Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13618g8.265ON30230211921e-165
Kwal_56.237818.265ON2933196613e-85
SAKL0H16962g8.265ON3363432155e-19
Ecym_43058.265ON3111651609e-12
CAGL0L12298g8.265ON2861111164e-06
Smik_4.3588.265ON3713801122e-05
YDR113C (PDS1)8.265ON3732111122e-05
AGR083W8.265ON2951541084e-05
ZYRO0C01584g8.265ON2821041041e-04
KLLA0F19206g8.265ON26394950.001
TDEL0F039208.265ON322147940.002
Suva_2.2738.265ON376212920.005
Kpol_543.418.265ON30668860.021
Skud_4.3748.265ON373179850.035
KNAG0H032308.265ON281118780.20
NCAS0B038308.265ON325131711.5
NDAI0J013508.265ON422129712.0
TBLA0B085203.60ON93444702.9
SAKL0G03080g5.458ON21357674.6
KAFR0B055108.265ON275115659.5
NOTE: 2 genes in the same pillar as KLTH0G13618g were not hit in these BLAST results
LIST: TBLA0E04460 TPHA0A01780

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13618g
         (302 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...   463   e-165
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...   259   3e-85
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    87   5e-19
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    66   9e-12
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    49   4e-06
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    48   2e-05
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    48   2e-05
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    46   4e-05
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    45   1e-04
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    41   0.001
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    41   0.002
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    40   0.005
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    38   0.021
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    37   0.035
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    35   0.20 
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    32   1.5  
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    32   2.0  
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    32   2.9  
SAKL0G03080g Chr7 (255941..256189,256954..257346) [642 bp, 213 a...    30   4.6  
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    30   9.5  

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score =  463 bits (1192), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 242/302 (80%), Positives = 242/302 (80%)

Query: 1   MGRHEDKENSIWSESNVPVTPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSYLGT 60
           MGRHEDKENSIWSESNVPVTPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSYLGT
Sbjct: 1   MGRHEDKENSIWSESNVPVTPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSYLGT 60

Query: 61  KEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKDGIEEEGSQSEGAEVX 120
           KEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKDGIEEEGSQSEGAEV 
Sbjct: 61  KEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKDGIEEEGSQSEGAEVD 120

Query: 121 XXXXXXSNRLAAKLRTKLLSRDRDAXXXXXXXXXXXXXXXXXXXPKLSQRAEESDSDQXX 180
                 SNRLAAKLRTKLLSRDRDA                   PKLSQRAEESDSDQ  
Sbjct: 121 EDDDDDSNRLAAKLRTKLLSRDRDAEGEQTGLLGATGGLQSLLGPKLSQRAEESDSDQEV 180

Query: 181 XXXXXXXXXXXXXXXGYTPFGEQEIAKLQGVDVSPFQLNFSGVDEDEDINSQDSTQXXXX 240
                          GYTPFGEQEIAKLQGVDVSPFQLNFSGVDEDEDINSQDSTQ    
Sbjct: 181 EVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPFQLNFSGVDEDEDINSQDSTQLFTL 240

Query: 241 XXXXXXXXXXXXXQSGRKRHHTPERTTIPISTGQRRKSDVFELEPTYAGNGLTAKELESL 300
                        QSGRKRHHTPERTTIPISTGQRRKSDVFELEPTYAGNGLTAKELESL
Sbjct: 241 NFDRDDNDDTDADQSGRKRHHTPERTTIPISTGQRRKSDVFELEPTYAGNGLTAKELESL 300

Query: 301 LE 302
           LE
Sbjct: 301 LE 302

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score =  259 bits (661), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 181/319 (56%), Gaps = 43/319 (13%)

Query: 1   MGRHEDKENSIWSESNVPVTPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSYLGT 60
           MG  E+KEN+IWSE +VPVTP HLLSRSQSFMKN SPKRAE R+PLASKDNN+S  +LG 
Sbjct: 1   MGARENKENAIWSERSVPVTPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGA 60

Query: 61  KEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKDGIEEEGSQSEGAEVX 120
           KEPLRKRTRP VNHAGSF+GN R G  P LN +GAP+IKSLVLKD IEEE SQS+G E  
Sbjct: 61  KEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDDIEEEQSQSDGGEA- 119

Query: 121 XXXXXXSNRLAAKLRTKLLSRDRDAXXXXXXXXXXXXXXXXXXXPKLSQRAEESDSDQXX 180
                 SN LAAKLR KL +RDRD                     KL     +SDSD   
Sbjct: 120 --EDDESNSLAAKLRGKLNARDRDDSTEQGGLLGATGGLQGLANTKLHSETLDSDSDLEV 177

