+P AT  +IK AYR+L+++ HPDK+S +     R   E  + +++ AYE L
Sbjct: 122 FDPYALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEAL 181

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  + NY TYG  +G
Sbjct: 182 TDEITKANYLTYGHPDG 198

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 393

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 70/130 (53%), Gaps = 24/130 (18%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LG++PDAT  EIKKAYR+ A+  HPDK  ++    +++ KF+ V  AY++LS+   R
Sbjct: 8   YDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDP---DAQAKFQAVGQAYQVLSDPGLR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQD----------GD-FASFFGNF--------ASNRYQDEYE 104
             YD +G  +       GF+D          GD F+ + G F        +++ + DE +
Sbjct: 65  SRYDEFGKDDAVP--QQGFEDAGEFFTTIFGGDGFSDWIGEFSLLKDMTKSADIFGDEEQ 122

Query: 105 AQSPPSPRTD 114
           ++SP    TD
Sbjct: 123 SESPEDATTD 132

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 58/103 (56%), Gaps = 7/103 (6%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LG+ P+AT  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LSN+E R
Sbjct: 8   YDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATE---RFQAISEAYQVLSNDELR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRYQDEYE 104
             YD  G          GF+D    F++ FG  A   Y  E +
Sbjct: 65  AKYDRLGKQEAVPK--GGFEDAAEQFSAIFGGDAFASYIGELQ 105

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG+ P+AT  EIKKAYRR A++ HPDK  D+    +++ KF+ V  AY++LS+   R
Sbjct: 8  YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SKYDQFGKEDAVPQ--QGFEDASEYFTAIFG 93

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESL---RDESEIKFKEVAAAYELL 57
            DPY+ LG++  A++ EIK AYR+L+++ HPDK++ E     R   E  + ++  AYE L
Sbjct: 118 FDPYDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEAL 177

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  RQN+  YG  +G
Sbjct: 178 TDELTRQNFLKYGHPDG 194

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG+ PDA+  +IKKAYR+ A+  HPDK  D+    E++ KF+ +  AY++LS+ + R
Sbjct: 8  YDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDP---EAQAKFQAIGEAYQVLSDPDLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
            YD +G  N       GF+D    F + FG
Sbjct: 65 SRYDEFGKENAVP--QQGFEDAAEFFTTIFG 93

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV P+AT  EIKKAYRR A++ HPDK  ++     ++ KF+ V  AY++LS++E R
Sbjct: 8  YDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDP---NAQAKFQAVGEAYQVLSDDELR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
          + YD  G  +       GF D    F + FG
Sbjct: 65 KRYDQLGKESAVPQ--QGFVDPSEYFTAIFG 93

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 50/77 (64%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDE---SEIKFKEVAAAYELL 57
            DPY+ LG++P A+  +IK AYRRL+L+ HPDK+S E   +E    E  + +++ A+E L
Sbjct: 124 FDPYDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEAL 183

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++   R+NY  YG  +G
Sbjct: 184 TDPIVRENYLKYGHPDG 200

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar to
           uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 56/110 (50%), Gaps = 6/110 (5%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVS----DESLRDESEIKFKEVAAAYELLSN 59
           YE LGV  DA+ DEIK  YR++ L  HPDK      D +++  S +   ++  AY +LSN
Sbjct: 12  YEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRVLSN 71

Query: 60  EEKRQNYD-TYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSP 108
           ++ R  Y+    D+N  +G ++ F DG        F  N  + EY    P
Sbjct: 72  DQLRAAYNRALNDSNKLAG-FNNFGDGLDEFNLDEFEFNEEKLEYVMTCP 120

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEI---KFKEVAAAYELL 57
            DPYE LGV+  A+  +IK AYR+L+++ HPDK++     DE  +    + ++  AYE L
Sbjct: 124 FDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESL 183

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  RQNY  YG  +G
Sbjct: 184 TDELVRQNYLKYGHPDG 200

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEI---KFKEVAAAYELL 57
            DPYE LG++  A+  +IK AYR+L+++ HPDK++     DE  +    + ++  AYE L
Sbjct: 124 FDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESL 183

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  RQNY  YG  +G
Sbjct: 184 TDELVRQNYLKYGHPDG 200

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.157
           YIR004W
          Length = 434

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 67/126 (53%), Gaps = 19/126 (15%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV P++T  EIKKAYR+ +++ HPDK  +     ++  KF+ ++ AY++LS++  R
Sbjct: 8   YDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPN---NPDATKKFQAISEAYQVLSDKNLR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDGD--FASFFGNFASNRY------------QDEYEAQSPP 109
            NYD +G          GF+D +  F + FG  A   Y            Q+E+E+ +  
Sbjct: 65  SNYDKFGKDKAIPK--GGFEDANEQFTAMFGGEAFKDYIGELTLLTDLQKQEEFESSAND 122

Query: 110 SPRTDD 115
              TD+
Sbjct: 123 EKNTDN 128

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVS---DESLRDESEIKFKEVAAAYELL 57
            DPYE LG++  A++ +IK AYR+L+++ HPDK+S    E  R   E  + ++  AYE L
Sbjct: 128 FDPYELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEAL 187

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  R+N+  YG  +G
Sbjct: 188 TDEAMRENFLKYGHPDG 204

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 53/73 (72%), Gaps = 5/73 (6%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V+ DA+  EIKK+YR+LA++ HPDK  D+    +++ KF+E+A AY++L +++ R
Sbjct: 8  YDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDP---QAQTKFQELAKAYQVLIDDDLR 64

Query: 64 QNYDTYG--DTNG 74
          + YD +G  +TNG
Sbjct: 65 KKYDQFGLDETNG 77

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
           (REAL)
          Length = 224

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 54/107 (50%), Gaps = 22/107 (20%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE L V   AT  EIKKAYR+LA++ HPDK S     +     FK +  A+E+LSNEEKR
Sbjct: 23  YEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASE----AFKVINRAFEVLSNEEKR 78

Query: 64  QNYDTYG------------DTNGFSGDY------SGFQDGDFASFFG 92
             YD  G              +GF G        SGF+D  F S FG
Sbjct: 79  SIYDRIGRDPDDRQMPSSSAASGFRGSAGGSPMGSGFEDMFFNSRFG 125

