Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13530g8.269ON57456426050.0
Kwal_56.237718.269ON56256420750.0
SAKL0H16874g8.269ON56356316560.0
TDEL0F039608.269ON55856314870.0
Suva_2.2768.269ON56556314300.0
ZYRO0C01496g8.269ON56756414210.0
YDR117C (TMA64)8.269ON56556314130.0
Skud_4.3778.269ON56256313650.0
NCAS0B038008.269ON56556913480.0
TPHA0J007808.269ON58358113321e-178
Smik_4.3618.269ON56556313231e-177
NDAI0J013108.269ON57958212761e-170
CAGL0B01837g8.269ON56957112521e-166
Kpol_392.28.269ON56656612181e-161
KAFR0B054708.269ON56256711991e-158
KLLA0F19294g8.269ON57056611881e-156
Ecym_43018.269ON56456411301e-148
TBLA0I032008.269ON56356410921e-142
AGR079W8.269ON54256510171e-131
KNAG0H032008.269ON5615739331e-118
SAKL0G15620g5.94ON87963770.90
TBLA0F03530singletonON87892761.2
SAKL0F04576g7.152ON180176731.5
TDEL0H031507.152ON181113703.4
NDAI0A083007.152ON181113677.6
YOR295W (UAF30)8.764ON22878679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13530g
         (574 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...  1008   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   803   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   642   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   577   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   555   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   551   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   548   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   530   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   523   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   517   e-178
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   514   e-177
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   496   e-170
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   486   e-166
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   473   e-161
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   466   e-158
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   462   e-156
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   439   e-148
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   425   e-142
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   396   e-131
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   363   e-118
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    34   0.90 
TBLA0F03530 Chr6 (867978..870614) [2637 bp, 878 aa] {ON}               34   1.2  
SAKL0F04576g Chr6 (369113..369120,369587..370121) [543 bp, 180 a...    33   1.5  
TDEL0H03150 Chr8 complement(518325..518859,518922..518932) [546 ...    32   3.4  
NDAI0A08300 Chr1 complement(1900800..1901334,1901450..1901460) [...    30   7.6  
YOR295W Chr15 (869208..869894) [687 bp, 228 aa] {ON}  UAF30Subun...    30   9.5  

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/564 (88%), Positives = 501/564 (88%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQ              DQ
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
           LQPPEG                  TGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300
           RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 301 KFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEKE 360
           KFLKY                TIIGVDRTKSELKNFAPYRI               NEKE
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEKE 360

Query: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420
           QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR
Sbjct: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420

Query: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480
           LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP
Sbjct: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480

Query: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540
           QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ
Sbjct: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540

Query: 541 GPHGPAVIELLNESGIPTKWINFV 564
           GPHGPAVIELLNESGIPTKWINFV
Sbjct: 541 GPHGPAVIELLNESGIPTKWINFV 564

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/564 (70%), Positives = 446/564 (79%), Gaps = 12/564 (2%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKKEPQIKALSNLKNSERK +QSQC+EQ   S+Y+FPSQVIKQ              D 
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           KN+PIWFKEKFSDLLYPTVF+CWSN  L+PIVLAHEYVVEEKLLKGANLMLPGTVPPFDE
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           RCVKT+MV VAST +PDVVKAIGIVQ+NLPQYSRVIGESGVAVEIVHTF DELCK FKVK
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
           LQPPEG                    +   P+  +AP     +QEP+VN++D +EQL++L
Sbjct: 181 LQPPEGADGIAESDSEENSDAEVSGAIKIEPKP-SAP-----LQEPIVNIDDAAEQLSQL 234

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300
            VEDVDHFFTR+LYY+L  D+KLE P SASNFVSNHILRNLPP+DHTQVNMKKTSWKKTA
Sbjct: 235 SVEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTA 294

Query: 301 KFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEKE 360
           KFLK+                TI+G+D+TK ELK+F PYR                +E E
Sbjct: 295 KFLKHFEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYR------TGGNSGGSTGSESE 348

Query: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420
           Q S+MKA+ +Y+P+SS K FL ATDL PN MF+ Q++K AVD YI++K LVS DNK+AVR
Sbjct: 349 QNSMMKALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVR 408

Query: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480
           LDDLL+ LVNRS+KKENAVRTI RAQIM P+LKGNF+EHFL+LK DGTPLFKHPVKG IP
Sbjct: 409 LDDLLFSLVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIP 468

Query: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540
           Q+QIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGE  TSPKT EVTVQ
Sbjct: 469 QIQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQ 528

Query: 541 GPHGPAVIELLNESGIPTKWINFV 564
           GPHGPAVIELLN+  IPTKWINFV
Sbjct: 529 GPHGPAVIELLNQLAIPTKWINFV 552

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/563 (57%), Positives = 401/563 (71%), Gaps = 13/563 (2%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKK+P IKALSNLKNSERK + +  +EQ   S+Y FP+QV+KQ              D+
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           +NVPIWFKEK   L++PTVFTCWSN  +LP+V  H++VVEEKLLKGA+LMLPG VPPF  
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           +C K  +V VAST +P V+KAIGIVQ++LP Y+RVIGE+GVAV I+HTF D LCK FK+K
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
           L+PPE                     V SA E+ A   +    Q  +VN ED SEQL EL
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEH-----VDSADEAKAIATT---TQARMVNTEDASEQLNEL 232

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300
             ED+DHF TRSLYY+L  D +L+ P++ASNFVSNHIL NLPP+DH Q+NMKK+SWKK+A
Sbjct: 233 SAEDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSA 292

Query: 301 KFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEKE 360
           KFLK+                 ++G+++ K ELK F PYRI                 +E
Sbjct: 293 KFLKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKA----QE 348

