Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13508g8.270ON64564534450.0
Kwal_56.237668.270ON74057816990.0
SAKL0H16852g8.270ON6445137813e-94
Smik_4.3628.270ON6484194892e-52
Suva_2.2778.270ON6494134857e-52
YDR118W (APC4)8.270ON6524214602e-48
ZYRO0C01474g8.270ON5994164564e-48
Skud_4.3788.270ON6524224541e-47
TDEL0F039708.270ON6194244493e-47
Kpol_392.18.270ON4244213991e-41
AGR078C8.270ON7155094003e-40
Ecym_43008.270ON7155573951e-39
TPHA0J007908.270ON6854283675e-36
KAFR0B054608.270ON6104783646e-36
NCAS0B037908.270ON6125113541e-34
KNAG0H031908.270ON6224863391e-32
CAGL0B01859g8.270ON6224313203e-30
TBLA0C045708.270ON6083423123e-29
NDAI0J012708.270ON7355012974e-27
KLLA0F19316g8.270ON6712011351e-07
TBLA0B004906.31ON78792707.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13508g
         (645 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...  1331   0.0  
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   659   0.0  
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   305   3e-94
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   192   2e-52
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   191   7e-52
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   181   2e-48
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   180   4e-48
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   179   1e-47
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   177   3e-47
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   158   1e-41
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...   158   3e-40
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...   156   1e-39
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   145   5e-36
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   144   6e-36
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   140   1e-34
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   135   1e-32
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   127   3e-30
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   124   3e-29
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   119   4e-27
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    57   1e-07
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    32   7.7  

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score = 1331 bits (3445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/645 (100%), Positives = 645/645 (100%)

Query: 1   MFDKWQFKRLIKLPKHRGVVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIG 60
           MFDKWQFKRLIKLPKHRGVVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIG
Sbjct: 1   MFDKWQFKRLIKLPKHRGVVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIG 60

Query: 61  AQWELAEGKLFALFFGNGAVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQ 120
           AQWELAEGKLFALFFGNGAVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQ
Sbjct: 61  AQWELAEGKLFALFFGNGAVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQ 120

Query: 121 FRQEYKGLNIEITKQLPGMVRLVRDAKQLSVVPLETGKLRWLADPGKDAAIFLGHDEKSG 180
           FRQEYKGLNIEITKQLPGMVRLVRDAKQLSVVPLETGKLRWLADPGKDAAIFLGHDEKSG
Sbjct: 121 FRQEYKGLNIEITKQLPGMVRLVRDAKQLSVVPLETGKLRWLADPGKDAAIFLGHDEKSG 180

Query: 181 DYLMTVDGLLSVRVPSGIKKMHKILRQGEDGTFVGVGADGTVQWVVLRFLNSALMRELIR 240
           DYLMTVDGLLSVRVPSGIKKMHKILRQGEDGTFVGVGADGTVQWVVLRFLNSALMRELIR
Sbjct: 181 DYLMTVDGLLSVRVPSGIKKMHKILRQGEDGTFVGVGADGTVQWVVLRFLNSALMRELIR 240

Query: 241 YSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPEDL 300
           YSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPEDL
Sbjct: 241 YSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPEDL 300

Query: 301 EDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQE 360
           EDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQE
Sbjct: 301 EDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQE 360

Query: 361 FGLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDED 420
           FGLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDED
Sbjct: 361 FGLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDED 420

Query: 421 YKRPQNRDSHQDCYGDRALALDQYISHCWENSEVWTRFERLLPQLAADADISATKLDHIY 480
           YKRPQNRDSHQDCYGDRALALDQYISHCWENSEVWTRFERLLPQLAADADISATKLDHIY
Sbjct: 421 YKRPQNRDSHQDCYGDRALALDQYISHCWENSEVWTRFERLLPQLAADADISATKLDHIY 480

Query: 481 TRAWVLEQVHVTSPVRACDVDSVEVLDVQACNKVIMVCRVQTKEGSGATVVTVEPPIADA 540
           TRAWVLEQVHVTSPVRACDVDSVEVLDVQACNKVIMVCRVQTKEGSGATVVTVEPPIADA
Sbjct: 481 TRAWVLEQVHVTSPVRACDVDSVEVLDVQACNKVIMVCRVQTKEGSGATVVTVEPPIADA 540

