Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13596g8.266ON26726713390.0
Kwal_56.237778.266ON2672658801e-119
SAKL0H16940g8.266ON3032935933e-75
TDEL0F039308.266ON2802044635e-56
ZYRO0C01562g8.266ON2772604218e-50
Kpol_392.48.266ON2812133731e-42
NDAI0B020108.266ON2812263643e-41
Ecym_43048.266ON2892403489e-39
AGR082C8.266ON2662143276e-36
KLLA0F19228g8.266ON3052343052e-32
NCAS0B050408.266ON2732272893e-30
KAFR0B027408.266ON2562142841e-29
Suva_10.1758.266ON2992242414e-23
YLR091W (GEP5)8.266ON2932242352e-22
Smik_12.1508.266ON2922252231e-20
Skud_12.1598.266ON2942232124e-19
KNAG0G020608.266ON2862112062e-18
TPHA0J007608.266ON2491811295e-08
TDEL0H002907.542ON66982740.74
CAGL0L12320g8.266ON27879665.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13596g
         (267 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   520   0.0  
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   343   e-119
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   233   3e-75
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   182   5e-56
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   166   8e-50
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...   148   1e-42
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   144   3e-41
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...   138   9e-39
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...   130   6e-36
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...   122   2e-32
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   115   3e-30
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...   114   1e-29
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    97   4e-23
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...    95   2e-22
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    91   1e-20
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    86   4e-19
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    84   2e-18
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    54   5e-08
TDEL0H00290 Chr8 complement(40466..42475) [2010 bp, 669 aa] {ON}...    33   0.74 
CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weak...    30   5.9  

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/267 (95%), Positives = 254/267 (95%)

Query: 1   MNMAVRALEKLPLDIRTXXXXXXXXXXXXXPGFQELAQQYTADGSSKSLESIVHLTYFHW 60
           MNMAVRALEKLPLDIRT             PGFQELAQQYTADGSSKSLESIVHLTYFHW
Sbjct: 1   MNMAVRALEKLPLDIRTLELLERKLLKKSLPGFQELAQQYTADGSSKSLESIVHLTYFHW 60

Query: 61  CNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEK 120
           CNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEK
Sbjct: 61  CNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEK 120

Query: 121 YAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNI 180
           YAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNI
Sbjct: 121 YAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNI 180

Query: 181 PEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQR 240
           PEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQR
Sbjct: 181 PEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQR 240

Query: 241 ACRGAYTIEQHPVLGLEIKESKLLKRL 267
           ACRGAYTIEQHPVLGLEIKESKLLKRL
Sbjct: 241 ACRGAYTIEQHPVLGLEIKESKLLKRL 267

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  343 bits (880), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 164/265 (61%), Positives = 200/265 (75%)

Query: 1   MNMAVRALEKLPLDIRTXXXXXXXXXXXXXPGFQELAQQYTADGSSKSLESIVHLTYFHW 60
           MN  ++ LEKLPLD+RT               F ELA+QY A    K+LE+I+H TYF W
Sbjct: 1   MNRGIQVLEKLPLDVRTLKLIEKRLERAESLRFLELARQYEAKKDYKTLENIIHHTYFSW 60

Query: 61  CNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEK 120
            NE   HIK FREHY ELRD WPYE HR+IL M +PK+QSIRFLWS+ +P+VL+ M Y  
Sbjct: 61  ENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLAAMRYGS 120

Query: 121 YAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNI 180
           Y  + E    RLTEL+RT++FHE+FQHFLFL+ RP LCK RK L+VPIVEIPMKPLGQNI
Sbjct: 121 YGWNREGGGERLTELERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNI 180

Query: 181 PEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQR 240
            +VR++NLFKRK+AYVW++LA+D+PALS +NE  L  II+SPQLP+  +S R LKRLYQR
Sbjct: 181 ADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQR 240