Query: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420
            +++M+AVSLY+PISS K F  A DLPPN++FT Q++K+A+D YI  KNLV+ D+K  V 
Sbjct: 349 NSNMMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVL 408

Query: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480
           LDD L+ ++NRS+KKENA+RTI+RAQIM P L  NF+EHF ILK D  PLFK  +KG+IP
Sbjct: 409 LDDTLFPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGD-VPLFKTALKGAIP 467

Query: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540
           ++QIVTEMKIGRKVVTKVSNFEKFQ+DA+ LA  LRK+CSGSTTIGE  +SPKTLEVTVQ
Sbjct: 468 EIQIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQ 527

Query: 541 GPHGPAVIELLNESGIPTKWINF 563
           GPHG  VI +LNE GIPTKWINF
Sbjct: 528 GPHGAIVIGMLNEYGIPTKWINF 550

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/563 (49%), Positives = 371/563 (65%), Gaps = 17/563 (3%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKKEP IKALSNLKNSERK +   CKEQTG+S+Y F + ++KQ              DQ
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            NVPIWFKEK  +LL+PTV++CW+   LLPIVL H++V+EE+L  GANLML GT+PPFDE
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           RCV  ++  +AS   P V+ AIG+VQ+NLP YS VIG+ G+AV+++H F D LC+ FK+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
           ++P                            +   +PK  ++     +++ED+++ L EL
Sbjct: 181 IEP----------AVLSSEPVEEEEEEEGKEKLTESPK--RETFHTEISIEDVAQVLDEL 228

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300
            VEDVDHFFTR+LYY+  HD  L  PI+ASNF+SNHIL NLPP+D +QVNMKKTSWKKTA
Sbjct: 229 SVEDVDHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTA 288

Query: 301 KFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEKE 360
           KFLK+                 I+GV++ K ELKNF PY+                N+  
Sbjct: 289 KFLKHFEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYK-----TSGQTASKKNSNKDS 343

Query: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420
              +M +  LY+PI+  K F+  +DLPP  ++T  ++K +V++YI+AK LV   NK  V 
Sbjct: 344 SPGMMYSEKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVL 403

Query: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480
           LDDLL+D+  R  K +   R ++RAQIM P +  NF+E + + K + TPLFK+P++G +P
Sbjct: 404 LDDLLFDMFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLP 463

Query: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540
           +V+IVTEMKIGRKVVT+VS+FE F++D ++LA  LRK CSGSTTIGE  TSPK  EV VQ
Sbjct: 464 RVKIVTEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQ 523

Query: 541 GPHGPAVIELLNESGIPTKWINF 563
           G HGP +I+ LN+ GIPTKWI+F
Sbjct: 524 GAHGPLIIDYLNKQGIPTKWIDF 546

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/563 (49%), Positives = 363/563 (64%), Gaps = 8/563 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKKEP IKALSNLKNSERK +   CK+QT + EY FP+  IKQ              D+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PI FKEK ++ L+PTV++CW N  LLPIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           RC    +  VAS  AP +V A+GIV+++LP YSRVIGE+GVAV+IVH F D L K FKVK
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
           L+PP                     G  +        K+ ++VQE  +N+E+I+E L  L
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKT------TEKTRENVQEANINIEEIAEVLDHL 234

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300
            V DVD+F TR+LYY+L  D  L  PISASNF+SNHI+RNLPPIDH +VN+K+TSWKK+A
Sbjct: 235 SVSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSA 294

Query: 301 KFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEKE 360
           KFLK+                TI+G +  K ELKNF PY++                EK 
Sbjct: 295 KFLKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEK- 353

Query: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420
            + +M +++LY+P +  K  +   +LP    +T QDI+SA+ +YIS KNLV   +K  V 
Sbjct: 354 TSGMMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVV 413

Query: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480
           +DDLLY++VN+  K  +  R I RAQI+ P+L  NF+E + I K D T L + P+KGS P
Sbjct: 414 MDDLLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPP 473

Query: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540
           +++I+TEMKIGRKV+TKVSNFE  Q+D + LA  LRK CSGSTTIGE+ T  K+ EV VQ
Sbjct: 474 RIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQ 532

Query: 541 GPHGPAVIELLNESGIPTKWINF 563
           GPHG  +I+ LN+SG+P KWI+F
Sbjct: 533 GPHGQLIIDHLNKSGVPNKWIDF 555

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/564 (50%), Positives = 363/564 (64%), Gaps = 11/564 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKK+P +KALSNLKNSE K + + C+ QTG+ EY+FP+ VIKQ              D 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PIWFKEK  +LLYPTVF CWS+  LLP+VL H +VVEE+L  GANLML GTV PFD 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           R     +  +AS  APDVV A+G+VQ++LP Y  V+G++GVAV++VH   D L KVFKV 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
            +PP                       PS+ E  +        QE  V+++DI+E L E 
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPS--------QEKAVDIDDIAEVLDEF 232

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300
           R+EDVD F TR+LYY+L HD KLE PISASNF+SNHI  NLP +DH +VN+KK+SWKKTA
Sbjct: 233 RLEDVDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTA 292

Query: 301 KFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEKE 360
           KFLK                 TIIG+++ K EL+NF PY+I                +K+
Sbjct: 293 KFLKNFEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNN-KKD 351

Query: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQ-MFTQQDIKSAVDKYISAKNLVSPDNKSAV 419
            +  ++  +LY+PI+  K F+  TDL P   ++T Q++K+A++ YI++ NL    NK  V
Sbjct: 352 GSPQLRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMV 411

