Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13552g8.268ON28128112940.0
Kwal_56.237758.268ON28128110241e-141
SAKL0H16896g8.268ON2852619141e-124
Ecym_43028.268ON2752467851e-104
ZYRO0C01518g8.268ON2772607781e-103
TDEL0F039508.268ON2762617741e-103
KLLA0F19272g8.268ON2662567601e-101
TPHA0J007708.268ON2782827571e-100
AGR080W8.268ON2752627174e-94
Kpol_392.38.268ON2812447122e-93
YDR116C (MRPL1)8.268ON2852717105e-93
Smik_4.3608.268ON2852737089e-93
Suva_2.2758.268ON2852737019e-92
NCAS0B038108.268ON3142736996e-91
Skud_4.3768.268ON2852646792e-88
NDAI0J013308.268ON3142496711e-86
KNAG0H032108.268ON2852845706e-72
KAFR0B054808.268ON2802465698e-72
CAGL0B01815g8.268ON2902475577e-70
TBLA0I031908.268ON2412144069e-48
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13552g
         (281 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   503   0.0  
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   399   e-141
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   356   e-124
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   306   e-104
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   304   e-103
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   302   e-103
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   297   e-101
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   296   e-100
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   280   4e-94
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   278   2e-93
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   278   5e-93
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   277   9e-93
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   274   9e-92
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   273   6e-91
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   266   2e-88
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   263   1e-86
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   224   6e-72
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   223   8e-72
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   219   7e-70
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   160   9e-48

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  503 bits (1294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/281 (90%), Positives = 255/281 (90%)

Query: 1   MFSGLSSRFLPLVRASPVRRLHVSASLRAEEPVGNATSKLSKDQLKKREVXXXXXXXXXX 60
           MFSGLSSRFLPLVRASPVRRLHVSASLRAEEPVGNATSKLSKDQLKKREV          
Sbjct: 1   MFSGLSSRFLPLVRASPVRRLHVSASLRAEEPVGNATSKLSKDQLKKREVRRFAQKKAAA 60

Query: 61  XXXXSEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALK 120
               SEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALK
Sbjct: 61  RRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALK 120

Query: 121 ELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQ 180
           ELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQ
Sbjct: 121 ELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQ 180

Query: 181 XXXXXXXXXXXXAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLEN 240
                       AAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLEN
Sbjct: 181 LGRILGPRGLLPAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLEN 240

Query: 241 IVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281
           IVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA
Sbjct: 241 IVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  399 bits (1024), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 202/281 (71%), Positives = 223/281 (79%)

Query: 1   MFSGLSSRFLPLVRASPVRRLHVSASLRAEEPVGNATSKLSKDQLKKREVXXXXXXXXXX 60
           M S LS R +PLV+    R LH  ++LRAEE      SKLSKDQL+KRE+          
Sbjct: 1   MLSRLSKRIVPLVQFPYARNLHAFSALRAEETPSPVVSKLSKDQLRKREIRKLAQKKAAA 60

Query: 61  XXXXSEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALK 120
               ++HPLYMPVDKALRFLRAAE GQP SQQTLSVTTIVISERGAP LSGN+SFP  LK
Sbjct: 61  RRPATDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLK 120

Query: 121 ELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQ 180
           +LKIAVFTNDEQQAQIAREKF CH+VGGS+LVEKIK+G V LDFDKSFATPEI TLLASQ
Sbjct: 121 DLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQ 180

Query: 181 XXXXXXXXXXXXAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLEN 240
                       AAKKGTV+ENLE L+K+SMGTLPFRQRGN +S+AVG+CSFTDKQLLEN
Sbjct: 181 LGRILGPRGLLPAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLEN 240

Query: 241 IVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281
           I+AAQK +KEALA QK KKPSLLGQTTLTST GPGIVIDFA
Sbjct: 241 ILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  356 bits (914), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 176/261 (67%), Positives = 210/261 (80%), Gaps = 1/261 (0%)

Query: 21  LHVSASLRAEEPVGNATSKLSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKALRFL 80
            H   +L++EEP   AT KLSKDQLK+RE+              ++HPLYMPV +ALRFL
Sbjct: 26  FHTFTALKSEEPSTIAT-KLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFL 84