Query: 241 ACRGAYTIEQHPVLGLEIKESKLLK 265
           ACRGAY I+ HP LGLEI+ESK+LK
Sbjct: 241 ACRGAYVIKPHPTLGLEIEESKILK 265

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  233 bits (593), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 132/293 (45%), Positives = 175/293 (59%), Gaps = 34/293 (11%)

Query: 8   LEKLPLDIRTXXXXXXXXXXXXXPGFQELAQQ---YTADGSSKSLESIVHLTYFHWCNED 64
           LE LPLD RT                  L Q+   Y A+ +SKSLE IV+ TYFHW N  
Sbjct: 11  LECLPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVYNTYFHWNNTT 70

Query: 65  APHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEK---- 120
             HI+KFR++Y +LR+HWPYE HR +LSM  P+  SIR +W+ N+ KVLS M +E+    
Sbjct: 71  PLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLSSMRFERNPWC 130

Query: 121 ------------------YAHDTEERPS--------RLTELQRTVQFHEVFQHFLFLKSR 154
                             Y    EE+          ++++L+ T+ FHE+FQH++FLK  
Sbjct: 131 RNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLKRN 190

Query: 155 PHLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELS 214
           P LCK  K L +PIVEIPMKPLGQ+IP VR+RNLFKRK A  WK+LA ++P LS +NE  
Sbjct: 191 PKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEENPVLSLENEAL 250

Query: 215 LAKIIDSPQLPEDVSSKRELKRLYQRACRGAYTIEQHPVLGLEIKESKLLKRL 267
           L  II SP     VS+ R++KRLYQRAC+ +Y I +   +GL+ + SKL K +
Sbjct: 251 LLDIIASPHHSTSVSN-RKIKRLYQRACKHSYVICEDRSIGLDFQISKLSKNI 302

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  182 bits (463), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 137/204 (67%), Gaps = 8/204 (3%)

Query: 47  KSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWS 106
           K+LESI++ T+F W +    H+K F+ HY ++  HWPYE HRSIL+M+ P++ S+R+ W 
Sbjct: 60  KALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWE 119

Query: 107 SNSPKVLSKMSYEKYAHDTEERPSR-LTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLA 165
            +S  VLS   Y K     +   S+ LT +QR + FH VF H+LFLK+ P LC   + L 
Sbjct: 120 DSSKTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLP 179

Query: 166 VPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLP 225
           +PIVEIPM+PLG +I   R++NLFK K+A+ +++LA+++P LSR +E  L++II      
Sbjct: 180 IPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIIS----- 234

Query: 226 EDVSSKRELKRLYQRACRGAYTIE 249
            D SS+++ +RLYQ +C+ AY +E
Sbjct: 235 -DASSRKQ-RRLYQASCKRAYVME 256

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  166 bits (421), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 142/260 (54%), Gaps = 13/260 (5%)

Query: 6   RALEKLPLDIRTXXXXXXXXXXXXXPGF---QELAQQYTADGSSKSLESIVHLTYFHWCN 62
           R++ +LPL I T                   Q++++ +      K LE+++  T+F W N
Sbjct: 15  RSIRQLPLHIETQKVLEFYCRNSSYKSLLVAQDISE-FEKHNDHKYLEALIQKTHFLWDN 73

Query: 63  EDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEKYA 122
              P +K+F+ ++ EL +HWPYE+ RS+LSM  P+ +S  +LW       LS + +EK+ 
Sbjct: 74  PLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNLRFEKHR 133

Query: 123 HDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNIPE 182
              E    RL+  Q T   H +F  + FLKS   LC   + + VPIVEIP++P+G ++ +
Sbjct: 134 WADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIVEIPLRPMGNDVAD 193

Query: 183 VRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRAC 242
            R+RNLFKRK A VW +LA ++  LS +NE  L +II         S  R ++RLYQRA 
Sbjct: 194 CRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITK-------SETRSMRRLYQRAS 246

Query: 243 RGAYTI--EQHPVLGLEIKE 260
           R AY +  E     GL++ E
Sbjct: 247 RRAYVVTNEGKDPNGLQVPE 266

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score =  148 bits (373), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 125/213 (58%), Gaps = 13/213 (6%)