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (68%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++   R
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNTR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EVYDQYG 68

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 60/128 (46%), Gaps = 3/128 (2%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKI 274
           E   +++ +  G + G +V  K + D  P       +  + +  A    +R G DL   +
Sbjct: 188 EKTQIDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKTLQFVIQEKAHPDFKRDGDDLIYIL 247

Query: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMY 334
            +S  ++L GF K +  T+DGR  KL +   Q ++P        +G P+    S+ G++ 
Sbjct: 248 RLSFKESLLGFSKTI-NTIDGR--KLPLSRSQPIQPTEISTYPGQGMPVSKNPSQRGNLI 304

Query: 335 VQIDIEFP 342
           ++  I++P
Sbjct: 305 IKYKIDYP 312

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+  A+  EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+  KR
Sbjct: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSNKR 61

Query: 64 QNYDTYG 70
            YD YG
Sbjct: 62 SVYDQYG 68

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (68%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EIYDQYG 68

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 7/130 (5%)

Query: 215 ESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPG--DLVFDIAENSASSSLERRGSDLYA 272
           E   +++ +  G + G ++  K + D  P K  G   L F I+E       +R   +L  
Sbjct: 228 EKTQIDIQLKPGWKAGTKITYKSKGDYNP-KTGGRKTLQFIISEK-PHPHFKREDDNLIY 285

Query: 273 KITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGD 332
            + ++  ++L GF K +  T+DG+ L L    GQ V+P        +G P+  +  + GD
Sbjct: 286 TLPLTFKESLLGFSKTI-QTIDGKNLPLS--RGQPVQPSETTTYPGQGMPITKKPGQRGD 342

Query: 333 MYVQIDIEFP 342
           + ++  +++P
Sbjct: 343 LLIKYKVDYP 352

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVS---DESLRDESEIKFKEVAAAYELL 57
            DPYE LGV   +T  EIK AYR+L+++ HPDK+S   +E  R   E +F  +  AY+ L
Sbjct: 110 FDPYELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKAL 169

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  ++NY  YG  +G
Sbjct: 170 TDEITKENYRKYGHPDG 186

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (68%), Gaps = 6/67 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+P+    E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++  KR
Sbjct: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNKR 61

Query: 64 QNYDTYG 70
          + YD YG
Sbjct: 62 EVYDKYG 68

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 65/134 (48%), Gaps = 3/134 (2%)

Query: 209 GKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGS 268
           G    PE K +++ +  G + G ++  K E D  P       +  I +      L+R G+
Sbjct: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGN 261

Query: 269 DLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGS 328
           DL   + +S  ++L GF K V  T+DGR  ++ +   Q V+P    R   +G PL    S
Sbjct: 262 DLTYTLPLSFKESLLGFSKTVH-TIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPS 318

Query: 329 KFGDMYVQIDIEFP 342
           + GD+ V+  I++P
Sbjct: 319 ERGDLIVKYKIDYP 332

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 58/93 (62%), Gaps = 7/93 (7%)

Query: 1  MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
          +DPY TL ++ DA   ++KK+YRRL L++HPDK+S++  ++E++ +F +V  +YE+L+  
Sbjct: 11 IDPYATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVLT-- 68

Query: 61 EKRQNYDTYGDTNGFSGDYSGFQD--GDFASFF 91
          + R+ YD  G        Y+   D  GD+   F
Sbjct: 69 KFREIYDKSG---SIEACYATASDSLGDWKDLF 98

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 56/92 (60%), Gaps = 9/92 (9%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG++  AT  EIKKAYR+ +++ HPDK  ++    E   +F+ ++ AY++LS+++ R
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATE---RFQAISEAYQVLSDKQLR 64

Query: 64 QNYDTYGDTNGF-SGDYSGFQDG--DFASFFG 92
           NYD YG      SG   GF+D    F+  FG
Sbjct: 65 SNYDKYGKEKAIPSG---GFEDAAEQFSVIFG 93

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} similar
           to uniprot|P40564 YIR004W Saccharomyces cerevisiae DJP1
           Cytosolic J-domain-containing protein, required for
           peroxisomal protein import
          Length = 419

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 56/98 (57%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+PDA   +IKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LS ++ R
Sbjct: 8   YDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKDDLR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRY 99
             YD +G       +  GF+D    F+  FG  A   Y
Sbjct: 65  AKYDKFGKEEAVPKE--GFEDAAEQFSMIFGGDAFASY 100

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
           (DJP1) - involved in peroxisome biogenesis [contig 135]
           FULL
          Length = 421

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 54/98 (55%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV P A   +IKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LS E+ R
Sbjct: 9   YDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKEDLR 65

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRY 99
             YD YG       +  GF+D    F+  FG  A   Y
Sbjct: 66  AKYDKYGKEEAIPKE--GFEDAAEQFSMIFGGDAFASY 101

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 51/77 (66%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDE---SEIKFKEVAAAYELL 57
            DPYE LG++  A+  +IK AYR+L+++ HPDK+S +  ++E    E K+ ++  AYE L
Sbjct: 120 FDPYELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEAL 179

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  ++N+  YG  +G
Sbjct: 180 TDEVIKENFLKYGHPDG 196

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
           HLJ1Co-chaperone for Hsp40p, anchored in the ER
           membrane; with its homolog Ydj1p promotes ER-associated
           protein degradation (ERAD) of integral membrane
           substrates; similar to E. coli DnaJ
          Length = 224

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 54/107 (50%), Gaps = 22/107 (20%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE L V   AT  EIKKAYR+LA++ HPDK S     +     FK +  A+E+LSNEEKR
Sbjct: 23  YEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGE----AFKVINRAFEVLSNEEKR 78

Query: 64  QNYD------------TYGDTNGFSGDY------SGFQDGDFASFFG 92
             YD            + G  +GF G         GF+D  F S FG
Sbjct: 79  SIYDRIGRDPDDRQMPSRGAASGFRGSAGGSPMGGGFEDMFFNSRFG 125

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 40/67 (59%)

Query: 1  MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
          +  YE L +  DATQDEIKKAYR   L  HPDK+S       S +   ++  AY++LSN 
Sbjct: 7  LTHYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNI 66