Query: 420 RLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSI 479
            LDDLLY LVN+  K   A R ++RA I+ P+L  +F+ HF I K D  PLFK+P +G++
Sbjct: 412 ILDDLLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNL 470

Query: 480 PQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTV 539
           P ++IVTEMKIGRKV+T+VS FE F +D DELA  LR+ CSGSTTIGE  TSPK  EVTV
Sbjct: 471 PNIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTV 530

Query: 540 QGPHGPAVIELLNESGIPTKWINF 563
           QGPHGP +I+ LN  GIPTKWI F
Sbjct: 531 QGPHGPLIIDHLNSLGIPTKWIKF 554

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/563 (49%), Positives = 364/563 (64%), Gaps = 8/563 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKKEP IKALSNLKNSERK +    ++QT + EY+F +  IKQ              D+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PI FKEK  + L+PTV++CW    LLPIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           RC    +  +AS  AP+ V AIGIV+++LP + +VIGE+GVAV+I+H F D L KVFK+K
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
           L+PP                      + S+ +  A  K  +DV+E  V+VE+I+E L   
Sbjct: 181 LEPP------FVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHF 234

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300
            V DVD+F TR+LYY+L  D  LE PISASNF+SNHI+RNLPPIDH +VN+KKTSWKK+A
Sbjct: 235 TVSDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSA 294

Query: 301 KFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEKE 360
           KFLK+                TI+G +  K ELKNF PY++                EK 
Sbjct: 295 KFLKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEK- 353

Query: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420
            + +M +++LY+P +  K  L   +L  +  +T QDI+SAV +YIS KNL    +K  V 
Sbjct: 354 TSGMMYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVI 413

Query: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480
           +DDLL+D+VN+  K  NA R IAR +I+ P+L  NF+E + I K+D T LFK P+KGS+P
Sbjct: 414 MDDLLFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLP 473

Query: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540
            ++I+TEMKIGRKV+T+VSNFE FQVD + LA  LRK CSGSTTI E+ T  K  EV VQ
Sbjct: 474 HIKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQ 532

Query: 541 GPHGPAVIELLNESGIPTKWINF 563
           GPHG ++I+ LN+ GIP+KWI+F
Sbjct: 533 GPHGQSIIDHLNKLGIPSKWIDF 555

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/563 (47%), Positives = 353/563 (62%), Gaps = 11/563 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKKEP IKALSNLKNSERK +   CK+QT + EY FP+  IKQ              D+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PI FKEK ++ L+PTV++CW N  LLPI+L H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           R     +  VAS  AP VV AIGIV+++LP Y RV+GE+GVAV+++H F D L K  KVK
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
           L PP                      V    E+     + +++Q+  V+VE+++E L   
Sbjct: 181 LDPP---------IAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHF 231

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300
            V DVD+F TR+LYY+L  D  L  PIS SNF+SNHI+RNLPPIDH +VN+KKTSW+K+A
Sbjct: 232 SVSDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSA 291

Query: 301 KFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEKE 360
           KFLK+                TI+G    K ELKNF PY++                EK 
Sbjct: 292 KFLKHFEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEK- 350

Query: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420
              +M +++LY+P S  K FL   +L     +T QDI+SA+ +YIS  NL    +K  V 
Sbjct: 351 TPGMMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVV 410

Query: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480
           +DDLL+++VN+  K  NA R + RAQI+ P+L  NF+E + I K D + LFK P+KGS P
Sbjct: 411 MDDLLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPP 470

Query: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540
           +++I TEMKIGRKV+T+VSNFE FQ+D + LA  LRK CSGSTTIGE+ T  K+ EV VQ
Sbjct: 471 RIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQ 529

Query: 541 GPHGPAVIELLNESGIPTKWINF 563
           GPHG  +I+ LN  G+P KWI+F
Sbjct: 530 GPHGQLIIDHLNNLGVPNKWIDF 552

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/569 (46%), Positives = 359/569 (63%), Gaps = 21/569 (3%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MF+KEP IKALSNLKNS+RK +      QTG+ +Y  PS ++KQ              D+
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           KN+PIWFKEK    LY TV+TCW+   LLPI L+H++V++EKL  GANLM+ GT+PPFDE
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RCVKTRMVSVASTAAPD-VVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKV 179
           +     +  VAS   P  VV AIGIV ++LP++ +V+GESGVAV+I+H F DEL K FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 KLQPP-----EGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDIS 234
            L+PP     +G                      +  E   A            NVED++
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTA-----------TNVEDLA 228

Query: 235 EQLTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKT 294
           E L  L V+DVD+F TR+LYY++  D KL  PISASNF+S HI +NLP +DH +VN+KK+
Sbjct: 229 EVLDHLSVQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKS 288

Query: 295 SWKKTAKFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXX 354
           SWKKTAKFLK+                T++G+++TK ELKNF PY++             
Sbjct: 289 SWKKTAKFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKE 348

Query: 355 XXNEKEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPD 414
             +   Q+ +M +++ Y+PI+  K  +  + +P   ++   +I+  V+ YI+ KNLV   
Sbjct: 349 GDS---QSGMMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNK 405

Query: 415 NKSAVRLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHP 474
           NK  V LDDLL+ +VN+        R+I+RAQI+ P LK NF+EHF I  + GTPLFK P
Sbjct: 406 NKKMVLLDDLLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSP 465

Query: 475 VKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKT 534
           ++GS P+++I+TEMKIGRKV+TKVSNFE+F ++ + LA  LRK CSGSTTIGE  TSPKT
Sbjct: 466 MRGSPPRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKT 525

Query: 535 LEVTVQGPHGPAVIELLNESGIPTKWINF 563
            EV VQGPHG  +I+ LN+ G+PTKWI++
Sbjct: 526 AEVQVQGPHGQIIIDHLNKLGVPTKWIDY 554