Query: 42  ADGSSKSLESIVHLTYFHWCNEDAP-HIKKFREHYAELRDHWPYEFHRSILSMDTPKTQS 100
            +  S++LE IV  T+  W N+  P H++KF+ HY EL  HWPYEFH  +L+M  P T S
Sbjct: 63  VENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGS 122

Query: 101 IRFLWSSNSPKVLS---KMSYEKYAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHL 157
           + +L  +N  +  +        K+ +  ++   +LT+ QR   ++++F+   FLK    +
Sbjct: 123 LIYLCLNNDDRFFNFYKSQINNKWFNSVDQ--YKLTDEQRVSIYNDIFKQIFFLKRHTTI 180

Query: 158 CKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAK 217
            +  K + VPIVE+P+KP+G +IP  R++NLF +K+ Y+WK+L+L SPA+S  +E  +  
Sbjct: 181 SEVNKNM-VPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKLLSLSSPAISLSHEKIIMN 239

Query: 218 IIDSPQLPEDVSSKRELKRLYQRACRGAYTIEQ 250
           I+      ED    R + RLY+R+ + +Y  + 
Sbjct: 240 IL------EDTKDNRRINRLYRRSLKNSYVFDD 266

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  144 bits (364), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 128/226 (56%), Gaps = 16/226 (7%)

Query: 45  SSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFL 104
           S+K+LESI++ TYF W N+ A H+K F+  Y+ L   WP+ +H  I S    K  SI   
Sbjct: 67  SNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDS----KKNSIILT 122

Query: 105 W--SSNSPKVLSKM-SYEKYAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTR 161
           W  SSNS  +L ++ S+  Y   T+    +  + Q  V F +++QH++FL   P LC   
Sbjct: 123 WNKSSNSKNMLRELLSHLNY---TQSLVPQKKDFQ--VIFKKIYQHYIFLSLNPSLCSNG 177

Query: 162 KGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDS 221
           K L  PIVEIPM  +G +IP+ R+ NL + KIA  W  LA+ +P L+ +NE  L +II+ 
Sbjct: 178 KRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIING 237

Query: 222 PQLPEDVSSKRELKRLYQRACRGAYTIEQHPVLGLEIKESKLLKRL 267
                     R+L++LY+RAC  +Y I+      +E ++SK L  L
Sbjct: 238 ----SSAIKSRQLRKLYRRACSNSYVIKNEDDNNIEFQKSKKLNWL 279

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score =  138 bits (348), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 121/240 (50%), Gaps = 34/240 (14%)

Query: 35  ELAQQYTADGSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMD 94
           E   +Y   G    L  ++   YF   N  A H+++F  +  EL+  WPYE H  +LS +
Sbjct: 44  EPINRYLLSGEVSYLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGE 103

Query: 95  TPKTQSIRFLWSSNSPKVLSKMSYE----------KYAHDT---------------EERP 129
            P   S R+LWS N+ KVL  M Y+          K++ D+               E+  
Sbjct: 104 RPYKDSARYLWSRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDK 163

Query: 130 SRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLF 189
           + L E +R      +F H+LF+KSRP LC   K L +PIVE+ M PLG+++P+VR+ NLF
Sbjct: 164 NTLGETERIALLKLIFSHYLFVKSRPTLC-GHKNLPIPIVEVGMSPLGEDMPDVRIDNLF 222

Query: 190 KRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYTIE 249
           +++     K L  D P LSR+ E  L  II            R + RLY+ +C GAYT++
Sbjct: 223 RKRSKATLKTLLHDFPPLSREVESLLHSIIK--------ECDRSMGRLYKWSCNGAYTMD 274

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score =  130 bits (327), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 115/214 (53%), Gaps = 13/214 (6%)

Query: 40  YTADGSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQ 99
           +   G  + L+ +V   +F        H++  R H  EL+  WPYE H S+L++   ++Q
Sbjct: 47  FLRKGGHQGLQRLVFHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQ 106