Query: 61 EKRQNYD 67
          + R+ YD
Sbjct: 67 KTRREYD 73

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDE---SLRDESEIKFKEVAAAYELL 57
            DPYE LGV+  A   EIK AYR+L+++ HPDK+  +     R + E  + ++  AYE L
Sbjct: 121 FDPYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESL 180

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  ++NY  YG  +G
Sbjct: 181 TDENVKENYLRYGHPDG 197

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 1  MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
          +  YE L +  DATQ+EIKKAYR   L  HPDK++  +    + +   ++  AY++LSN 
Sbjct: 7  LTHYEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNN 66

Query: 61 EKRQNYD 67
          +KR  YD
Sbjct: 67 QKRGEYD 73

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKE----VAAAYEL 56
            DPYE LG+   AT+ E++ +YR+L+++ HPDK+S + L  E  ++ +E    +  AY+ 
Sbjct: 114 FDPYELLGIGTSATEREVRSSYRKLSVKFHPDKLSKD-LSQEERLQLEEQYVLITKAYKA 172

Query: 57  LSNEEKRQNYDTYGDTNG 74
           L+ E  R+NY  YG  +G
Sbjct: 173 LTEEVTRENYLKYGHPDG 190

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 50/91 (54%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV PDAT  EIKKAYR+ AL   P+K       +E   KF+ +A AY++L ++E R
Sbjct: 8  YELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANE---KFQAIAEAYQVLHSKELR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDGD--FASFFG 92
          + YD  G          GF+D    F + FG
Sbjct: 65 EKYDKLGKEAAIPK--KGFEDASEYFPTIFG 93

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
           (REAL)
          Length = 224

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 53/107 (49%), Gaps = 22/107 (20%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE L V   AT  +IKKAYR+LA++ HPDK S     +     FK +  A+E+LSNEEKR
Sbjct: 23  YEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGE----AFKVINRAFEVLSNEEKR 78

Query: 64  QNYDTYG------------DTNGFSGDY------SGFQDGDFASFFG 92
             YD  G              +GF G         GF+D  F S FG
Sbjct: 79  SIYDRIGRDPDDRQIPSRSAASGFQGSAGGSPMGGGFEDMFFGSRFG 125

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 471

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 121/285 (42%), Gaps = 25/285 (8%)

Query: 112 RTDDAHVPIRLTMQE-LYNGKTIRFQAKRNVVCNRCEGTGVRRRARHA-SACSQCEGHGV 169
           + ++  VP +++ ++ ++  K ++   +    C+ C+G+G++  A H+ S C  C G G 
Sbjct: 168 KGENVTVPFQVSFKDAVFGVKNVKLNYQCYDPCSSCDGSGLK--AGHSRSVCPTCHGTGT 225

Query: 170 KQRLRRLGPGFVTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPES-KNLNVYIPRGSR 228
           +  +R    GF  +    C  C G G  ++  D C  CH       S K + V +P G +
Sbjct: 226 QVHVR---AGF--QMASTCQTCDGEGSTIKDSDKCGTCHSHGFKLNSNKTITVDLPHGLQ 280

Query: 229 HGDRVVLKGEAD-----------EEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITIS 277
            GD + +  +              E     GDL+  +     +        D+     I 
Sbjct: 281 DGDTIRVPNQGSYPGMAIDPSMKSELHLTRGDLLIRVRVRKDTRFQVSNNYDIIYTQEIP 340

Query: 278 LSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQI 337
           ++ A  G   EV  T++   ++LKV  G   +    +RI N+G P   +G + GDM V+ 
Sbjct: 341 ITTAALGGVIEV-PTVEEEKIRLKVSSG--TQHDQVIRIPNKGVPRGARGDR-GDMLVKF 396

Query: 338 DIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANT 382
            I        +ER   ++L +L     +    +   +SA D +++
Sbjct: 397 KIVIKKPKDETERYLWETLAHLTNDTTARRTITPSGSSAKDNSSS 441

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {ON}
           similar to gnl|GLV|CAGL0J01936g Candida glabrata
           CAGL0J01936g and some similarites with uniprot|P40564
           YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
           J-domain- containing protein, required for peroxisomal
           protein import
          Length = 418

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 53/98 (54%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV   AT  EIKKAYR+ ++  HPDK  D+    E   +F+ ++ AY++LSN++ R
Sbjct: 8   YDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATE---RFQSISEAYQVLSNKDLR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRY 99
            NYD  G          GF+D    F+  FG  A   Y
Sbjct: 65  ANYDKSGKEKAIPK--GGFEDAAEQFSVIFGGEAFAAY 100

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (56%), Gaps = 9/97 (9%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+  AT  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++L ++E R
Sbjct: 8  YDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDDELR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDG--DFASFFGN--FAS 96
            YD YG          GF+D    F+  FG   FAS
Sbjct: 65 AKYDKYGRKEAIP--QGGFEDAAEQFSVIFGGDAFAS 99

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSD---ESLRDESEIKFKEVAAAYELL 57
            DPY  LGVA  AT  E++ AYR+L+++ HPDK++    +  R E E ++  +  AY+ L
Sbjct: 115 FDPYTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKAL 174

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  ++NY  +G  +G
Sbjct: 175 TDEITKENYLKFGHPDG 191

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {ON}
           Anc_1.113 YJR097W
          Length = 159

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 50/100 (50%), Gaps = 8/100 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YETLG+  D + +EIKKAY+   L  HPDK+ DES    S ++  ++  AY++L +   R
Sbjct: 6   YETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGDES----SSVEVNKIQEAYKVLCDVNLR 61

Query: 64  QNYD----TYGDTNGFSGDYSGFQDGDFASFFGNFASNRY 99
           + YD          GF G   G  D     F+ N A   Y
Sbjct: 62  EKYDESLKKQYKHQGFLGSGDGLDDYSLDEFYFNPAIMEY 101

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.157
           YIR004W
          Length = 411

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 54/98 (55%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE LG+   AT  EIKKAYR+ +++ HPDK  ++    E   +F+ ++ AY++LS+ + R
Sbjct: 8   YELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATE---RFQAISEAYQVLSDSDLR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRY 99
            NYD +G          GF+D    F+  FG  A   Y
Sbjct: 65  ANYDKFGKEKAIPK--GGFEDAAEQFSVIFGGEAFEPY 100