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  517 bits (1332), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 268/581 (46%), Positives = 360/581 (61%), Gaps = 41/581 (7%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKK P +KA SNLKNSERK +   CKEQ  SS+Y FPS +IKQ              D+
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           +NVPIWFKEK SD+L+P+V+TCW N KLLPI++ + YV+EEK+L GANLM+ GT+ PFDE
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           R +   +  +AS   P+VV AIGIVQ++L  Y++V+GE+GVAV ++H  GD L   FK+ 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVP-SAPESLAAPKSLQDVQEPLVNV--------- 230
           L+PPE                   TG        +   +  QDV   L N          
Sbjct: 181 LEPPE-------------------TGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDAR 221

Query: 231 --EDISEQLTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQ 288
             +D++E L  L V+ +D F T+SLYYSL +D KLE PISASNF+SN+I+ NLPP+D+  
Sbjct: 222 PNDDLAEVLETLPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDM 281

Query: 289 VNMKKTSWKKTAKFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXX 348
           VN+KK+SWKKTAKFL++                 I G ++ K+ELK+F PYR        
Sbjct: 282 VNLKKSSWKKTAKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYR-TGNGNST 340

Query: 349 XXXXXXXXNEKEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAK 408
                   +  +   +M++VS Y+PIS  K  +  +  P   ++T  +++  + +YI+ K
Sbjct: 341 KSKKDKTNDTSDNGDMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKK 400

Query: 409 NLVSPDNKSAVRLDDLLYDLVNRSSKKENAV--RTIARAQIMAPVLKGNFSEHFLILKAD 466
           NLV   NK  + +DDL+Y LV    KK+N+   R I+RA ++ P+ K NF+EHF I K  
Sbjct: 401 NLVDSKNKKMILMDDLMYSLV---YKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKG 457

Query: 467 ----GTPLFKHPVKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGS 522
                 PLFK P++GSIP+V+IVTEMKIGRKV+T+VSNFE F +DA+ LA  LRK C+G+
Sbjct: 458 DNETAVPLFKKPIRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGA 517

Query: 523 TTIGEANTSPKTLEVTVQGPHGPAVIELLNESGIPTKWINF 563
           TTIGE  TSPKT EV VQGPH   +I+ LN   IPTKWI+F
Sbjct: 518 TTIGETLTSPKTAEVQVQGPHSQVIIKHLNSLSIPTKWIDF 558

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  514 bits (1323), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 269/563 (47%), Positives = 361/563 (64%), Gaps = 8/563 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKKEP IKALSNLKNSERK +   C +QT + EY FP+ +IKQ              D+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N+PI FKEK  + LYPTV++CW N  LLPIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           RC    +  VA   +P VV AIG+V+++LP Y RVIGE+GVAV+++H F D L K FKVK
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
           L+PP                    T  P   +S  A KS + +++   ++E+++E L  L
Sbjct: 181 LEPP----VVLNTESEDENINSKQTETPEQVKS--ADKSQESIKKTAPDLEEVAEVLDHL 234

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300
            V DVD+F TR+LYYSL  D  L  PISAS F+SNHI+RNLPPIDH +VN+KK+SWKK+A
Sbjct: 235 TVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSA 294

Query: 301 KFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEKE 360
           KFLK+                TI+G +  K ELKNF PY++                ++ 
Sbjct: 295 KFLKHFEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDR- 353

Query: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420
            + +M +++LY+P S  K  L    L  +  +T QD+++AV +YIS KNL    +K  V 
Sbjct: 354 TSGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVV 413

Query: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480
           +DDLL+++VN+  K  +  R IAR++I+ P+L  NF+E + I + D T LF+ P+KG  P
Sbjct: 414 MDDLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPP 473

Query: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540
           +++IVTEMKIGRKV+TKVSNFE F +D + LA  LRK CSGSTTIGE+ T  K+ EV VQ
Sbjct: 474 RIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQ 532

Query: 541 GPHGPAVIELLNESGIPTKWINF 563
           GPHG  +I+ LN+SGIP+KWI+F
Sbjct: 533 GPHGQFIIDYLNKSGIPSKWIDF 555

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  496 bits (1276), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 266/582 (45%), Positives = 358/582 (61%), Gaps = 31/582 (5%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFP-SQVIKQXXXXXXX--XXXXXX 57
           MFKKEP IKALSNLKNS+RK +    K QT    Y F  S +IKQ               
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  XDQKNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPP 117
            +  N+PIWFK K +DLLYPTVFTCW+N  +LP +L+H++V++EKL  GANLM+ GT+PP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDERCVKTRMVSVASTAAPD-VVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKV 176
           FD R +   +  +AS   P  +V AIG+V++N+P + +V+GE+GVAVE++H F DEL K+
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKVK-LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISE 235
           FK   L+P E                   T  P     +A   + +  +E   + E   E
Sbjct: 181 FKCNDLKPDE------------FVKEQLNTEHPQD-NDVADEDTTRKKEENRESNEPDFE 227

Query: 236 QLTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTS 295
            L   + EDVD+F TRSLYY++  D K+E PISASNF+S HI +NLP I H +VN+KKTS
Sbjct: 228 VLDHFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTS 287

Query: 296 WKKTAKFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXX 355
           WKKTAKFLK+                T++G+++TK ELKNF PY+I              
Sbjct: 288 WKKTAKFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPN 347

Query: 356 XNEK-EQASVMKAVSLYRPISSTKAFLSAT-DLPPNQMFTQQDIKSAVDKYISAKNLVSP 413
            N+K +   +M + + Y+PI+  K  L A   +P   ++TQQ+I+  V  YI++KNL+  
Sbjct: 348 TNDKSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDM 407