Query: 100 SIRFLWSSNSPKVLSKMSYEKY----AHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRP 155
           S+R LW     +VL +M Y ++      D  ER + LT+ QR    H VF  ++FLK RP
Sbjct: 107 SLRRLWEDGQEEVLQQMQYCRHHWLREGDVPERYA-LTQAQREEVLHRVFAQYMFLKQRP 165

Query: 156 HLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSL 215
            L   R+ L +P+VEI M PLG +IP+VRV  LFK K   V ++L  + PAL+   E  +
Sbjct: 166 ALWSVRR-LPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDM 224

Query: 216 AKIIDSPQLPEDVSSKRELKRLYQRACRGAYTIE 249
            +II            R ++R+Y RACR AY ++
Sbjct: 225 LRIIAE-------CPTRAMRRIYLRACRRAYVLD 251

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score =  122 bits (305), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 115/234 (49%), Gaps = 32/234 (13%)

Query: 38  QQYTADGSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPK 97
             +  + + K+LE +V+  +FH  N+   H+   R++  EL   WPYE   SIL MD P 
Sbjct: 42  NSFNENPTRKTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPN 101

Query: 98  TQSIRFLWSSNSPKVLSKMSYEK--------YAHDTEE-----------RPSRLTELQR- 137
             S   LWS N+   L  +S+ +        +    EE           + +++TE+ R 
Sbjct: 102 LTSQTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRL 161

Query: 138 -----TVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRK 192
                     ++F+H+ FLK+ P LC T+K L  PIVEI MKP G +I ++R+ NLFK+K
Sbjct: 162 PAEKIKETLRQIFEHYYFLKTNPKLCATKK-LQAPIVEIGMKPDGFDIADIRIDNLFKKK 220

Query: 193 IAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAY 246
           +  +  +L   +P L+   E  L  I++ P L       R  KRLY+     +Y
Sbjct: 221 VKLISDLLYSQNPVLTSDAESILTSIVNDPDL------NRRTKRLYKNVASRSY 268

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  115 bits (289), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 121/227 (53%), Gaps = 21/227 (9%)

Query: 44  GSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRF 103
           G  K LESI + TYF W N    H++ F+++   LR +WP  +HR    MDT K  SI  
Sbjct: 64  GIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRG---MDT-KRDSIIV 119

Query: 104 LWS-SNSPKVLSK--MSYEKYAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKT 160
            W+ SN+   L K  M++ +     EE           + F ++FQH++FL     +   
Sbjct: 120 QWAKSNNGDALLKGTMNHIQPGASAEE----------LLMFKKIFQHYIFLTLNARITSN 169

Query: 161 RKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIID 220
            K L  P+V +PM  +G+ IP+VRV+NLF++K+++    L   +P L+ +N   L +II+
Sbjct: 170 AKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIIN 229

Query: 221 SPQLPEDVSSKRELKRLYQRACRGAYTIEQHPVLGLEIKESKLLKRL 267
           +    +  ++ R L+RLYQRA + A+ I       ++   +K L R+
Sbjct: 230 A----DYENTSRSLRRLYQRASKNAHVIAGESPESIQFAIAKDLHRM 272

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score =  114 bits (284), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 106/214 (49%), Gaps = 29/214 (13%)

Query: 40  YTADGSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQ 99
           Y   G SK LESI++  YF W NE   H+K     Y  L+ +WP E H    + + P+  
Sbjct: 58  YETTGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAE-PEAI 116

Query: 100 SIRFLWSSNSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEVFQHFLFLK-SRPHLC 158
           S+R  W  N        + +    D   +P              +  HF +L+ +   LC
Sbjct: 117 SLRNAWMRNKA-----TAVDLSTSDGVIKP--------------ILNHFRYLRVNEDRLC 157

Query: 159 KTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKI 218
           K + GL  PI+E+P+   G  IPE RV NL K++IA+V K L  D+P LS + E +L  I
Sbjct: 158 KKKVGL--PILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSI 215