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESL------RDESEIKFKEVAAAYELL 57
          YE L +  DAT  EIKKAY++  L  HPDK S + L       D + +   ++  AY++L
Sbjct: 11 YEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAYKIL 70

Query: 58 SNEEKRQNYD 67
          SNE  R+ YD
Sbjct: 71 SNESTREQYD 80

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L V P A  +E+KKAYRR ALQ+HPDK + E++ + +EI F  + AAYE+LS+ ++R
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDK-NPENVEEATEI-FASIRAAYEVLSDPQER 63

Query: 64 QNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
           (REAL)
          Length = 225

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 56/108 (51%), Gaps = 23/108 (21%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ L V   AT  EIKKAYR+LA++ HPDK    +   ++   FK +  A+E+LSNEEKR
Sbjct: 23  YQILKVDKKATDGEIKKAYRKLAIKLHPDK----NPHPKASEAFKIINRAFEVLSNEEKR 78

Query: 64  QNYD-------------TYGDTNGFSGDY------SGFQDGDFASFFG 92
             YD             + G  +GF G+        GF+D  F S FG
Sbjct: 79  GLYDRIGRDPDDRQMPSSRGAASGFQGNAGGSPMGGGFEDMFFNSRFG 126

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {ON}
           Anc_2.15 YNL227C
          Length = 626

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 64/146 (43%), Gaps = 21/146 (14%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE LGV  +AT  E+KKAYRR ALQ HPDK  D    +E+   F  V AAYE+L++ ++R
Sbjct: 6   YELLGVETNATDVELKKAYRRKALQFHPDKNPDNV--EETTAIFASVRAAYEVLADPQER 63

Query: 64  QNYDTY--------------GDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPP 109
             YD +               D +      +G    +   FF +     +       SP 
Sbjct: 64  AWYDDHKEQILNDSVNLDDADDESHLDSSITGVTSDELLMFFNSSLYTNF-----GNSPS 118

Query: 110 SPRTDDAHVPIRLTMQELYNGKTIRF 135
                   +  +L M E+Y  + +R 
Sbjct: 119 GVYQIIGKIFAKLAMDEVYWARRLRL 144

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 47/77 (61%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEI---KFKEVAAAYELL 57
            DPY  L V+  +T  EI+ AYR+L+++ HPDK+S +   +E  I   ++  +  AY+ L
Sbjct: 116 FDPYALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKAL 175

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  R+NY  YG  +G
Sbjct: 176 TDEVTRENYLKYGHPDG 192

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 55/97 (56%), Gaps = 9/97 (9%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+  A+  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++L +++ R
Sbjct: 8  YDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLGDDDLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDG--DFASFFGN--FAS 96
            YD YG          GF+D    F+  FG   FAS
Sbjct: 65 AKYDKYGRKEAIP--QGGFEDAAEQFSVIFGGDAFAS 99

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEI---KFKEVAAAYELL 57
            DPY  L ++  +T  EI+ AYR+L+++ HPDK+S +   DE  +   ++  +  AY+ L
Sbjct: 114 FDPYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKAL 173

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  R+NY  YG  +G
Sbjct: 174 TDEITRENYLRYGHPDG 190

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   A+  E+KKAYR+ ALQ+HPDK  D    +E+  KF  + AAYE+LS+ ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--EEATQKFAIIRAAYEVLSDSQER 63

Query: 64 QNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
           (REAL)
          Length = 431

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 53/98 (54%), Gaps = 7/98 (7%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV+  A+  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++L + E R
Sbjct: 8   YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDNELR 64

Query: 64  QNYDTYGDTNGFSGDYSGFQDG--DFASFFGNFASNRY 99
             YD YG          GF+D    F+  FG  A   Y
Sbjct: 65  VKYDKYGRKEAIP--QGGFEDAAEQFSVIFGGDAFASY 100

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   A+  E+KKAYR+ ALQ+HPDK  D    +E+  KF  + AAYE+LS+ ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--EEATEKFAIIRAAYEVLSDSQER 63

Query: 64 QNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
           Anc_2.350 YMR161W
          Length = 225

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 15/106 (14%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE L +   A+ +EIKK+YR+LA++ HPDK    +    +   FK +  A+E+LS+EEKR
Sbjct: 26  YEVLQIERSASDNEIKKSYRKLAIKLHPDK----NPHPRASEAFKVINRAFEVLSDEEKR 81

Query: 64  QNYDTYG-----------DTNGFSGDYSGFQDGDFASFFGNFASNR 98
           + YD  G            ++GF    +GF  G   SF+   A+ R
Sbjct: 82  RLYDRLGRDPDDRNMPSASSSGFRTASAGFPAGFENSFYSRRAATR 127

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 7/85 (8%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   A+  E+KKAYR+ ALQ+HPDK  D    +E+  KF  + AAYE+LS+ ++R
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDKNPDNV--EEATQKFAVIRAAYEVLSDPQER 63

Query: 64 QNYDTY-----GDTNGFSGDYSGFQ 83
            YD++      DT   + DY  ++
Sbjct: 64 AWYDSHKEQILNDTPPSTDDYYDYE 88

>KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa]
          {ON} conserved hypothetical protein
          Length = 283

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (61%), Gaps = 6/86 (6%)

Query: 1  MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
          +DPYE LGV    T+ E+KK YR+L L+ HPDK  D +   E++ KF ++  A+E+L  +
Sbjct: 13 IDPYEVLGVNKSVTEKELKKCYRKLMLRCHPDKTKDWT--PEAKEKFHKIQFAFEVL--D 68

Query: 61 EKRQNYDTYGDTNG-FSG-DYSGFQD 84
          + ++ YD  G     F G D++ ++D
Sbjct: 69 KFKETYDKTGSVEACFKGSDFADWKD 94

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 55/97 (56%), Gaps = 9/97 (9%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+  A+  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++L ++E R
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATE---RFQAISEAYQVLGDDELR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDG--DFASFFGN--FAS 96
            YD +G          GF+D    F+  FG   FAS
Sbjct: 65 AKYDKFGRKEAIP--QGGFEDAAEQFSVIFGGDAFAS 99