Query: 414 DNKSAVRLDDLLYDLVNRSSKKENAV-RTIARAQIMAPVLKGNFSEHFLI---------L 463
            NK  + LDDLL+++V++   + NA  RT+ R  I+ P+L  NF+EH+ I         L
Sbjct: 408 KNKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGEL 467

Query: 464 KADGTPLFKHPVKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGST 523
             D  PLFK P +G +PQ+ I+TEMKIGRKV+TKVSNFE F + +D LA  LRK CSGST
Sbjct: 468 MEDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGST 527

Query: 524 TIGEANTSPKTLEVTVQGPHGPAVIELLNES-GIPTKWINFV 564
           TIGE  TSPKT EV VQGPHG  +I+ LN+  G+PTKWIN+V
Sbjct: 528 TIGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINYV 569

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  486 bits (1252), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 261/571 (45%), Positives = 354/571 (61%), Gaps = 21/571 (3%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKKEP IKALSNLKNSERK +Q +C+ QT + EY+F S  IKQ              D+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PIWFKEK  + LYPTV  CW    L+P+VL H  V+E+ +  GANLM+ GT+PPFDE
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           R     +  +A    P+++ A+GIVQ+NLP ++RVIGE+GVAV+IVH   DEL KVFKVK
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
            +PP                           E     +S  D ++   N++D++E L EL
Sbjct: 181 EEPP------AELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDEL 234

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPP-IDHTQVNMKKTSWKKT 299
           R+ED+D+F TR+LYY+++ D KLETP SASNFVSNHI  NLP   +  +VN+KK+SWKKT
Sbjct: 235 RLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKT 294

Query: 300 AKFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEK 359
           AKFLK+                TI+ V++ K E+K F PY +                  
Sbjct: 295 AKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNA--- 351

Query: 360 EQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAV 419
              + +K V+LY+PI+  K F+S+  +P  Q++ + +IK  ++KYI+ K+LV   +K  V
Sbjct: 352 --KTTIKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCV 409

Query: 420 RLDDLLYDLVNRSSKKENAV---RTIARAQIMAPVLKGNFSEHFLILKADG---TPLFKH 473
            +DD+L  ++ +  KKE+     R I RA I+ PVL+ NF++++ + +  G   TPL K 
Sbjct: 410 LVDDMLMTMIYK--KKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKT 467

Query: 474 PVKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSP- 532
           P+KG  P++ IVTEMKIGRKV+TKVSNFE FQ+D +E A  +RKKCSGSTTIGE  +S  
Sbjct: 468 PLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAK 527

Query: 533 KTLEVTVQGPHGPAVIELLNESGIPTKWINF 563
           KT EV VQGPHG  ++  LN+ GIP KWI+F
Sbjct: 528 KTAEVQVQGPHGQLIMSYLNDLGIPNKWIDF 558

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  473 bits (1218), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 259/566 (45%), Positives = 347/566 (61%), Gaps = 14/566 (2%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKK P IK+LSNLKNSERK +   CK QTGS++Y FP+ VIKQ              D+
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
           +  P+WFKEK S+LL+PTV+TCW +  LLPIVL H+ V+ E +  GANLM+ GT+PPFD 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           R V   +  +A+   P+ + A+G+VQ+++P YS VIG++GVAV ++H +GD +   FK+K
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTE- 239
              P                    T    +P  +   +  +D   P ++  D+SE   E 
Sbjct: 181 RDIP--------TIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEE 232

Query: 240 --LRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWK 297
             L VED+DHF TRSLYY+L +D KL  PI +S+F+SNHI+RNLPP+DH  VN+KKTSWK
Sbjct: 233 SALTVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWK 292

Query: 298 KTAKFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXN 357
           K++KFLK+                TI+G ++ K ELK F PYRI               N
Sbjct: 293 KSSKFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRI--SNSSSNSGKKINSN 350

Query: 358 EKEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKS 417
            +E  ++M ++  Y P  S K F++ T+LP    +T  ++K+AV +YI  K LV   N  
Sbjct: 351 RQESENMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPK 410

Query: 418 AVRLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKG 477
              LDD LYD+   + K  N  R I RA ++      NF+E + + K D TPL K+PV+G
Sbjct: 411 MANLDDRLYDMC-YTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRG 469

Query: 478 SIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEV 537
           S P+++IVTEMKIGRK+VT+VSNFE F +DAD LA  LR+ CSGSTTIGE  TSPKT EV
Sbjct: 470 SPPRIKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEV 529

Query: 538 TVQGPHGPAVIELLNESGIPTKWINF 563
            VQGPH   +I+ LN   IPTKWI+F
Sbjct: 530 QVQGPHSKIIIDHLNSLSIPTKWIDF 555

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  466 bits (1199), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 255/567 (44%), Positives = 337/567 (59%), Gaps = 20/567 (3%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSE-YAFPSQVIKQXXXXXXXXXXXXXXD 59
           MFKKEP+IKALS LKNS+RK +    K Q  S E  +     I Q              D
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  QKNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFD 119
             ++PI FK K SD LYPT F  WSN+ LL  V  H  VVE  +  GA+LM+ GTVPPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 ERCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKV 179
                  + +VA+  APDV  A+GIV++NLP+Y +V+G++GVAVEI+H F D L   FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 KLQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVE---DISEQ 236
           KL+ P                    T    A ES A  +S Q V EP    E   DI+E 
Sbjct: 181 KLEIP----------ASVKSILQEETTADVAKESDAEQES-QSVTEPPSGSEGPDDIAEV 229