Query: 219 IDSPQLPEDVSSKRELKRLYQRACRGAYTIEQHP 252
           I+      D  + R LKR+Y R+C  AYT E +P
Sbjct: 216 IN------DSKNTRALKRVYLRSCSRAYTGESNP 243

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 97.4 bits (241), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 110/224 (49%), Gaps = 28/224 (12%)

Query: 45  SSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMD---------- 94
           S K+LESIV+ T+F W N    H   F++HY  L  HWP+E HRS++             
Sbjct: 65  SLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISL 124

Query: 95  TPKTQSIRFLWSS----NSPKVLSKMSYEKYAHDTEERPSRLTEL-----QRTVQFHEVF 145
           T K   ++  W++     +P V +       +    +  + + EL     +RT     + 
Sbjct: 125 TSKGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQ--NSIAELDAFTAERTFLVKSLG 182

Query: 146 QHFLFLKSRPHLCKTRKGLAVPIVEIPMK-PLGQNIPEVRVRNLFKRKIAYVWKVLALDS 204
            H+ FL +  HL    K    P+V+IP++  LG+  P  ++  LF R++A ++  L +++
Sbjct: 183 NHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVEN 242

Query: 205 PALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYTI 248
           P LS  NEL+L  + D      D + +R   RLY RAC  AYTI
Sbjct: 243 PPLSTANELALMTVFD------DGTLERRHTRLYMRACARAYTI 280

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score = 95.1 bits (235), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 109/224 (48%), Gaps = 35/224 (15%)

Query: 44  GSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSI---LSMDTPKTQS 100
            S K+LESI++ T+F W N    H   F++HY  L  HWP+E HR +   ++++  K  S
Sbjct: 64  ASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLNS 123

Query: 101 I--RFLWSS--------------NSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEV 144
              R +W                 +P  L ++S       T ER   +  L         
Sbjct: 124 TSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLG-------- 175

Query: 145 FQHFLFLKSRPHLCKTRKGLAVPIVEIPMK-PLGQNIPEVRVRNLFKRKIAYVWKVLALD 203
             H+ FL +  HL    K    P V+IP++  LG+  P  ++  LF R++++++K L ++
Sbjct: 176 -NHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIE 234

Query: 204 SPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYT 247
           +P LS +NEL+L  +        D + +R L+RLY RAC  AYT
Sbjct: 235 NPPLSPENELALTAVF------YDETVERRLRRLYMRACARAYT 272

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 90.5 bits (223), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 106/225 (47%), Gaps = 41/225 (18%)

Query: 47  KSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSI----------LSMDTP 96
           K+LESI++ T+F W N    H   F++HY  L  HWP+E HR +          L+    
Sbjct: 67  KALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPS 126

Query: 97  KTQSIRFLWSS------------NSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEV 144
           KT  ++  W++             +PK LS+   + +   T ER   +  L         
Sbjct: 127 KTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAF---TPERAFLVNSLG-------- 175

Query: 145 FQHFLFLKSRPHLCKTRKGLAVPIVEIPMK-PLGQNIPEVRVRNLFKRKIAYVWKVLALD 203
              + FL +  HL    K    P V+IP++  LG+  P  ++  LF R++AY++  L  +
Sbjct: 176 -NQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEE 234

Query: 204 SPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYTI 248
           +P LS  N+++L  I +      D +  R  KRLY RAC  AYTI
Sbjct: 235 NPPLSPANDIALMAIFN------DKTMDRRFKRLYMRACARAYTI 273

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 86.3 bits (212), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 103/223 (46%), Gaps = 32/223 (14%)

Query: 45  SSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSI----------LSMD 94
           S K+LESI+  T+F W N    H   F++H+  L  HWP+E HRS+          L+  
Sbjct: 65  SLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLNSM 124

Query: 95  TPKTQSIRFLWSS---------NSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEVF 145
             K   ++  W++          +P   +  +Y   A+     P      +RT   + + 
Sbjct: 125 ASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTP------ERTFLVNSLG 178

