Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13574g8.267ON1121124654e-61
Kwal_56.237768.267ON130882972e-35
AGR081C8.267ON130752573e-29
SAKL0H16918g8.267ON111592538e-29
Ecym_43038.267ON109892467e-28
KLLA0F19250g8.267ON116752461e-27
ZYRO0C01540g8.267ON97632422e-27
NCAS0B038208.267ON115842381e-26
TPHA0A017708.267ON104682372e-26
KAFR0B054908.267ON85882273e-25
Smik_4.3598.267ON105802284e-25
Suva_2.2748.267ON105892267e-25
TDEL0F039408.267ON110542269e-25
Skud_4.3758.267ON105552269e-25
YDR115W8.267ON105682233e-24
CAGL0B01793g8.267ON98902206e-24
Kpol_543.428.267ON112582163e-23
NDAI0J013408.267ON141542021e-20
KNAG0H032208.267ON86491952e-20
TBLA0E044708.267ON94521945e-20
Suva_4.2183.159ON100736651.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13574g
         (112 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...   183   4e-61
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...   119   2e-35
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...   103   3e-29
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...   102   8e-29
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    99   7e-28
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    99   1e-27
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    98   2e-27
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    96   1e-26
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    96   2e-26
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    92   3e-25
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    92   4e-25
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    92   7e-25
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    92   9e-25
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    92   9e-25
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    91   3e-24
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    89   6e-24
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    88   3e-23
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    82   1e-20
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    80   2e-20
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    79   5e-20
Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W...    30   1.8  

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score =  183 bits (465), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 94/112 (83%), Positives = 94/112 (83%)

Query: 1   MSFIYNXXXXXXXXXXXXXXXXXXPLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFG 60
           MSFIYN                  PLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFG
Sbjct: 1   MSFIYNRLFQFSARRSLSSLSSFSPLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFG 60

Query: 61  FTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112
           FTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH
Sbjct: 61  FTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score =  119 bits (297), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 64/88 (72%)

Query: 25  PLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFGFTQRRWKSRGNTYQPSTLKRKRRV 84
           PLN    R  V Q    +A   SS       S+LFG TQ+RWKSRGNTYQPSTLKRKRRV
Sbjct: 43  PLNVCMFRSPVSQVNNSIATGSSSSAMPSYLSSLFGLTQKRWKSRGNTYQPSTLKRKRRV 102

Query: 85  GFLARAKSKQGYKVLKRRREKGRWYLTH 112
           GFLAR KSKQG K+LKRRREKGRWYLTH
Sbjct: 103 GFLARVKSKQGSKILKRRREKGRWYLTH 130

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score =  103 bits (257), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 58/75 (77%), Gaps = 5/75 (6%)

Query: 38  AAAPMAAERSSQGSSPLFSALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYK 97
           A  P AA + S     + S L G TQ+RWKSRGNTYQPSTLKRKRRVGFLARA+S+ G  
Sbjct: 61  AFTPAAAPKPS-----MLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRN 115

Query: 98  VLKRRREKGRWYLTH 112
           +LKRRREKGRWYLTH
Sbjct: 116 ILKRRREKGRWYLTH 130

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score =  102 bits (253), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 47/59 (79%), Positives = 52/59 (88%)

Query: 54  LFSALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112
           + + L G TQRRWKSRGNTYQPSTLKRKRRVGFLARAK+KQ  K+LK R+EKGRWYLTH
Sbjct: 53  IMNILLGLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 99.4 bits (246), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 55/89 (61%), Positives = 66/89 (74%), Gaps = 2/89 (2%)

Query: 26  LNAVSCRPSVFQAAAPMAAERS-SQGSSP-LFSALFGFTQRRWKSRGNTYQPSTLKRKRR 83
           +++ S   S+ Q  A  AA  S S    P + S +FG  QRRWKSRGNT+QPSTLKRKRR
Sbjct: 21  VSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQRRWKSRGNTFQPSTLKRKRR 80