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (69%), Gaps = 4/69 (5%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPYETLGV+ DA+  +IKKAY +LA ++HPD   DE     +E KF ++  AYE+LS+E 
Sbjct: 51  DPYETLGVSRDASTSQIKKAYYKLAKKYHPDINKDEG----AEKKFHDLQNAYEILSDES 106

Query: 62  KRQNYDTYG 70
           KR  YD +G
Sbjct: 107 KRSQYDQFG 115

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 4/83 (4%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   A+  E+KKAYR+ ALQ+HPDK  D ++++ +E KF  + AAYE+LS+ ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD-NVQEATE-KFAIIRAAYEVLSDPQER 63

Query: 64 QNYDTYGD--TNGFSGDYSGFQD 84
            YD++ +   N  + D  G+ D
Sbjct: 64 AWYDSHKEQILNDTAPDADGYYD 86

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 5/89 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV+  A   E+KKA+RR ALQ+HPDK  D    +E+   F ++ AAYE+L++ ++R
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDKNRDNV--EEATETFAQIRAAYEVLNDPQER 63

Query: 64 QNYDTYGDTNGFSGDYSG--FQDGDFASF 90
            YD++  +   + D +G  ++D ++ S+
Sbjct: 64 AWYDSHK-SQILNDDINGGTYEDDEYGSY 91

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 6/94 (6%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEI--KFKEVAAAYELLSN 59
           D Y+ L V+ DA   +I+K+Y  L  + HPDK    S +++ +I  K  E+  AYE+LS+
Sbjct: 527 DYYKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSD 586

Query: 60  EEKRQNYDT--YGDTNGFSGDYSGFQDGDFASFF 91
           E KR  YD    G+ NG +    G Q+ DF   F
Sbjct: 587 ETKRNEYDLNRSGNHNGMAN--GGAQNFDFGRMF 618

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
           Anc_2.350 YMR161W
          Length = 219

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 8/92 (8%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE L V   A+ +EIKKAYRRLA++ HPDK         S   FK +  A+E+L +E+KR
Sbjct: 25  YEVLQVERTASDNEIKKAYRRLAIKLHPDKNG----HPRSAEAFKVINRAFEVLGDEDKR 80

Query: 64  QNYDTYG----DTNGFSGDYSGFQDGDFASFF 91
           + +D  G    D +  S   SGF  G  + FF
Sbjct: 81  RLFDQLGRDPDDRSAPSRGPSGFDGGVRSPFF 112

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   A+  E+KKAYR+ ALQ HPDK  D    DE+   F  + AAYE+LS+ ++R
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDKNPDNV--DEATENFATIRAAYEVLSDPQER 63

Query: 64 QNYDTY 69
            YD +
Sbjct: 64 AWYDAH 69

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (59%)

Query: 1  MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
          +  YE L +  DATQ+EIKKAYR   L  HPDK++ ++    + +    +  AY++LSN 
Sbjct: 7  LTHYEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNI 66

Query: 61 EKRQNYD 67
          + R  YD
Sbjct: 67 KTRGEYD 73

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L +  +A+ +EIKKAYR+LA++ HPDK    +    +   FK +  A+E+LS+E+KR
Sbjct: 24 YEVLQIEREASDNEIKKAYRKLAIKLHPDK----NKHPRASEAFKRINRAFEVLSDEQKR 79

Query: 64 QNYDTYG 70
          + +D  G
Sbjct: 80 RIFDQVG 86

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIK--FKEVAAAYELLSN 59
           D Y+ LGVAP AT  EI+KAY  L  ++HPDK+       E  I     ++  AYE LS+
Sbjct: 535 DYYKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSD 594

Query: 60  EEKRQNYD 67
           ++KR+ YD
Sbjct: 595 DDKRKEYD 602

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V  DA+  ++KKAYRR ALQ+HPDK  D    +E+   F E+ AAYE+LS+ ++R
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNV--EEATTIFAEIRAAYEVLSDPQER 63

Query: 64 QNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L V   A  +EIKKAYR+LA++ HPDK    +   ++   FK +  A+E+LS+ EKR
Sbjct: 24 YEILKVEKTANDNEIKKAYRKLAVKLHPDK----NPHPKASEAFKIINRAFEVLSDVEKR 79

Query: 64 QNYDTYG 70
          Q YD  G
Sbjct: 80 QLYDRIG 86

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 50/77 (64%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDE---SEIKFKEVAAAYELL 57
            DPY+ LG++  ++  +IK AYR+L+++ HPDK+S +   DE    E K+ ++  AYE L
Sbjct: 121 FDPYDILGISSSSSDKDIKSAYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYEAL 180

Query: 58  SNEEKRQNYDTYGDTNG 74
           ++E  R+NY  YG  +G
Sbjct: 181 TDETVRENYLKYGHPDG 197

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   A+  ++KKAYRR ALQ+HPDK  D    +E+   F  + +AYE+L++ ++R
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKNPDNV--EEATTVFATIRSAYEVLADPQER 63

Query: 64 QNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 2/96 (2%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVS--DESLRDESEIKFKEVAAAYELLSNEE 61
           Y+ LGV   AT  +I+K+Y  +  ++HPDK     E+ + +++ K  E+  AYE+LS+E 
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 62  KRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASN 97
           KR+ YD         G  S F  G F    GNF  N
Sbjct: 567 KRKEYDDQRSGRAPQGQGSPFGQGGFPFGSGNFKMN 602

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   AT  E+KKAYR+ ALQ HPDK  D ++ + +EI F  + +AYE+LS+ ++R
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPD-NVEEATEI-FATIRSAYEVLSDPQER 63

Query: 64 QNYDTY 69
            YD +
Sbjct: 64 AWYDAH 69

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 7/91 (7%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L +   AT  EIKKAYR+ +++ HPDK  ++    E   +F+ ++ AY++LS++  R
Sbjct: 8  YDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTATE---RFQAISEAYQVLSDKNLR 64

Query: 64 QNYDTYGDTNGFSGDYSGFQDG--DFASFFG 92
           NYD +G          GF+D    F++ FG
Sbjct: 65 ANYDKFGKEKAIPK--GGFEDAAEQFSAIFG 93