Query: 81  RAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREK 140
           RAAEVGQPQSQQT+S+TT+VISERGAP L+GN+SFP  LK++KIAVFTNDE + +IAR++
Sbjct: 85  RAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQ 144

Query: 141 FNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXXXXXXXAAKKGTVS 200
           FNCH+VGGSEL+EKIK+G+VPLDFDK+FATP+IA  L SQ             AKKGTV+
Sbjct: 145 FNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQLGRILGPRGLLPNAKKGTVT 204

Query: 201 ENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKP 260
           E++ SLIKDSMGTLPFRQRGN ISIAV +CSFTD Q+LENI+AAQKS K ALANQKAKKP
Sbjct: 205 EDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKP 264

Query: 261 SLLGQTTLTSTRGPGIVIDFA 281
           S+LGQTTLT+T GPG+VIDFA
Sbjct: 265 SILGQTTLTTTHGPGLVIDFA 285

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  306 bits (785), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 192/246 (78%)

Query: 35  NATSKLSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKALRFLRAAEVGQPQSQQTL 94
           ++T+KLSK+Q+KK+E+               EHPLYMPV +A RFLRAAEVGQP SQQT+
Sbjct: 29  SSTTKLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTI 88

Query: 95  SVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEK 154
           S+TT+V+S++GAPLLSGN+ FPN L+++K+AVFTN+++Q ++ARE+F CH+VGG+EL+E 
Sbjct: 89  SLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEA 148

Query: 155 IKQGQVPLDFDKSFATPEIATLLASQXXXXXXXXXXXXAAKKGTVSENLESLIKDSMGTL 214
           IK G  P+DFDK+ ATP++   L SQ            A KKGTVSEN+ +LI+++M T+
Sbjct: 149 IKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTV 208

Query: 215 PFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGP 274
           PFRQRG  +S+AVG+C F+DKQLL+NIVA QK+ K+ALA+Q+ KK S+LG+TT+TST GP
Sbjct: 209 PFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGP 268

Query: 275 GIVIDF 280
           GIVIDF
Sbjct: 269 GIVIDF 274

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  304 bits (778), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 193/260 (74%), Gaps = 4/260 (1%)

Query: 21  LHVSASLRAEEPVGNATSKLSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKALRFL 80
            H +A LRAEE    A SKL+K+QL+KREV                HPLYMP   ALR+L
Sbjct: 21  FHTAALLRAEE----AGSKLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPTPLALRYL 76

Query: 81  RAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREK 140
           RA EVG P SQQ ++VTT V+++RG P ++GNVS P+ LK++ +AVF+NDEQQ  +AR+K
Sbjct: 77  RAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDK 136

Query: 141 FNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXXXXXXXAAKKGTVS 200
           F CH+VGGS+++ KIKQG++P+DFDK+FATP+IA  L SQ             AK+GTV+
Sbjct: 137 FRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVA 196

Query: 201 ENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKP 260
            +LE LIKDS G++PFRQ+GN+IS+AV +C F+D+Q+LEN++A Q + KEA++NQKAK+P
Sbjct: 197 SDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRP 256

Query: 261 SLLGQTTLTSTRGPGIVIDF 280
           S+LG+TTLT+T GPGIVID 
Sbjct: 257 SILGRTTLTTTHGPGIVIDL 276

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  302 bits (774), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 197/261 (75%), Gaps = 1/261 (0%)

Query: 21  LHVSASLRAEEPVGNATSKLSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKALRFL 80
           LH    LRAEE   N  SKLSKDQLKKRE+              S+HPLYM +  ALRFL
Sbjct: 17  LHTGNVLRAEEAAAN-VSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIPMALRFL 75

Query: 81  RAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREK 140
           RAAEVGQPQ+QQT+++TT V++ERG P L+G+VSFP  LKE+KIAVF+ DE Q ++AREK
Sbjct: 76  RAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQLKVAREK 135

Query: 141 FNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXXXXXXXAAKKGTVS 200
           FNCH+VGG+E++EKIK G++P+DFDK+FATP+IA  L SQ              KKGTV+
Sbjct: 136 FNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARILGPRGVLPTVKKGTVA 195

Query: 201 ENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKP 260
            ++  L++DSMG++PFRQRGN ISIAVG+ SF+D+Q+LEN +A   +VKEALANQ +KK 
Sbjct: 196 TDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDAVKEALANQVSKKT 255

Query: 261 SLLGQTTLTSTRGPGIVIDFA 281
           SLLG+TTL+ST GPGIVIDFA
Sbjct: 256 SLLGKTTLSSTHGPGIVIDFA 276

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  297 bits (760), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 191/256 (74%), Gaps = 3/256 (1%)

Query: 26  SLRAEEPVGNATSKLSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKALRFLRAAEV 85
           S R  E  G   +KL+K+QL+KRE+              S+HPLYMPV +ALR+LRA EV
Sbjct: 14  SFRLAEETG---TKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEV 70

Query: 86  GQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFNCHV 145
           GQP SQQT+++TT+V++ERG P L+GNVSF   LK++K+AVFTNDE QA + ++K++ H+
Sbjct: 71  GQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHL 130

Query: 146 VGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXXXXXXXAAKKGTVSENLES 205
           VGGS+LV +IK G+V +DFDK+FATP+I   LASQ             AKKGTV+E+LE 
Sbjct: 131 VGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEP 190

Query: 206 LIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQ 265
           LIKDSM ++PFRQRGN+IS+ V +  FTDK++LEN++A QK+ K+++ NQ+ KKPS+L Q
Sbjct: 191 LIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQ 250

Query: 266 TTLTSTRGPGIVIDFA 281
           TTLTST GPGIVIDFA
Sbjct: 251 TTLTSTHGPGIVIDFA 266

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  296 bits (757), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 205/282 (72%), Gaps = 10/282 (3%)

Query: 5   LSSRFLPLVRASPVRRLHVSASLR-----AEEPVGNATSKLSKDQLKKREVXXXXXXXXX 59
           L + FL + R +     HVS  +R     AE P+    SKLSKDQLKKRE+         
Sbjct: 2   LKANFLQVTRKNA---FHVSRIIREEITGAEGPIAQV-SKLSKDQLKKRELRRFTIRKRE 57

Query: 60  XXXXXSEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNAL 119
                + HPLYM V +ALRFLRAAEVGQP SQQT+++TT+V+SE+G+P L+G+++F   L
Sbjct: 58  AKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPL 117

Query: 120 KELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLAS 179
           KE+KIA+FTNDE Q +IA+EKFNC+VVGGSEL+ KIK G++ +DFDK+FATP+I   L S
Sbjct: 118 KEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS 177

Query: 180 QXXXXXXXXXXXXAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLE 239
                        + KKGTVSEN+E LIK ++G++PFRQ GN IS+A+G+C+F+D+Q+LE
Sbjct: 178 -VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILE 236

Query: 240 NIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281
           N+++ +K+ K++++ QK KKPS+LG+T L++T GPGIVIDF+
Sbjct: 237 NLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  280 bits (717), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 136/262 (51%), Positives = 188/262 (71%), Gaps = 1/262 (0%)

Query: 19  RRLHVSASLRAEEPVGNATSKLSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKALR 78
           R LH++A   ++E     +SKLSKDQLKKRE+              S  PLYMPV +ALR
Sbjct: 13  RGLHLTAVQLSQEAAAT-SSKLSKDQLKKRELRRLAQRKAAARRPASASPLYMPVQQALR 71

Query: 79  FLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAR 138
           FLRAAEVGQP +QQT+SV T+VI ++GA LLSG V+ P+ ++E K+AVFTND +QA+ AR
Sbjct: 72  FLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETAR 131

Query: 139 EKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXXXXXXXAAKKGT 198
            K+ C++VGG+ELVE++K G+V +DFDK+FATP+IA L+A++            + KKGT
Sbjct: 132 TKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKKGT 191

Query: 199 VSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAK 258
           V+ +L  L+ D + + PF+QR N IS+A+G+C F+D+Q++EN++A Q + + A+ +QK K
Sbjct: 192 VAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQKTK 251

Query: 259 KPSLLGQTTLTSTRGPGIVIDF 280
           K SL G TTLTST GPGIVIDF
Sbjct: 252 KTSLFGTTTLTSTHGPGIVIDF 273

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  278 bits (712), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 131/244 (53%), Positives = 181/244 (74%)

Query: 38  SKLSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVT 97
           SK  KD+LK+RE+              S +PLYMP+ +ALR+LRAAEVGQP SQQ +++T
Sbjct: 38  SKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQIITIT 97