Query: 181 XXXXXXXXXXXXXXXGYTPFGEQEIAKLQGVDVSPFQLNFSG-----------------V 223
                          GYTPF +++I KLQ  + SPFQLNF+                  +
Sbjct: 178 EVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPFQLNFADDDDDASSQDSTQLFTLKL 237

Query: 224 DEDEDINSQDSTQXXXXXXXXXXXXXXXXXQSGRKRHHTPERTTIPISTGQRRKSDVFEL 283
           D D+++  Q                     +  RKR HTPE+     S  Q+     FEL
Sbjct: 238 DNDDNLGDQ---------------------EHDRKRLHTPEKKPTRASIAQQAAD--FEL 274

Query: 284 EPTYAGNGLTAKELESLLE 302
           +P YAG+GL+ KELESLLE
Sbjct: 275 DPIYAGHGLSTKELESLLE 293

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 87.4 bits (215), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 101/343 (29%), Positives = 138/343 (40%), Gaps = 48/343 (13%)

Query: 1   MGRHEDKENSIWSESNVPVTPRHLLSRSQSFMK----NKSPKRAEARRPLASKDNNRSVS 56
           M  HE+KEN I+S  N+P TP HLL RSQSFMK    N   K++  R PLASKDNN+S +
Sbjct: 1   MRTHENKENVIFSSENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNT 60

Query: 57  YL--GTKEPL--------------RKRTRPGVNHAGSFVG------------NARLGP-A 87
            +  G K  L               KR RP V++ GSF+             ++RL    
Sbjct: 61  LINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYG 120

Query: 88  PTLNASGAPKIKSLVLKDGIEEEGSQSEGAEVXXXXXXXS----NRLAAKLRTKLLSRDR 143
             L  +G P++KSLVLKD  E +  +SE  E             N LAAKL   L + + 
Sbjct: 121 SVLGYNGLPRVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNHNE 180

Query: 144 DAXXXXXXXXXXXXXXXXXXXPKLSQRAEESDSDQXXXXXXXXXXXXXXXXXGYTPFGEQ 203
           D                     K     E  +SD                  GY+PF E 
Sbjct: 181 DDKEEGSIGLLGSNTGLQQLL-KHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKES 239

Query: 204 EIAKLQGVDVSPFQLNFSGVDEDEDINSQDSTQXXXXXXXXXXXXXXXXXQSGRKRHHTP 263
           ++ KL     SPF ++    D  E+ +  D                       R++    
Sbjct: 240 DVIKLNTF-TSPFSMHKEDSD-CEECDDYDGLLTISMVKSEDEEQDDDTNDRKRRKSWID 297

Query: 264 ERTTIPISTGQRRKSDV----FELEPTYAGNGLTAKELESLLE 302
           E     ++T +    D       +EP Y G GL  ++LESLL+
Sbjct: 298 EG----LATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLLD 336

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 66.2 bits (160), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 75/165 (45%), Gaps = 36/165 (21%)

Query: 1   MGRHEDKEN----SIWSESNVPVTPRHLLSRSQS--FMKNKSPKRAEARRPLASKDNNRS 54
           M +HEDKEN    S  S S VP TP H L RS S   +KN S      R PLASKD NRS
Sbjct: 1   MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNS------RLPLASKDRNRS 54

Query: 55  VSYLGTKEPL-------------RKRTRPGVNHAGSFVGNA------RLGPAPTLNASGA 95
            S    K+ L              K  RP  N   SFV N       + G    +N    
Sbjct: 55  QSGFNLKQQLVQGHVGGGVMVGQNKSKRPASN---SFVKNMPDSKLKKYGSVLGVNYPHL 111

Query: 96  PKIKSLVLKDGIEEEGSQSEGAEVXXXXXXXSNRLAAKLRTKLLS 140
            K KSLVLKD    +GSQ  G E         N LAAKLR++L S
Sbjct: 112 TKTKSLVLKDA--SDGSQDNGEESDDYDDEEGNPLAAKLRSRLTS 154

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 56/111 (50%), Gaps = 21/111 (18%)

Query: 1   MGRHE-DKENSIWS--ESNVPVTPRHLLSRSQSFMKNKSPKRAEARRPLASKDN--NRSV 55
           MG  E DKEN++        P TP  LL R++S +    PK+   R+PLASKD   NRS 
Sbjct: 1   MGAVETDKENNVVGTLREKGPATPTQLLKRTRSTL---LPKKNGQRQPLASKDKNYNRSS 57