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   AT  E+KKAYR+ ALQ HPDK  D    DE+   F  + +AYE+LS+ ++R
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPDNV--DEATEIFATIRSAYEVLSDPQER 63

Query: 64 QNYDTY 69
            YD +
Sbjct: 64 AWYDAH 69

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L V   +T++EIKKAYR+LA++ HPDK    +   ++   FK +  A+E+LS+ EKR
Sbjct: 23 YEILKVERTSTENEIKKAYRKLAIRLHPDK----NPHPKASEAFKIINRAFEVLSDNEKR 78

Query: 64 QNYDTYG 70
          + +D  G
Sbjct: 79 RIFDQLG 85

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   A+  ++KKAYRR ALQ+HPDK +  +++  +EI F  + AAYE+LS+ ++R
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDK-NIGNVQQATEI-FASIRAAYEVLSDAQER 63

Query: 64 QNYDTY 69
            YD +
Sbjct: 64 AWYDAH 69

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 2/68 (2%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIK--FKEVAAAYELLSN 59
           D Y+TLGV P AT  EI+KAY  L  ++HPDK+       +  I     ++  AYE LS+
Sbjct: 538 DYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALSD 597

Query: 60  EEKRQNYD 67
           + KR+ YD
Sbjct: 598 DNKRKEYD 605

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 1  MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60
          +  YE L +  DATQ+EIK+AYR   L  HPDK++  +    S +   ++  AY +LS+ 
Sbjct: 7  LTHYEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDI 66

Query: 61 EKRQNYD 67
            R  YD
Sbjct: 67 RSRCEYD 73

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V  DAT  ++K+AYR+ AL +HPDK +  ++ + +E+ F ++ AAYE+LS+ ++R
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDK-NRNNIEEATEV-FAQIRAAYEVLSDAQER 63

Query: 64 QNYDTYGD 71
            YD + D
Sbjct: 64 AWYDAHKD 71

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
           Anc_2.15 YNL227C
          Length = 659

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 68/143 (47%), Gaps = 17/143 (11%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE L V+  A+  E+KKAYR+ ALQ+HPDK  +    +E+   F E+ AAYE+LS+ ++R
Sbjct: 6   YELLEVSEYASDLELKKAYRKKALQYHPDKNRENP--EEATAIFSEIRAAYEVLSDPQER 63

Query: 64  QNYDTYG----------DTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRT 113
             YD++           D        +G    +   FF +    R  D     SP     
Sbjct: 64  AWYDSHKQQILNDTPLEDEYEVDSIVTGVTTDEVLMFFNSSLYTRIDD-----SPAGIYQ 118

Query: 114 DDAHVPIRLTMQELYNGKTIRFQ 136
             + +  RL+  E+ NGK +  +
Sbjct: 119 IISKIFSRLSNDEVNNGKRLSLK 141

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y  LG+ P AT +EI+K+Y +LA Q HPDK   +S    +E+ FK V  A+ +L++EE +
Sbjct: 9  YSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSC---AEL-FKLVVHAHSILTDEETK 64

Query: 64 QNYDT 68
          + YDT
Sbjct: 65 RKYDT 69

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIK--FKEVAAAYELLSN 59
           D Y+ LGV+P+A   EI+KAY  L  ++HPDK+       +  I     ++  AYE LS+
Sbjct: 542 DYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLSD 601

Query: 60  EEKRQNYD 67
           E+KR+ YD
Sbjct: 602 EDKRKEYD 609

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
           [687 nt, 229 aa]
          Length = 228

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 48/85 (56%), Gaps = 7/85 (8%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           D Y  L V   + + EIKK+YR+LA++ HPDK    +   ++   FK +  A+E+LS+ E
Sbjct: 22  DFYNVLKVERSSDETEIKKSYRKLAIKLHPDK----NPHPKASEAFKVINRAFEVLSDNE 77

Query: 62  KRQNYDTYG---DTNGFSGDYSGFQ 83
           KR+ +D  G   D  G S   SGF 
Sbjct: 78  KREIFDRIGRDPDDRGVSSSASGFN 102

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVS---DESLRDESEIKFKEVAAAYELL 57
            DPYE L V   AT  EI+ AYR+L+++ HPDK++    ++ R   E ++  +  AY+ L
Sbjct: 114 FDPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKAL 173

Query: 58  SNEEKRQNYDTYGDTNG 74
           +++  R N+  YG  +G
Sbjct: 174 TDDATRDNFLRYGHPDG 190

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y  LGV  DAT +EI K+YR+LA++ HPDK    S  D+ E  FK V  A+ +L+N E+R
Sbjct: 11 YSLLGVHFDATNEEISKSYRKLAMKLHPDK----SKSDKCEELFKLVVHAHSVLTNGEER 66

Query: 64 QNYD 67
            Y+
Sbjct: 67 AKYN 70

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L V   A++ +IKKAYR+LA++ HPDK    +    +   FK++  A+E+LS++ KR
Sbjct: 24 YEMLKVGKSASESDIKKAYRKLAIKLHPDK----NRHPRASEAFKKINRAFEVLSDDSKR 79

Query: 64 QNYDTYG 70
          + +D  G
Sbjct: 80 RIFDQLG 86

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2.15
           YNL227C
          Length = 598

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 69/144 (47%), Gaps = 23/144 (15%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE L V   A+  ++KKAYRR ALQ+HPDK +  ++++ ++I F  +  AYE+LS+ ++R
Sbjct: 6   YELLDVEMTASDADLKKAYRRKALQYHPDK-NINNIKEATDI-FANIRTAYEILSDPQER 63

Query: 64  QNYDTYGDTNGFSGDYSGFQDGDF--------------ASFFGNFASNRYQDEYEAQSPP 109
             YD++   N    D    +DG +                FF +    R+ D     SP 
Sbjct: 64  VWYDSHK--NQILNDEPIMEDGSYEVDSRVTGVTTEELMMFFNSSLYTRFDD-----SPA 116

Query: 110 SPRTDDAHVPIRLTMQELYNGKTI 133
                   +  RL   E+ NG+ +
Sbjct: 117 GVFQIAGKIFSRLAKDEIVNGRKL 140

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L +  +A+  ++KKAYR+LA++ HPDK    +    +   FK++  A+E+LS+E KR
Sbjct: 26 YELLQIDKEASDSDVKKAYRKLAIKLHPDK----NRHPRAAEAFKKINRAFEVLSDENKR 81