Query: 237 LTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSW 296
           L EL VEDVD+F  R+LY+++  D  L  P+ AS F+SNHI+RNLP +DH +VN+K+TSW
Sbjct: 230 LDELTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSW 289

Query: 297 KKTAKFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXX 356
           KKTAKFLKY                 I+G+++ K ELKNF PY+I               
Sbjct: 290 KKTAKFLKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDST- 348

Query: 357 NEKEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNK 416
             + Q   + +V+LY+PI+  + F+  +++    M+T  +I++ ++ YI  KNLV   +K
Sbjct: 349 --QTQGVSVSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDK 406

Query: 417 SAVRLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVK 476
             V LDDLL+ +VNR  +     R I RA I+ P++  NF+E+F + K D TPLFK+P+K
Sbjct: 407 KMVMLDDLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIK 466

Query: 477 GSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLE 536
           G  P++ IVTEMKIGRKVVT+VSNFE F++  +ELA  LRK CSGSTTI E  T  K  E
Sbjct: 467 GQTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSE 524

Query: 537 VTVQGPHGPAVIELLNESGIPTKWINF 563
           V VQGPHG  +I+  N+SGIP+K+I F
Sbjct: 525 VQVQGPHGQLIIDHFNKSGIPSKFIQF 551

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  462 bits (1188), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 246/566 (43%), Positives = 339/566 (59%), Gaps = 11/566 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MF KEP IK LSNLKNS+RK +QS  K Q  + EY  P+ VIKQ              D+
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWS-NSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFD 119
            N PIWFK KF D LYPT+F+ W+   +LLPI+L H++V+E+ +L GA LMLPGTVPPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 ERCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKV 179
               +  +V +AST  P +VKAIGI +++L   S VIG  G+AV +VH   D L K FK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 KLQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTE 239
           +L+PP                     G     ES    +S    Q P   V +I+++L E
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERS--SSQSP---VNEIADELEE 234

Query: 240 LRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKT 299
           + +EDVDH   R++ YS+  D K+  PI AS F+SNH+++NLP +D   VN+KK+SWKK 
Sbjct: 235 MSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKA 294

Query: 300 AKFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEK 359
            K LKY                T+I +++   +L N   Y+                + K
Sbjct: 295 TKLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNK 354

Query: 360 EQASVMKAVSLYRPISSTKAFLSA-TDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSA 418
            + +     +LY+P+S+ + F++  T   P   +TQQ++K  +D Y++  NL+ P+NKS 
Sbjct: 355 NKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSL 414

Query: 419 VRLDDLLYDLVNRSSKKENAVRTIARAQIMAPV-LKGNFSEHFLILKADGTPLFKHPVKG 477
           V+ DD LY + NR+ +    ++ IAR  I++P  L  NF+ +  I K +G PL K P KG
Sbjct: 415 VKYDDTLYQMSNRAPQ-NGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKG 473

Query: 478 SIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEV 537
            IP ++IVTE KIGRKV+T+V+NFEKF++D++ELA ALRKKCSGSTTIGE+  S KT EV
Sbjct: 474 PIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESK-STKTAEV 532

Query: 538 TVQGPHGPAVIELLNESGIPTKWINF 563
            VQGPHG  VI +LN+ GIPTKWI+F
Sbjct: 533 QVQGPHGSIVISILNDYGIPTKWISF 558

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  439 bits (1130), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 228/564 (40%), Positives = 339/564 (60%), Gaps = 10/564 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKK+P IK+ SNLKNSERK +    + Q  + E+ F + ++KQ              D+
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N PI+FKEK S+ L PT+ TCW    LL +VL H++V++ KL  GA+LMLPGT+PPF +
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
            C + ++V VAS+  P VV+AIG+ Q+NL    +V+GE+GVAV+++HT  D L +VFK+ 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 LQPP-EGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTE 239
           ++PP +                    G     E L   K+     E   ++ +++EQL E
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240

Query: 240 LRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKT 299
           L +E VDHF T+++YY+LA D  L+ PI ASNF++NH+++NLP I  TQV++K++SW + 
Sbjct: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300

Query: 300 AKFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEK 359
           +KFLKY                T++ V++ K+E+K+F PYR                N+K
Sbjct: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR----TIQKSVSTSSKNNDK 356

Query: 360 EQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAV 419
               V   V  Y+P+++ KA L A    PN M   +DIK+ ++KY++ K LV+  ++  +
Sbjct: 357 HDVEV---VVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERII 413

Query: 420 RLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSI 479
            LDD L+ L  + S  + + R + RA++   +L  +F+E F I K DG PL   P+K   
Sbjct: 414 LLDDTLFSLAYKKSASD-STRKVLRAKMFDLILSTSFTEVFFIFK-DGKPLSSKPLKSKN 471

Query: 480 PQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTV 539
             V ++TEMKI RK+VT++SNFE + VD +EL+  LRK+CSGS+T+ E +T   T EV V
Sbjct: 472 RNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQV 531

Query: 540 QGPHGPAVIELLNESGIPTKWINF 563
           QGPHG   I +LNE GIP+K+I+F
Sbjct: 532 QGPHGNTAINILNEHGIPSKYIDF 555

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  425 bits (1092), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 219/564 (38%), Positives = 319/564 (56%), Gaps = 11/564 (1%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKK   I  LSNLKNSE +NI+  C++   ++EY FP   +KQ              D 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            NVPIWFK+K+S+ + PTV+T W     +PI+  H++++E K+  GANLM+PGTV P DE
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
           R    ++  +AST  P  + AIG+   ++      +G++GVAVE++H + DEL  +FK+K
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240
           L PP                      +  A   +       D      N +D++E L +L
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTS--NADDLAETLEQL 238