Query: 84  VGFLARAKSKQGYKVLKRRREKGRWYLTH 112
           VGFLARA+SK G K+LKRR+EKGRWYLT+
Sbjct: 81  VGFLARARSKTGQKILKRRKEKGRWYLTY 109

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 99.4 bits (246), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 3/75 (4%)

Query: 41  PMAAERSSQ---GSSPLFSALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYK 97
           PM     SQ     S +F  LF  TQRRWKSRGNT+QPSTLKRKRRVGFLARA+S+ G +
Sbjct: 42  PMEITLQSQTQANGSSIFGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQ 101

Query: 98  VLKRRREKGRWYLTH 112
           +LKRR+ KGRWYLT+
Sbjct: 102 ILKRRKNKGRWYLTY 116

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 97.8 bits (242), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 49/63 (77%), Positives = 55/63 (87%), Gaps = 1/63 (1%)

Query: 50  GSSPLFSALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWY 109
           G SPL S  FG  QRRWKSRGNT+QPSTLKRKRRVGFLARA+SKQG K+L+RR+ KGRW+
Sbjct: 36  GPSPLSSG-FGMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWF 94

Query: 110 LTH 112
           LTH
Sbjct: 95  LTH 97

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 96.3 bits (238), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 50/84 (59%), Positives = 59/84 (70%), Gaps = 4/84 (4%)

Query: 31  CRPSVFQAAAPMAAERSSQGSSPLFSAL--FGFTQRRWKSRGNTYQPSTLKRKRRVGFLA 88
            R  +    +PM +   SQ  SP+  +L  FG  QRRWKSRGNTYQPSTLKRKR+ GFLA
Sbjct: 34  IRQGITGLGSPMGSNVLSQ--SPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKFGFLA 91

Query: 89  RAKSKQGYKVLKRRREKGRWYLTH 112
           +A+  Q  K+LKRRR KGRWYLTH
Sbjct: 92  KARDSQKCKILKRRRLKGRWYLTH 115

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 95.9 bits (237), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 46/68 (67%), Positives = 54/68 (79%), Gaps = 5/68 (7%)

Query: 50  GSSPLFSALFGFT-----QRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRRE 104
           GS    +++ G       QRRWKSRGNTYQPSTLKRKRR+GFLARA+SKQG K+L+RR+ 
Sbjct: 37  GSRTGLASILGLNLDLGLQRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKA 96

Query: 105 KGRWYLTH 112
           KGRWYLTH
Sbjct: 97  KGRWYLTH 104

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 92.0 bits (227), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 5/88 (5%)

Query: 25  PLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFGFTQRRWKSRGNTYQPSTLKRKRRV 84
           P+   +   S+F++      +     S+ +F  L  F Q+RWKSRGNTYQPSTLKRKR+ 
Sbjct: 3   PIIKTNRNTSIFKSVILNTVQ-----STNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKF 57

Query: 85  GFLARAKSKQGYKVLKRRREKGRWYLTH 112
           GFL+RAKSKQ  K+LK R+EKGRWYL+H
Sbjct: 58  GFLSRAKSKQKSKILKDRKEKGRWYLSH 85

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 92.4 bits (228), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 34  SVFQAAAPMAAERSSQGSSPLFSALFGFT-QRRWKSRGNTYQPSTLKRKRRVGFLARAKS 92
           +V +    M    S   +  L +  FGF  QRRWKSRGNTYQPSTLKRKR  GFLARAKS
Sbjct: 26  TVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKS 85

Query: 93  KQGYKVLKRRREKGRWYLTH 112
           KQG K+LKRR+ KGRW+L+H
Sbjct: 86  KQGSKILKRRKLKGRWFLSH 105

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 91.7 bits (226), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 61/89 (68%), Gaps = 5/89 (5%)