Query: 64 QNYDTYG 70
          + YD  G
Sbjct: 82 KVYDQIG 88

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (63%), Gaps = 4/61 (6%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L V   A+  EIKKAYR+LA++ HPDK    +    +   FK +  A+E+LS+E+KR
Sbjct: 24 YEVLRVEKQASDLEIKKAYRKLAIKLHPDK----NKHPRASEAFKRINRAFEVLSDEQKR 79

Query: 64 Q 64
          +
Sbjct: 80 R 80

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (69%), Gaps = 4/69 (5%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPYETLGV  +A+  EIKKAY +LA + HPD ++ E     +E KF ++  AYE+LS++ 
Sbjct: 36  DPYETLGVGKNASSSEIKKAYYKLAKKFHPD-INKEP---NAEAKFHDLQNAYEILSDDT 91

Query: 62  KRQNYDTYG 70
           K+Q YD +G
Sbjct: 92  KKQQYDQFG 100

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 2/68 (2%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEI--KFKEVAAAYELLSN 59
           D Y+ LG++  A+  EI+KAY  L  ++HPDK    S +++ +I  K  +V  AYE+LS+
Sbjct: 522 DYYKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSD 581

Query: 60  EEKRQNYD 67
           E K+++YD
Sbjct: 582 EGKKRDYD 589

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L V   A+  +IKKAYR++A++ HPDK    +    +   FK+V  A+E+LS+E+KR
Sbjct: 26 YELLQVDEKASDGDIKKAYRKMAIKLHPDK----NRHPRAAEAFKKVNRAFEVLSDEKKR 81

Query: 64 QNYDTYG 70
          + YD  G
Sbjct: 82 RVYDQLG 88

>Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to
          Ashbya gossypii AFR639W
          Length = 156

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 8/67 (11%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDK--VSDESLRDESEIKFKEVAAAYELLSNEE 61
          Y  LG+  DA  D IKKAYRR  L+ HPDK  +S+ESL         ++  AY +L ++E
Sbjct: 6  YSVLGIDSDADSDTIKKAYRRRLLETHPDKKQISNESL------SVDQLQKAYRVLIDKE 59

Query: 62 KRQNYDT 68
           R  YD+
Sbjct: 60 LRAKYDS 66

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIK--FKEVAAAYELLSN 59
           D Y+ LGV+P A+  EI+KAY  L  ++HPDK+       +  I     ++  AYE LS+
Sbjct: 538 DYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSD 597

Query: 60  EEKRQNYD 67
           ++KR+ YD
Sbjct: 598 DDKRKEYD 605

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L V   A+ +EIKKAYR+LA++ HPDK    +    +   FK +  A+E+LS+  KR
Sbjct: 26 YELLQVEKGASDNEIKKAYRKLAIRLHPDK----NTHPRASEAFKRINRAFEVLSDVGKR 81

Query: 64 QNYDTYG 70
          + +D  G
Sbjct: 82 RMFDQLG 88

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
           Anc_2.350 YMR161W
          Length = 175

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 5/86 (5%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           Y+ +GV    +Q ++K +Y+ L  + HPDK S    ++     F  V  AY+ LSN++KR
Sbjct: 25  YDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEA----FALVHKAYKTLSNKQKR 80

Query: 64  QNYDTYGDTNGFSGDYSGFQDGDFAS 89
             YD YG+ + FS    G  D  F S
Sbjct: 81  AMYDKYGN-DAFSRKTDGSADKPFNS 105

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 55/101 (54%), Gaps = 9/101 (8%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEI--KFKEVAAAYELLSN 59
           D Y+ LG+   AT  +I++AY     ++HPDK    S ++ES+I  K  ++  AYE LS+
Sbjct: 494 DYYKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAYETLSD 553

Query: 60  EEKRQNYDTYGDTNGFSG-------DYSGFQDGDFASFFGN 93
           + +R+ YD    +   SG        ++  ++G  +S FGN
Sbjct: 554 DTRRKEYDQARSSGSRSGPMNPNMFRHANAREGQGSSHFGN 594

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   A+  E+KKAYR+ ALQ+HPDK +   + + +EI F  +  AYE+LS+ ++R
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDK-NPTKVEEATEI-FATIRTAYEVLSDPQER 63

Query: 64 QNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 48/82 (58%), Gaps = 6/82 (7%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVS--DESLRDESEIKFKEVAAAYELLSN 59
           D Y+ LG++ +AT  +I+KAY +L  ++HPDK     ES + ++  K  E+  AYE LS+
Sbjct: 559 DYYKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSD 618

Query: 60  EEKRQNYDTY----GDTNGFSG 77
           E K+  YD+      + N F G
Sbjct: 619 EAKKSEYDSVRSGKSNQNMFRG 640

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   A+  ++KKAYR+ AL +HPDK  D    +E+   F  + AAYE+L++ ++R
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDKNRDNV--EEATAIFATIRAAYEVLADPQER 63

Query: 64 QNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDE---SLRDESEIKFKEVAAAYELLSNE 60
           Y+ LG+ P+A+  EI+KAY  L  ++HPDK   +       +++ K  E+  AYE+L++E
Sbjct: 543 YQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDE 602

Query: 61  EKRQNYDT 68
           EKR+ YD+
Sbjct: 603 EKRKEYDS 610

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y  LG+ P A+ ++IKK+Y++LA + HPDK    S  +ES   FK V  AY +LS+ ++R
Sbjct: 9  YSVLGLTPTASLNDIKKSYKKLARELHPDK----SKSNESSELFKIVVDAYSILSDVKER 64

Query: 64 QNYDTYGDTNGFSGDY 79
          + Y+      G   +Y
Sbjct: 65 EEYNITLHRKGLYTNY 80

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L V   A   EIKKAYR+LA++ HPDK    +   ++   FK +  A+E+L N EKR
Sbjct: 24 YEILKVNRTANDSEIKKAYRKLAIKLHPDK----NPHPKAAEAFKLINRAFEVLGNSEKR 79

Query: 64 QNYDTYG 70
          + ++  G
Sbjct: 80 EIFNRIG 86

>KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON}
          Anc_1.113 YJR097W
          Length = 163