Query: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300
           RVED+D+F T+SLYY++  +  L+ PI +S FVS ++++NLP +DH QVN+KK+SWKKTA
Sbjct: 239 RVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTA 298

Query: 301 KFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNEKE 360
           KFLK+                TI G ++ K +LK F PYRI               ++++
Sbjct: 299 KFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRI-----GKPAGALPSKDKQD 353

Query: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420
             + +K V+LY P     +  +A  L     FT  +I SA+  YI+ KNL +P +K+ + 
Sbjct: 354 NKNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKIS 413

Query: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480
           +DD+L+DLV  ++ K NA R I R+Q++ PVL  NF  +  +   D   L KHP KGS P
Sbjct: 414 MDDVLFDLV-ITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPP 472

Query: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540
            V++VTE     KV+T+VSNFE F +DA +++  L+  CSGST+I E    P   EV VQ
Sbjct: 473 TVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSEVQVQ 529

Query: 541 GPHGPAVIELLNESGIPTKWINFV 564
           GPHG  V+E   + GIP KW ++ 
Sbjct: 530 GPHGDIVMEYFEKHGIPRKWFDYT 553

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  396 bits (1017), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 211/565 (37%), Positives = 317/565 (56%), Gaps = 35/565 (6%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKKEP +   SN KNSERK +Q+  +EQ     Y F S  IK               D 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120
            N+P+WF+ K      PTV++CW +  LLP+V  HE+VVE KL  GA+LMLPGTVPPF  
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180
              + R+V +AST AP VVKA+GI +++L   + V   +GVAV ++HT+GD LC+VFKV+
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 LQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNV--EDISEQLT 238
            + PE                             A+P++ +   EP      E ++E+L 
Sbjct: 181 REAPEASEAKG-----------------------ASPEAREPEAEPPKTAPGEGLAEELE 217

Query: 239 ELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKK 298
            L +EDVDH  TR++YY++  D +L+ P++AS F++ H+L+NLPP+D +QV +K++SW K
Sbjct: 218 RLTMEDVDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGK 277

Query: 299 TAKFLKYXXXXXXXXXXXXXXXXTIIGVDRTKSELKNFAPYRIXXXXXXXXXXXXXXXNE 358
            AK LK+                T++ V+     LK+F PYR                  
Sbjct: 278 AAKLLKHFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQS 337

Query: 359 KEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSA 418
                 ++ V  Y P  +    L+   +      + +DI+  +++Y++A+  V P +KS 
Sbjct: 338 ------LEIVYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSM 391

Query: 419 VRLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGS 478
           +RLDD L  L++++   +   R++ R + +A +L  +FSE+F++++ D  PL K P KG 
Sbjct: 392 LRLDDTLAQLLHKNVNADTP-RSLPRPEALAALLSRSFSEYFVVMRGDA-PLSK-PQKGR 448

Query: 479 IPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVT 538
            P +++  E KI +KVVTKVSNFE + VD +ELA  LR +CSGSTTI +   + K +EV 
Sbjct: 449 APPIKVTNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT-KAVEVQ 507

Query: 539 VQGPHGPAVIELLNESGIPTKWINF 563
           VQGPH   ++ +LN+ GIP+K+I  
Sbjct: 508 VQGPHEATIVSILNKHGIPSKYITL 532

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  363 bits (933), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 221/573 (38%), Positives = 326/573 (56%), Gaps = 33/573 (5%)

Query: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQ 60
           MFKK P IK LSNLKNSE++ +Q + ++Q G  E+ F    +KQ              + 
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  KN--VPIWFKEKF-SDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPP 117
           +   VP++FKEK  S  L+P+V+ CWS+  LLPI+L H  V+E+ L  GANLM+ GT+PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-ERCVKTRMVSVASTAAPDVVKAIGIVQINLPQY--SRVIGESGVAVEIVHTFGDELC 174
           FD     K R   +A+  +PDV+ A+G ++++L  +  + V+G SGV VE+ H F D L 
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 KVFKVKLQPPEGXXXXXXXXXXXXXXXXXXTGVPSAPESLAAPKSLQDVQEPLVNVEDIS 234
             F++KL  P+                     V   P   A P S   V  P V V+D++
Sbjct: 181 DAFRLKLDIPDKLESATTQE------------VAEEPPVEAKPTS--PVTNP-VAVDDLA 225

Query: 235 EQLTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPP-IDHTQVNMKK 293
           E L  L VEDVD+F TR+LYY+L  + KL  PI+ASNF+S H+++ LP  ID T+VN+KK
Sbjct: 226 EVLETLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKK 285

Query: 294 TSWKKTAKFLKYXXXXXXXXXXXXXXXXTIIGV--DRTKSELKNFAPYRIXXXXXXXXXX 351
           +SWKKTAK+LK+                 ++G    +T + LK+F PY +          
Sbjct: 286 SSWKKTAKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAESGPK 345

Query: 352 XXXXXNEKEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLV 411
                ++     VM AV+ ++P S+ +   +A  L   + F+  +I+  +++YI+A  L 
Sbjct: 346 -----SQTTNGPVMFAVTSFQPDSTAQ---TALPLGGQRYFSGPEIREVLNEYITANKLA 397

Query: 412 SPDNKSAVRLDDLLYDLVNRSSK-KENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPL 470
            P+N   V L+D L+ +V + ++ K+   R +AR +I+  V+K +F   + + K   TPL
Sbjct: 398 QPNNPKMVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPL 457

Query: 471 FKHPVKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANT 530
            KHP KG  P+V I+TEMKIGRKVVT+V NF+   +   E A  LRK CS STTIG+  +
Sbjct: 458 TKHPQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVS 517