Query: 25  PLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFGFT-QRRWKSRGNTYQPSTLKRKRR 83
           P++A+S    V +    M    S   +  L    FGF  QRRWKSRGNTYQPSTLKRKR 
Sbjct: 21  PISALS----VLRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWKSRGNTYQPSTLKRKRT 76

Query: 84  VGFLARAKSKQGYKVLKRRREKGRWYLTH 112
            GFLARAKSKQG K+LKRR+ KGRW+L+H
Sbjct: 77  FGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 91.7 bits (226), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 42/54 (77%), Positives = 49/54 (90%)

Query: 59  FGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112
           FG  QRRWKSRGNT+QPSTLKRKRR+GFLARA+SK G +VL+RR+ KGRWYLT+
Sbjct: 57  FGIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 91.7 bits (226), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 1/55 (1%)

Query: 59  FGFT-QRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112
           FGF  QRRWKSRGNTYQPSTLKRKR  GFLARAKSKQG K+LKRR+ KGRW+L+H
Sbjct: 51  FGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 90.5 bits (223), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (80%), Gaps = 2/68 (2%)

Query: 47  SSQGSSPLFSAL-FGFT-QRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRRE 104
           SS   +P F+ L FG   QRRWKSRGNTYQPSTLKRKR  GFLARAKSKQG K+LKRR+ 
Sbjct: 38  SSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKL 97

Query: 105 KGRWYLTH 112
           KGRW+L+H
Sbjct: 98  KGRWFLSH 105

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 89.4 bits (220), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (66%), Gaps = 4/90 (4%)

Query: 25  PLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFGF--TQRRWKSRGNTYQPSTLKRKR 82
           P+N       + + +  +     S G+S  FS++      QRRWKSRGNTYQPSTLKRKR
Sbjct: 11  PMNLTPGNGMIGKNSVSLIRNEISSGTS--FSSILTLFPLQRRWKSRGNTYQPSTLKRKR 68

Query: 83  RVGFLARAKSKQGYKVLKRRREKGRWYLTH 112
           + GFLAR  +K+  K++KRR+EKGRWYLTH
Sbjct: 69  KFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 87.8 bits (216), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 41/58 (70%), Positives = 49/58 (84%), Gaps = 1/58 (1%)

Query: 55  FSALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112
            + L G  QRRWKSRGNTYQPSTLKRKR+ GFLARA+S+ G K+L+RR+ KGRWYL+H
Sbjct: 56  ITGLLGL-QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 82.4 bits (202), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 36/54 (66%), Positives = 45/54 (83%)

Query: 59  FGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112
           F   Q+RWKSRGNTYQPSTLKRKR+ GFL+R + +Q  K+LKRR+ KGRW+L+H
Sbjct: 88  FMINQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 79.7 bits (195), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 38/49 (77%), Positives = 43/49 (87%)

Query: 64  RRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112
           RRWKSRGNTYQPSTLKRKR+ GFLAR ++    KVLKRR+EKGRWYL+H
Sbjct: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 79.3 bits (194), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (82%)

Query: 61  FTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112
              RRWKSRGNTYQPSTLKRKR+ GFL+RAKS    K+LKRR+ KGRW+L+H
Sbjct: 43  IDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W
           (REAL)
          Length = 1007

 Score = 29.6 bits (65), Expect = 1.8,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 52  SPLFSALFGFTQRRWKSRGN---TYQPSTLKRKRRV 84
           +P++ +L G  ++RW   G    T+QP TL   +R+
Sbjct: 570 APMYDSLAGLMKKRWVDEGKPEYTFQPPTLSYTKRL 605

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.131    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,719,994
Number of extensions: 280400
Number of successful extensions: 685
Number of sequences better than 10.0: 23
Number of HSP's gapped: 685
Number of HSP's successfully gapped: 23
Length of query: 112
Length of database: 53,481,399
Length adjustment: 82
Effective length of query: 30
Effective length of database: 44,078,787
Effective search space: 1322363610
Effective search space used: 1322363610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)