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE L V    T DE+KK+YR L L  HPDK +  +    S+    ++  AY +LS+   R
Sbjct: 7  YEVLNVPAQVTPDELKKSYRVLLLSTHPDKSNVTT----SKYSIDQIKEAYRILSDPVSR 62

Query: 64 QNYDTY----GDTNGF 75
          + YD +    G  NGF
Sbjct: 63 KTYDAHLLEEGKKNGF 78

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 45/72 (62%), Gaps = 4/72 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y  LG+  DAT+ +IKKAYR++A+  HPDK    S    +E+ FK V+ A  +L ++E+R
Sbjct: 14 YSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSA---AEL-FKLVSHAQSVLIDKEQR 69

Query: 64 QNYDTYGDTNGF 75
          Q+Y+    T G 
Sbjct: 70 QSYNRKLITKGL 81

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVS--DESLRDESEIKFKEVAAAYELLSNEE 61
           Y+ L V P AT  +I+K+Y  +  ++HPDK     ES + +++ +  E+  AYE+LS+E 
Sbjct: 505 YKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEG 564

Query: 62  KRQNYD 67
           KR+ YD
Sbjct: 565 KRKEYD 570

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 50/79 (63%), Gaps = 8/79 (10%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPD--KVSDESLRDESEIKFKEVAAAYELLSN 59
           DPY TLGV+  AT  EIKKAY +LA ++HPD  K +D      ++ KF ++  AYE+LS+
Sbjct: 39  DPYSTLGVSNSATSSEIKKAYYKLAKKYHPDINKAAD------AQKKFHDLQNAYEILSD 92

Query: 60  EEKRQNYDTYGDTNGFSGD 78
           + KRQ +D YG      GD
Sbjct: 93  DCKRQQWDQYGPAAFSQGD 111

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 45/69 (65%), Gaps = 4/69 (5%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDK---VSDESLRDESEIKFKEVAAAYELLS 58
           D Y+ LGV   AT  +++++Y +L  + HPDK   ++DE  R ++E K  E+  AYE+LS
Sbjct: 528 DYYKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQ-RQKNEEKMAEINEAYEILS 586

Query: 59  NEEKRQNYD 67
           +++KR  YD
Sbjct: 587 DDDKRTKYD 595

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDK---VSDESLRDESEIKFKEVAAAYELLSNE 60
           Y+ LG+  DA   +I++AY  L  ++HPDK   +SD   R + E K   +  AYE+LS+E
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAE-RAKVEEKMSSINEAYEVLSDE 569

Query: 61  EKRQNYDT 68
            KR+ YD 
Sbjct: 570 SKRKEYDM 577

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          YE LGV   A+  E+KKAYR+ AL++HPDK  +    +E+   F  +  AYE+LS+ ++R
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDKNPNNV--EEATQAFATIRLAYEVLSDPQER 63

Query: 64 QNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {ON}
           similar to uniprot|P48353 Saccharomyces cerevisiae
           YMR161W
          Length = 238

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 51/95 (53%), Gaps = 16/95 (16%)

Query: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
           YE L V   A  +EIKK+YR+LA++ HPDK    +    +   FK +  A+E+L + EKR
Sbjct: 24  YEILKVERTANDNEIKKSYRKLAIRLHPDK----NPHPRASEAFKLINRAFEVLGDSEKR 79

Query: 64  QNYDTYGD-----------TNGFSGDYSGFQDGDF 87
             YD  G            ++ F+GD +GF++  F
Sbjct: 80  SLYDRLGRDPDDRSVPSAASSAFNGD-TGFENMFF 113

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V   A   EIKK+YR+LA++ HPDK    +   ++   FK +  A+E+LS++EKR
Sbjct: 26 YDILNVQKSADSVEIKKSYRKLAIKLHPDK----NPHPKAGEAFKVINRAFEVLSDDEKR 81

Query: 64 QNYDTYG 70
            +D  G
Sbjct: 82 SVFDRIG 88

>SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {ON}
           some similarities with uniprot|P35191 Saccharomyces
           cerevisiae YFL016C MDJ1 Protein involved in folding of
           mitochondrially synthesized proteins in the
           mitochondrial matrix localizes to the mitochondrial
           inner membrane member of the DnaJ family of molecular
           chaperones
          Length = 510

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 4/69 (5%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY+TLGV+  A+  EIKKAY +LA ++HPD    E    +++ KF ++  AYE+LS+E 
Sbjct: 56  DPYKTLGVSQSASGSEIKKAYYKLAKKYHPDINKAE----DAQKKFHDLQNAYEILSDET 111

Query: 62  KRQNYDTYG 70
           K+Q +D +G
Sbjct: 112 KKQQWDQFG 120

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V   ++  +IKKAYR+LA++ HPDK    +   ++   FK +  A+E+LS+ +KR
Sbjct: 23 YDILNVERSSSDVDIKKAYRKLAIKLHPDK----NPYPKAHEAFKLINRAFEVLSDSQKR 78

Query: 64 QNYDTYG 70
          Q YD  G
Sbjct: 79 QIYDQIG 85

>KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 473

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 4/69 (5%)

Query: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61
           DPY TLGV+  A+  EIKKAY +LA ++HPD    E    +++ KF ++  AYE+LS++ 
Sbjct: 40  DPYATLGVSKSASGSEIKKAYYKLAKKYHPDINKAE----DAQKKFHDLQNAYEILSDDS 95

Query: 62  KRQNYDTYG 70
           KRQ +D +G
Sbjct: 96  KRQQWDQFG 104

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V   A  +EIKK+YR+LA++ HPDK    +   ++   FK +  A+E+L +E+KR
Sbjct: 26 YDILKVDKTAQDNEIKKSYRKLAIKLHPDK----NPHPKASEAFKRINRAFEVLGDEKKR 81

Query: 64 QNYDTYG 70
            +D  G
Sbjct: 82 VLFDRIG 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,986,739
Number of extensions: 2098263
Number of successful extensions: 6408
Number of sequences better than 10.0: 389
Number of HSP's gapped: 5787
Number of HSP's successfully gapped: 416
Length of query: 414
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 302
Effective length of database: 40,638,807
Effective search space: 12272919714
Effective search space used: 12272919714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)