Query: 541 EPVLQSMKLGMDHVIKAALVLPEGAADNTAVVVALQHSGQQNASVRASCVQFGAHVMHSE 600
           EPVLQSMKLGMDHVIKAALVLPEGAADNTAVVVALQHSGQQNASVRASCVQFGAHVMHSE
Sbjct: 541 EPVLQSMKLGMDHVIKAALVLPEGAADNTAVVVALQHSGQQNASVRASCVQFGAHVMHSE 600

Query: 601 HSWEELAPKNEAHEPVAFLPVHVSATRDGVAVHSDTDVAVFENIT 645
           HSWEELAPKNEAHEPVAFLPVHVSATRDGVAVHSDTDVAVFENIT
Sbjct: 601 HSWEELAPKNEAHEPVAFLPVHVSATRDGVAVHSDTDVAVFENIT 645

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/578 (56%), Positives = 412/578 (71%), Gaps = 22/578 (3%)

Query: 1   MFDKWQFKRLIKLPKHRGVVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIG 60
           M   W+ K ++ LPK   VVWNPRLSLYLVL DK ++VNR IDGQ+IAAVNLR + +++G
Sbjct: 1   MTSNWKLKGVVTLPKGHKVVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVG 60

Query: 61  AQWELAEGKLFALFFGNGAVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQ 120
            QWE  E KLFA+F  NG VRIYDC+ GGSLRE+V+LV+EGQ+A+V VD  VW   +WA+
Sbjct: 61  IQWEKNESKLFAVFQSNGVVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAK 120

Query: 121 FRQEYKGLNIEITKQLPGMVRLVRDAKQLSVVPLETGKLRWLADPGKDAAIFLGHDEKSG 180
           F + Y+GL+ +IT  +PGMVRLVRD+KQLS+ PL+ GKL WL     DAAIFL HD +S 
Sbjct: 121 FPESYRGLDFDITTLMPGMVRLVRDSKQLSLAPLDLGKLSWLDGKYGDAAIFLAHDCEST 180

Query: 181 DYLMTVDGLLSVRVPSGIKKMHKILRQGEDGTFVGVGADGTVQWVVLRFLNSALMRELIR 240
           +Y++ +DG LS+R PSGI+ +HKIL QG  G+F+ VG DGT+QWV L+FL  ALMREL++
Sbjct: 181 EYMVAIDGQLSLRFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLKFLECALMRELVK 240

Query: 241 YSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPEDL 300
            SGQIRFLC YL EN+++C T+LIEPYR FLTR+  AYEG +LA+R RDI+L+GYIP+DL
Sbjct: 241 SSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDL 300

Query: 301 EDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQE 360
           E+WLCNS+GDKNYKRWKQLSTRMYGDLNNVL LAV+PACERLILAAE++QGIHK LKLQ 
Sbjct: 301 EEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQR 360

Query: 361 FGLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDED 420
           F      E  + E+  LI+ CQ LL  +L L+ +LNRD  LH +FA+WFYDVVMETVDED
Sbjct: 361 FCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDED 420

Query: 421 YKRPQNRDSHQDCYGDRALALDQYISHCWENSEVWTRFERLLPQLAADADISATKLDHIY 480
           YKRP       D YG     LDQY+S+CW++SE   RFE  LP+LAA   +SA  LD  Y
Sbjct: 421 YKRPSRDGIPLDSYG-----LDQYLSYCWQSSETIQRFETSLPELAARPGVSAALLDRKY 475

Query: 481 TRAWVLEQVHVTSPVRA-CDVDSV--EVLDVQACN-KVIMVCRVQTKEGSGA----TVVT 532
           TR W+L  +HVT  V    D+ +   EVLD  A + +  +  R  T +   A    T+ +
Sbjct: 476 TREWLLADIHVTETVHVDNDIRAGFDEVLDAVASDFRAAIAYRTTTPQQPSAAECLTIAS 535