Query: 98  TIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQ 157
           T V+SERG   L+GN+S+   +K++KIAVF+ND ++    +E+ NCH++GG++LVEKIK 
Sbjct: 98  TDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKS 157

Query: 158 GQVPLDFDKSFATPEIATLLASQXXXXXXXXXXXXAAKKGTVSENLESLIKDSMGTLPFR 217
           G+ P+DFDK+FATP+I+ +L SQ              KKGTVSE++ SLIK S+G +PFR
Sbjct: 158 GKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFR 217

Query: 218 QRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIV 277
           Q GN+IS++VGRC+F+DKQ+LENI+A + +    L++QK+KKPSLLG+TT+TST GPGI 
Sbjct: 218 QTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPGIT 277

Query: 278 IDFA 281
           IDFA
Sbjct: 278 IDFA 281

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  278 bits (710), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 137/271 (50%), Positives = 192/271 (70%), Gaps = 6/271 (2%)

Query: 17  PVRR--LHVSASLRAEEPVGNATSK----LSKDQLKKREVXXXXXXXXXXXXXXSEHPLY 70
           P RR   H +  L A++    A S     L+KDQ KKRE+              +  PLY
Sbjct: 15  PARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLY 74

Query: 71  MPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTND 130
           MPV KALR+LRAAEVG+PQSQQT+++TT+V+ ERG   LSG+V+FP  L+ +KIA FTND
Sbjct: 75  MPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTND 134

Query: 131 EQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXXXXX 190
           E + +  REK+  H++GG++LV KIK G++ +DFDK+FATP+I   L SQ          
Sbjct: 135 ESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRGV 194

Query: 191 XXAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKE 250
             + KKGTVS+++ SL+++S+G++PFRQRGN+ISI VG+C FTD+++L+NI++A+ + K 
Sbjct: 195 LPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFKT 254

Query: 251 ALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281
           A+ NQK+KKP++L +TTL+ST GPGIVIDFA
Sbjct: 255 AVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  277 bits (708), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 136/273 (49%), Positives = 194/273 (71%), Gaps = 6/273 (2%)

Query: 15  ASPVRRL--HVSASLRAEEPVGNATSK----LSKDQLKKREVXXXXXXXXXXXXXXSEHP 68
           AS  RR   H +  L AEE    A S     L+KDQ KKRE+              + +P
Sbjct: 13  ASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNP 72

Query: 69  LYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFT 128
           LYMPV  ALR+LRAAEVG+PQSQQT+++TT+V+ ERG   LSG+V+FP  L+ +K+A FT
Sbjct: 73  LYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFT 132

Query: 129 NDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXXX 188
           NDE + +  R+K+  H++GG++LV +IK G++P+DFDK+FATP+I   L SQ        
Sbjct: 133 NDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPR 192

Query: 189 XXXXAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSV 248
               + KKGTVS+++ SL+++S+G++PFRQRGN+IS+ VG+C F+D+++L+NI++A+ + 
Sbjct: 193 GVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAF 252

Query: 249 KEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281
           K A+ NQK+KKP+LL +TTL+ST GPGIVIDFA
Sbjct: 253 KAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  274 bits (701), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 139/273 (50%), Positives = 191/273 (69%), Gaps = 6/273 (2%)

Query: 15  ASPVRRL--HVSASLRAEEPVGNATSK----LSKDQLKKREVXXXXXXXXXXXXXXSEHP 68
           ASP+RR   H +  L AEE    A S     L+KDQ KKRE+              +  P
Sbjct: 13  ASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSP 72

Query: 69  LYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFT 128
           L+MPV  ALR+LRAAEVG+PQSQQT+++TT+V+ ERG   +SGNV+F   L+ +K+AVFT
Sbjct: 73  LHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFT 132

Query: 129 NDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXXX 188
           NDE + +  REK+   +VGG++LV KIK  + P+DFDK+FATP+I   L SQ        
Sbjct: 133 NDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPR 192

Query: 189 XXXXAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSV 248
               + KKGTVS+++ SL+++S+G++PFRQRGN IS+ +G+C FTD++LL+NI++A+ + 
Sbjct: 193 GVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAF 252

Query: 249 KEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281
           + A+ NQKAKKPSLL +TTL+ST GPGIVIDFA
Sbjct: 253 RAAVDNQKAKKPSLLSKTTLSSTHGPGIVIDFA 285