Query: 146 QHFLFLKSRPHLCKTRKGLAVPIVEIPMK-PLGQNIPEVRVRNLFKRKIAYVWKVLALDS 204
            H+ FL +  HL    K    P V+IP++  LG+     ++  LF R++  ++  L +++
Sbjct: 179 NHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVEN 238

Query: 205 PALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYT 247
           P LS  NEL+L  +        D S  R  KRLY RAC  AYT
Sbjct: 239 PPLSADNELALMAVF------HDDSLDRRHKRLYMRACARAYT 275

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 103/211 (48%), Gaps = 17/211 (8%)

Query: 47  KSLESIVHLTYFHWCNEDA------PHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQS 100
           K L +++   Y  W N  +      PH+  F + +  L   WP E H S L   T    +
Sbjct: 61  KILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLS-LKQSTKGHAT 119

Query: 101 IRFLWSSNSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKT 160
           ++  W +N+   L +MS++  A +     S   EL+ +++  ++  H+  L +   +   
Sbjct: 120 LKHAWVTNNKHAL-QMSFDAAAANPT---SGNIELRGSLR--QILSHYQLLYNNMRMFGK 173

Query: 161 RKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELS-LAKII 219
            K L VP+ EIP+   G+ IP  R  NL +RK+ YV +VL  + PAL     ++ L  II
Sbjct: 174 IK-LQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAII 232

Query: 220 --DSPQLPEDVSSKRELKRLYQRACRGAYTI 248
             D P       S R+L+RLY+RA  G YT+
Sbjct: 233 AGDGPAARSGNYSPRQLRRLYRRAFAGCYTL 263

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 79/181 (43%), Gaps = 38/181 (20%)

Query: 44  GSSKSLESIVHLTYFHWCN--EDAPHIKKFREHYAELRDHWPYEFHRSILSMD--TPKTQ 99
           G  K L+ I+  T+  + N  ++  H+K F+  Y  L  +WPYE H  + + +   P+T+
Sbjct: 70  GQLKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETK 129

Query: 100 SIRFLWSSNSPKVLSKMSYE-----------------KYAHD--TEERPSRLTELQRTVQ 140
           ++ +LW++ +   L+ M  +                  Y H    E   S +  L   + 
Sbjct: 130 ALEYLWNNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIID 189

Query: 141 --------FHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRK 192
                   F E+F+         H   T   L +PIV +P+  LG  IP+ R+ N FK+K
Sbjct: 190 EKEIEINLFGELFKQL-------HYINTINKLQIPIVILPLNALGLKIPKSRLYNKFKKK 242

Query: 193 I 193
           +
Sbjct: 243 L 243

>TDEL0H00290 Chr8 complement(40466..42475) [2010 bp, 669 aa] {ON}
           Anc_7.542 YPR185W
          Length = 669

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 122 AHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQ-NI 180
           A+D     S+L+E+Q ++   ++    L   S+P L K R GL+ PI+      + + N+
Sbjct: 165 ANDLHVNLSKLSEIQGSMPALQISTRVLD-GSKPILSKGRIGLSKPIISTYSNVINESNV 223

Query: 181 PEVRVRNLFKRKIAYVWKVLAL 202
           P     +L +RKI  VW    L
Sbjct: 224 PS----HLEQRKITSVWTKFGL 241

>CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q12393 Saccharomyces cerevisiae
           YLR091w
          Length = 278

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 167 PIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSR--QNEL--SLAKIIDSP 222
           P+    + PLG    E + +N  +  +  +W++LA+  P LSR   +EL  +L + + + 
Sbjct: 175 PLTIRELTPLGALESEAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTLKRTLGTS 234

Query: 223 QLPEDVSSKRELKRLYQRA 241
           +   D S  R   +L QRA
Sbjct: 235 R--TDRSIARAYLQLLQRA 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,969,161
Number of extensions: 1048628
Number of successful extensions: 2649
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2678
Number of HSP's successfully gapped: 24
Length of query: 267
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 159
Effective length of database: 41,097,471
Effective search space: 6534497889
Effective search space used: 6534497889
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)