Query: 56  SYLGTK-EPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKD 105
           SYL  K    +K+ +P V  AGS   NA              ++ SL+LKD
Sbjct: 58  SYLSLKRNSNQKKLKPAVTRAGSTANNANR------------RVTSLILKD 96

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 93/380 (24%), Positives = 133/380 (35%), Gaps = 89/380 (23%)

Query: 1   MGRHEDKENSIW------SESNVPVTPRHLLSRSQSFM---------------------- 32
           M  +EDKEN+I       S  N P TP HLL RS S +                      
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 33  ------KNKSPKR-------AEARRPLASKDNNRSVSYLGTKE----------------- 62
                 K  SP +        + R PLA+KDNNR+ S++   E                 
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 63  -------PLRK-----RTRPGVNHAGSFVGNARLGP-APTLNASGAPKIKSLVLKDGIEE 109
                   LRK     R R  VNH+       +L      L  +  PK+KSLVLKD + +
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLV-D 179

Query: 110 EGSQSEGAEVXXXXXXXSNRLAAKLRTKLL---SRDRDAXXXXXXXXXXXXXXXXXXXPK 166
            G   E ++         N+L+ KL+  LL   S D +                      
Sbjct: 180 PGKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKN 239

Query: 167 LSQRAEESDSDQXXXXXXXXXXXXXX----XXXGYTPFGEQEIAKLQGVDVSPFQLNFSG 222
             Q   +S SD                      GY+PF +++I KL+  + SP++L    
Sbjct: 240 SVQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFN-SPYEL---- 294

Query: 223 VDEDEDINSQDSTQXXXXXXXXXXXXXXXXXQSGRKRHHTPERTTIP-ISTGQRRKSDVF 281
            D ++D  S D                         R    E T +P +S   R+ + + 
Sbjct: 295 -DLEDDGGSTDKVDLLPLEAINEESEQDEIVHIAGDRE---EGTPLPLLSKNLRKITAIP 350

Query: 282 ELEPTYAGNGLTAKELESLL 301
            +E    G GL  +ELE L+
Sbjct: 351 TIESLCNGEGLDPEELEDLI 370

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 81/211 (38%), Gaps = 70/211 (33%)

Query: 1   MGRHEDKENSIW------SESNVPVTPRHLLSRSQSFM---------------------- 32
           M  +EDKEN+I       S  N P TP HLL RS S +                      
Sbjct: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61

Query: 33  ------KNKSPKR-------AEARRPLASKDNNRSVSYLG-------------------- 59
                 K  SP +        + R PLA+KDNNRS S++                     
Sbjct: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLS 121

Query: 60  --TKEPLRK-----RTRPGVNHAGSFVGNARLGP-APTLNASGAPKIKSLVLKDGIEEEG 111
               + LRK     R+R   NH      + +L      L  +  PK+KSLVLKD + + G
Sbjct: 122 IRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKD-LADSG 180

Query: 112 SQSEGAEVXXXXXXXSNRLAAKLRTKLLSRD 142
              E ++         ++L  KL++ LL +D
Sbjct: 181 KNEESSDDDEGNEDSESKLGKKLQSALLKQD 211

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 65/154 (42%), Gaps = 24/154 (15%)

Query: 1   MGRHEDKENSIWSE---SNVPVTPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSY 57
           M +HEDKEN + S    + +P TP H L RS S +      R   R PLASKD N+S   
Sbjct: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNLAG----RNSTRMPLASKDRNQSQGV 56

Query: 58  LGTKEPLRKRT--------RPGVNHAGSFVGNARL---GPAPTLNASGAPKIKSLVLKDG 106
            G K               RP  +     + +++L   G    +      K KSLVLKD 
Sbjct: 57  FGLKTSGAGGAGGAQAQSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKD- 115

Query: 107 IEEEGSQSEGAEVXXXXXXXSNRLAAKLRTKLLS 140
                +    +          N LAAKL+++L S
Sbjct: 116 -----TSDCESANEESEEEEGNPLAAKLKSRLCS 144

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 54/104 (51%), Gaps = 21/104 (20%)

Query: 17  VPVTPRHLLSRSQSFM------------KNKSPKRAEARRPLASKDNNRSVSYLGTKEPL 64
           +P TP HLL RSQ  +            ++ SP R + R PLASKD+N+S S  G   P+
Sbjct: 25  LPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQRRLPLASKDHNKS-SAAG---PV 80