Query: 531 SPKTLEVTVQGPHGPAVIELLNESGIPTKWINF 563
           +P   E+ VQG HGP +I+ L E G+P+ W+ F
Sbjct: 518 TPVVSEIQVQGAHGPLIIDHLRELGVPSSWVVF 550

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 30/63 (47%)

Query: 108 NLMLPGTVPPFDERCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVH 167
           +L++P   P + E CV T  +  AS  +PD    +   QI + + S    E    + +++
Sbjct: 85  DLLIPVVAPTWIESCVSTNRIVRASNFSPDQAHVLKNCQIYISKQSISATECSFYISLIN 144

Query: 168 TFG 170
           T G
Sbjct: 145 TLG 147

>TBLA0F03530 Chr6 (867978..870614) [2637 bp, 878 aa] {ON} 
          Length = 878

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 12/92 (13%)

Query: 374 ISSTKAFLSATDLPP------NQMFTQQDIK--SAVDKYISAKNLVSPDNKSAVRLDDLL 425
           +S    FL ATD P       NQM  + D+K   +V KY+    +  PD   +V LD  +
Sbjct: 554 LSYVDDFLIATDNPNLRKELFNQMNKEWDVKDMGSVKKYLGMTFITYPD--GSVSLDQRI 611

Query: 426 Y--DLVNRSSKKENAVRTIARAQIMAPVLKGN 455
           Y  +L+ R   K + +R    ++I  P+ + N
Sbjct: 612 YLTELLERYHDKNHKIRATPMSEIPIPLNEDN 643

>SAKL0F04576g Chr6 (369113..369120,369587..370121) [543 bp, 180 aa]
           {ON} similar to uniprot|P89886 Saccharomyces cerevisiae
           YER007C-A TMA20 Protein of unknown function that
           associates with ribosomes
          Length = 180

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 73/176 (41%), Gaps = 9/176 (5%)

Query: 2   FKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQXXXXXXXXXXXXXXDQK 61
           F +E  + + SN+K+S ++ ++S+  +Q    E      V K+                 
Sbjct: 4   FSRE-DVHSRSNVKSSVQRTLKSKLVKQFPKLEEVIDELVPKKSQVELIKCEDKIQLYAV 62

Query: 62  NVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPF--- 118
           +  I F +KF+DL+ PT+          P V      ++  +L GAN+M PG   P    
Sbjct: 63  DGEILFFQKFNDLI-PTLKFVHRFPGAFPTVQVDRGAIK-FVLSGANIMCPGLTSPGAKL 120

Query: 119 -DERCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDEL 173
            D   ++   + + +    +   AIG + ++      +    G  VE+VH  GD L
Sbjct: 121 PDAPGLEKDAIVIVNAENKEHALAIGTLLMSTEDIRSI--NKGHGVEMVHYLGDCL 174

>TDEL0H03150 Chr8 complement(518325..518859,518922..518932) [546 bp,
           181 aa] {ON} Anc_7.152 YER007C-A
          Length = 181

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 48/113 (42%), Gaps = 8/113 (7%)

Query: 65  IWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPF----DE 120
           + F +KF +L+ PT+          P V      ++  +L GAN+M PG   P     D 
Sbjct: 67  VLFFQKFDELI-PTLKLVHKFPAAYPTVQVDRGAIK-FVLSGANIMCPGLTSPGAALPDA 124

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDEL 173
              +   + V +    D   AIG + ++  +   V    G  VE++H  GD L
Sbjct: 125 PGFEEESIVVINAENKDSALAIGKLMMSTEEIKSV--NKGHGVEMIHHLGDPL 175

>NDAI0A08300 Chr1 complement(1900800..1901334,1901450..1901460) [546
           bp, 181 aa] {ON} Anc_7.152 YER007C-A
          Length = 181

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 8/113 (7%)

Query: 65  IWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPF----DE 120
           + F +KF +L+ PT+       +  P V      ++  +L GAN+M PG   P     D 
Sbjct: 67  VLFFQKFDELI-PTLRLVHRFPEAYPTVQVDRGAIKF-VLSGANIMCPGLTSPGAKLPDA 124

Query: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDEL 173
              +   + V +    D   AIG + ++      +    G  VE++H  GD L
Sbjct: 125 PGFEKDSIVVITAENKDSALAIGKLLMSTEDIKSI--NKGHGVEMIHHLGDPL 175

>YOR295W Chr15 (869208..869894) [687 bp, 228 aa] {ON}  UAF30Subunit
           of UAF (upstream activation factor), which is an RNA
           polymerase I specific transcription stimulatory factor
           composed of Uaf30p, Rrn5p, Rrn9p, Rrn10p, histones H3
           and H4; deletion decreases cellular growth rate
          Length = 228

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 7/78 (8%)

Query: 358 EKEQASVMKAVSLYRPISSTKAFLSAT--DLPPNQMFTQQDIKSAVDKYISAKNLVSPDN 415
           EK++ +V K+     PIS+ K  LS +   L      T+ ++   +  YI A NL +P+N
Sbjct: 108 EKKKGTVSKS-----PISTRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNN 162

Query: 416 KSAVRLDDLLYDLVNRSS 433
           K  +  D+ L  ++ +S+
Sbjct: 163 KKEILCDEKLELILGKST 180

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,185,344
Number of extensions: 1926280
Number of successful extensions: 5629
Number of sequences better than 10.0: 38
Number of HSP's gapped: 5667
Number of HSP's successfully gapped: 39
Length of query: 574
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 459
Effective length of database: 40,294,809
Effective search space: 18495317331
Effective search space used: 18495317331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)