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  273 bits (699), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 133/273 (48%), Positives = 193/273 (70%), Gaps = 7/273 (2%)

Query: 15  ASPVRRLHVSASLRAEEPVGNATS-------KLSKDQLKKREVXXXXXXXXXXXXXXSEH 67
           +S  R +H ++++ AEE     TS        LSK+QLKKRE+              S H
Sbjct: 41  SSQSRGIHSTSNVGAEEAASTTTSATIPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIH 100

Query: 68  PLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVF 127
           PLYMPV +ALR++RAAEVG+P  QQT+++T++V++E+G   L+G++S P  LK LK+AVF
Sbjct: 101 PLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVF 160

Query: 128 TNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXX 187
           + +E+     +EK++CH+VGG EL+ KIK G+V  DFDK+FA+ ++A +L++Q       
Sbjct: 161 SQNEELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLGR 220

Query: 188 XXXXXAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKS 247
                 AKKGTVS++LESL+ D +G+LPFRQ GN ISI +G+C F+D+++L NI+AA+ +
Sbjct: 221 RGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSA 280

Query: 248 VKEALANQKAKKPSLLGQTTLTSTRGPGIVIDF 280
           V +AL+ QK+KKPS+LG+TTL+ST GPGIVIDF
Sbjct: 281 VMKALSEQKSKKPSILGKTTLSSTHGPGIVIDF 313

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  266 bits (679), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 192/264 (72%), Gaps = 4/264 (1%)

Query: 22  HVSASLRAEEPVGNATSK----LSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKAL 77
           H ++ L AEE    A S     L+K+Q KKRE+              + +PLYMPV  AL
Sbjct: 22  HTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVAL 81

Query: 78  RFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIA 137
           R+LRAAEVG+PQSQQT+++TT+V+ ERG   LSG+V+FP  L+ +K+AVFTNDE + +  
Sbjct: 82  RYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKEL 141

Query: 138 REKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXXXXXXXAAKKG 197
           REK+  H++GG++LV +IK G++P+DFDK++AT +I   L SQ            + KKG
Sbjct: 142 REKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGVLPSVKKG 201

Query: 198 TVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKA 257
           TVS+++ SL+++S+G++PFRQRGN+IS+ +G+C FTD+++L+NI+AA+ + K A+++QK+
Sbjct: 202 TVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAAFKAAVSDQKS 261

Query: 258 KKPSLLGQTTLTSTRGPGIVIDFA 281
           KKP++L +TTL+ST GPGIVIDFA
Sbjct: 262 KKPNILSKTTLSSTHGPGIVIDFA 285

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  263 bits (671), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 174/249 (69%), Gaps = 1/249 (0%)

Query: 32  PVGNATSKLSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKALRFLRAAEVGQPQSQ 91
           P  NAT KLSK+QLKKRE+              + HPLYM V  ALRF+RAAEVG+P+ Q
Sbjct: 66  PPANAT-KLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQ 124

Query: 92  QTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFNCHVVGGSEL 151
           QT+++TT+++SE+G  LL+GN+     LKELKIAVF+ D++  +  + +FNC +VGG+E 
Sbjct: 125 QTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNET 184

Query: 152 VEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXXXXXXXXAAKKGTVSENLESLIKDSM 211
           VE IK G +  +FD +FATPEI   + SQ              KKGTVS++L +L+   M
Sbjct: 185 VEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKM 244

Query: 212 GTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTST 271
           G +PF+Q GNNISI +G+C F+DK +L NI+AA+ + KEALANQKAK+PS+L +TTL+ST
Sbjct: 245 GNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSST 304

Query: 272 RGPGIVIDF 280
            GPGIVIDF
Sbjct: 305 HGPGIVIDF 313

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  224 bits (570), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 182/284 (64%), Gaps = 7/284 (2%)

Query: 5   LSSRFLPLVRASPVRRLHVSASLRAEEPVGNATS-------KLSKDQLKKREVXXXXXXX 57
           L++ + P++   P+R LH      A+E V  A         KL+K+QL++RE+       
Sbjct: 2   LANHWRPVLLRMPLRALHTRFGPLAQEAVTGAAVAAAPAQPKLTKEQLRRRELRKMIRSK 61