Query: 65  RKRTRPGVNHAGSFVGNAR--LGPAPTLNASGAPKIKSLVLKDG 106
           +KR +P +   G  + N R        L  +  P+ KSLVLKDG
Sbjct: 81  KKR-QPTL--QGELLSNPRKLQKYGSVLGYTDLPRTKSLVLKDG 121

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 46/94 (48%), Gaps = 16/94 (17%)

Query: 20  TPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSYLGTKE--PLRKRTRPGVNHAGS 77
           TP + + R+ S ++         RRPLASKDNNR+ S L  K    L K   P    A S
Sbjct: 23  TPLNQMKRTDSLVRGN-------RRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASS 75

Query: 78  FVGNA------RLGPAPTLNASGAPKIKSLVLKD 105
           F+ N       + G    +N +  P+ KSLVLKD
Sbjct: 76  FMKNMPENKLKKYGSVLGMN-TFMPRTKSLVLKD 108

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 60/147 (40%), Gaps = 42/147 (28%)

Query: 1   MGRHEDKENSI---WSES---NVPVTPRHLLSRSQSFM---------------------K 33
           M  +E+KEN +     ES   + P TP HLL RSQS M                     K
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60

Query: 34  NKSPKR--AEARRPLASKDNNRSVSY----------LGTKEPLRKRTRPGVNHA-GSFVG 80
             SP R   + R PLASKDNNRS  +             K  L +  +   N   G  + 
Sbjct: 61  RASPSRRVQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLLT 120

Query: 81  NARL--GPAPTLNASGAPKIKSLVLKD 105
           N R        L  +  PK+KSLVLKD
Sbjct: 121 NPRRLKKYGSVLGYNALPKMKSLVLKD 147

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 279 DVFELEPTYAGNGLTAKELESLLE 302
           D FE++P+Y G GL A +L  LL+
Sbjct: 298 DTFEIQPSYCGEGLDASDLNDLLK 321

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 79/212 (37%), Gaps = 72/212 (33%)

Query: 1   MGRHEDKENSIW------SESNVPVTPRHLLSRSQSFM---------------------- 32
           M  +EDKEN+I       S ++ P TP HLL RS S +                      
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 33  ------KNKSPKR-------AEARRPLASKDNNRSVSYLGTKEP---------------- 63
                 K  SP +        + R PLA+KDNNRS S++   E                 
Sbjct: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120

Query: 64  --------LRK-----RTRPGVNHAGSFVGNARLGP-APTLNASGAPKIKSLVLKDGIEE 109
                   LRK     R R   N+ G    + +L      L  +  PK+KSLVLKD + +
Sbjct: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKD-LAD 179

Query: 110 EGSQSEGAEVXXXXXXXSNRLAAKLRTKLLSR 141
                E ++         N+L+ KL++    +
Sbjct: 180 PAKNQESSDDDDGSEGTDNKLSQKLQSAFFQQ 211

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
          complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 19/68 (27%)

Query: 5  EDKENSIWSES---NVPVTPRHLLSRSQSFMK-------------NKSPKRAEARRPLAS 48
          ++KEN+I+  +   ++P TP +LL R+ S +K             N SP++   R PLAS
Sbjct: 3  QNKENNIFRHAMLKDMPQTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQK---RLPLAS 59

Query: 49 KDNNRSVS 56
          KDNNRS S
Sbjct: 60 KDNNRSNS 67

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 13/107 (12%)

Query: 197 YTPFGEQEIAKLQGVDVSPFQLNFSGVDEDEDINSQDSTQXXXXXXXXXXXXXXXXXQSG 256
           + PF E +IAKL+  + SPF+L  S  D++ED  S +                       
Sbjct: 211 HLPFDENDIAKLKTFN-SPFKLEQSNSDDEED--SSELLLLANTSDDEGTHNDKITTNKN 267

Query: 257 RKRHHTPE-RTTIPISTGQRRKSDVFELEPTYAGNGLTAKELESLLE 302
              ++ P  +  IP        +D+ ++EP+Y G GL + +LE LL+
Sbjct: 268 LSINNKPNSKDVIP--------ADILDIEPSY-GEGLDSNDLEDLLD 305

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 62/179 (34%), Gaps = 77/179 (43%)

Query: 1   MGRHEDKENSIW------SESNVPVTPRHLLSRSQSFM---------------------- 32
           M  +EDKEN+I       S  N P TP HLL RS S +                      
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 33  ------KNKSPKR-------AEARRPLASKDNNRSVSYLGTKEPL--------------- 64
                 K  SP +        + R PLA+KDNNRS S++   E                 
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120