Query: 58  XXXXXXXSEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPN 117
                  S+  +Y+ V +A+R LRA EVGQP SQQT+++TT+V+SE+G P L G+V  P 
Sbjct: 62  MLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTMVVSEKGVPPLHGDVVLPT 121

Query: 118 ALKELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLL 177
            LK ++IA F+ D +  +  +E+    +VGG+EL++++K G+VP+ FDK+FATP+IA  L
Sbjct: 122 PLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSGEVPVQFDKAFATPDIAPQL 181

Query: 178 ASQXXXXXXXXXXXXAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQL 237
            S+              KKGTV  +L ++I+  +G +PFRQR  N++  + +C F+D+Q+
Sbjct: 182 NSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFRQRAANLAFGIAKCHFSDRQV 241

Query: 238 LENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281
           L N++AA+++ + A+ NQK+KK S+LG++TL+ST GPGIVID A
Sbjct: 242 LGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVIDLA 285

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  223 bits (569), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 115/246 (46%), Positives = 156/246 (63%), Gaps = 1/246 (0%)

Query: 36  ATSKLSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKALRFLRAAEVGQPQSQQTLS 95
           A SK +K Q KK+ +              S HPLYM V  ALRFLRA EVGQP+SQQT++
Sbjct: 34  APSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTIT 93

Query: 96  VTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKF-NCHVVGGSELVEK 154
           +TT+VISE+G P + GNV  P  L+  K+ V ++D ++ +  ++ F N H+VGG ELV+K
Sbjct: 94  LTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDK 153

Query: 155 IKQGQVPLDFDKSFATPEIATLLASQXXXXXXXXXXXXAAKKGTVSENLESLIKDSMGTL 214
            K   + +DFDK  ATP+I                     KKGTVSENL  L+ +++ ++
Sbjct: 154 FKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSM 213

Query: 215 PFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGP 274
           PFRQR   IS+ +G+  F+DKQ+LENI+A +++    L+NQK KK S LG+TTLTST GP
Sbjct: 214 PFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGP 273

Query: 275 GIVIDF 280
           GIVIDF
Sbjct: 274 GIVIDF 279

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  219 bits (557), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 106/247 (42%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 40  LSKDQLKKREVXXXXXXXXXXXXXXSEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTI 99
           L+K+Q KKRE+              + HPLYMP+  ALR+LR+AEVG+P   QT++VTT+
Sbjct: 43  LTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTL 102

Query: 100 VISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFN--CHVVGGSELVEKIKQ 157
           V++++G   L+GN+ FP+ LK++KIA+F++++++    + K++    + GG +++  IK 
Sbjct: 103 VVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKS 162

Query: 158 GQVPLD-FDKSFATPEIATLLASQXXXXXXXXXXXXAAKK---GTVSENLESLIKDSMGT 213
           G++ +D  +K FATPEI   +ASQ              KK    TV E+L+SLI++++G 
Sbjct: 163 GKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQ 222

Query: 214 LPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRG 273
           + FRQRGN++S++VGRC+F+D+ +LENI+A + + K+++++Q AKKPS+LG+TT+++T G
Sbjct: 223 VSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAG 282

Query: 274 PGIVIDF 280
           PGIVIDF
Sbjct: 283 PGIVIDF 289

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  160 bits (406), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 134/214 (62%), Gaps = 2/214 (0%)

Query: 67  HPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAV 126
           HPL M V  ALR+LRA E G+  S+QT+++ T+V + RG   L G ++F   +++  IAV
Sbjct: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88

Query: 127 FTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQXXXXXX 186
           FT D +Q +IA+E     ++GGSEL++KI  G+  + F  +FAT ++   LA +      
Sbjct: 89  FTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDLA-RVAQKLG 146

Query: 187 XXXXXXAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQK 246
                   KK TV +N+  L++D +  +PF ++ + IS  VG+CSFTD+++L N++ A++
Sbjct: 147 KQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKARE 206

Query: 247 SVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDF 280
            +++AL  Q  KKPS + + TLTST GPGI ID 
Sbjct: 207 GLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,014,182
Number of extensions: 796266
Number of successful extensions: 1607
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1621
Number of HSP's successfully gapped: 21
Length of query: 281
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 173
Effective length of database: 41,097,471
Effective search space: 7109862483
Effective search space used: 7109862483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)