Query: 65  ----------------RKRTRPGVNHAGSFVGNAR--LGPAPTLNASGAPKIKSLVLKD 105
                           R RTR   N     + N+R        L  +  PK+KSLVLKD
Sbjct: 121 LSIRKNDQLRQLSQISRNRTRANYNE---LLNNSRKLQKYGSVLGYNALPKMKSLVLKD 176

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 53/118 (44%), Gaps = 20/118 (16%)

Query: 1   MGRHEDKENSIWSESNVPVTP-RHLLSRS------------QSFMKNKSPKRAEARRPLA 47
           M  +EDKEN++     VP TP  ++L  S            QSF   KSP R   R PLA
Sbjct: 1   MQDNEDKENAVA----VPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRG-GRLPLA 55

Query: 48  SKDNNRSVSYLGTKEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKD 105
           SKDNN S   +  K  L ++    V  A S     R G     +     + KSL+LKD
Sbjct: 56  SKDNNASGLVVSGK--LGRQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKD 111

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 54/131 (41%), Gaps = 41/131 (31%)

Query: 1   MGRHEDKENSIWSESNV---------PVTPRHLL-SRSQSF------------MKNKSPK 38
           +  +EDKEN    ES+V         P TP HLL  RS S             + N SP+
Sbjct: 3   LDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNISPR 62

Query: 39  R-----AEARRPLASKDNNRSVSYLGTKEPLRKRTRPGVNHAGSFVGNARLGPAPTLNAS 93
           R      + R PLA KDNN S S+   K  L    +  +   GS +G             
Sbjct: 63  RRQLLQLQNRLPLAKKDNNNS-SFSSRKNGLNNIKK--LKKYGSVLG-----------MD 108

Query: 94  GAPKIKSLVLK 104
             P+ KSL+LK
Sbjct: 109 ALPRTKSLILK 119

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 51/129 (39%), Gaps = 37/129 (28%)

Query: 17  VPVTPRHLLSRSQSFMK--------------------------NKSPKR----AEARRPL 46
            P TP HLL RS S +                           N SP+R     + R PL
Sbjct: 37  FPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRFPL 96

Query: 47  ASKDNNRSVSYLGTKEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKDG 106
           + KDNN S      K+  ++     +   GS +G    G     N +   +IKSLVLKD 
Sbjct: 97  SKKDNNNSFI---LKQQQQQFDHKRLKKYGSVLGLGTDGN----NHNNLTRIKSLVLKDI 149

Query: 107 IEEEGSQSE 115
            +++ + S 
Sbjct: 150 DDDDNAGSH 158

>TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa]
           {ON} Anc_3.60 YNL298W
          Length = 934

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 15  SNVPVTP-RHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSY 57
           SNV + P R + SRSQS M N  P RA+   PLA    +R+ S+
Sbjct: 321 SNVAIVPQRDVSSRSQSPMNNSQPNRAKTSSPLAPGPMSRNQSH 364

>SAKL0G03080g Chr7 (255941..256189,256954..257346) [642 bp, 213 aa]
           {ON} similar to uniprot|Q12159 Saccharomyces cerevisiae
           YDR381W YRA1 Nuclear protein that binds to RNA and to
           Mex67p required for export of poly(A) mRNA from the
           nucleus member of the REF (RNA and export factor binding
           proteins) family another family member Yra2p can
           substitute for Yra1p function
          Length = 213

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 61  KEPLRKRTRPGVNHAGSFV-GNARLGPAPTLNASGAPKIKSLVLKDGIEEEGSQSEG 116
           K+P+R+ TR G       + GN R GPAPT    GAP IK+  L D         EG
Sbjct: 17  KKPIRRATRGGPKKVSKQINGNRRRGPAPTGPKRGAP-IKAASLLDAAYSTKVNVEG 72

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 48/115 (41%), Gaps = 26/115 (22%)

Query: 1   MGRHEDKENSIWSESNVPV----TPRHLLSRSQSFMKNKSPKR---AEARRPLASKDNNR 53
           M    DKEN++   S +PV    TP     +  +     SP +    + + PL SK+ N+
Sbjct: 1   MSNQSDKENNL---STIPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNK 57

Query: 54  SVSYLGTKEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASG---APKIKSLVLKD 105
           S S L             ++H G+     + G    L   G    PK KSL+LKD
Sbjct: 58  SNSIL-------------ISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLILKD 99

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.126    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,138,249
Number of extensions: 886229
Number of successful extensions: 1859
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1891
Number of HSP's successfully gapped: 33
Length of query: 302
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 193
Effective length of database: 40,982,805
Effective search space: 7909681365
Effective search space used: 7909681365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 65 (29.6 bits)