Query: 533 VEPP------IADAEPVLQSM---KLGMDHVIKAALVL 561
           VEPP         ++PVL ++   +L   H +   L+ 
Sbjct: 536 VEPPRDGFSCSPASQPVLPTITHARLEQPHHVTGTLIF 573

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  305 bits (781), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 174/513 (33%), Positives = 273/513 (53%), Gaps = 39/513 (7%)

Query: 4   KWQFKRLIKLPKHRGVVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQW 63
           KW+   +   P  + +VWNP LSL+LV   K ++VNR +DGQRIA V+++  G ++  QW
Sbjct: 3   KWEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQW 62

Query: 64  ELAEGKLFALFFGNGAVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQ 123
           E +EG++FA+   NG +R+YD +  G     V L D    +D  V    WS   W    +
Sbjct: 63  EQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGD----SDCDVLKFCWSQDSWTFGSK 118

Query: 124 EYKGLNIEITKQLPGMVRLVRDAKQLSVVPLETGK--LRWLADPGKDAAIFLGHDEKSGD 181
                + EIT  +P +V+ V+D++QL+++P + G    RW    G  + IFLG+D K   
Sbjct: 119 FSNVFDHEITSLMPRLVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQK 178

Query: 182 YLMTVDGLLSVR------------------VPSGIKKMHKILRQGEDGTFVGVGADGTVQ 223
            LM +DG   +                   VP+ ++ + K     ++G ++ +  D  +Q
Sbjct: 179 ILMAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKY----DNGEYLVITDDWYIQ 234

Query: 224 WVVLRFLNSALMRELIRYSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGEL 283
            +   FLN  L RE+I    +IR L   L E++++ KT+L+EPY QF+ R+  AYEG +L
Sbjct: 235 KIKFDFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEG-DL 293

Query: 284 ASRFRDIILSGYIPEDLEDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLI 343
                +++ +G +P +LEDWL N+IGDKN +RWK+LS+ MY +   ++ L ++P CERLI
Sbjct: 294 IGDLTELLFTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLI 353

Query: 344 LAAEQLQGIHKGLKLQEFGLASPQE-FESAEVTELITGCQALLHASLELVVDLNRDTRLH 402
           L  E+L GI KGLKL   GL   ++  E  E  +L+   Q  L   +  +  +N D+ LH
Sbjct: 354 LCGERLHGIIKGLKL--IGLKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLH 411

Query: 403 AIFADWFYDVVMETVDEDYKRPQNRDSHQDCYGDRALALDQYISHCWENSEVWTRFERLL 462
             F DWF+D+VME VDEDYKR       +  Y    L + Q++S        +   +   
Sbjct: 412 EAFIDWFHDMVMEAVDEDYKR-------KTSYNCDPLKIQQFMSGSLTGVHTYEWCQYSF 464

Query: 463 PQLAADADISATKLDHIYTRAWVLEQVHVTSPV 495
           P +          ++ +Y   WV+++V    P+
Sbjct: 465 PAVTNRLGKQFETVEQLYVANWVVQRVKFGEPI 497

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  192 bits (489), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/419 (29%), Positives = 203/419 (48%), Gaps = 33/419 (7%)

Query: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80
           +NPR  ++     K +++NR  D  R+AA+ +R    +    W+   GK  ++FF +G +
Sbjct: 12  YNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTI 71

Query: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYK----GLNIEITKQL 136
           RI+D    G L   +            + +   S   W +   E +     L   I   L
Sbjct: 72  RIHDIFKDGRLVSFL-----------RIPSTKISKGTWDRIPLESESGNGNLAYNIIDYL 120

Query: 137 PGMVRLVRDAKQLSVVPLETGKLRWLADPGKDAA-------IFLGHDEKSGDYLMTVDGL 189
           P ++R V+D+K++++VP       W   P +D         I +  +E      +  +G 
Sbjct: 121 PKLIRYVKDSKRINIVPYTPPNSLWRG-PDEDEPENNEKLDIHIIFNEGHDKITVFFNGD 179

Query: 190 LSVRVPSGIKKMHKILR---QGEDGTFVGVGADGTVQWVVL-RFLNSALMRELIRYSGQI 245
            ++ VP G  +  + ++   + +DG +     DGTV+ + L   L S     +++Y   I
Sbjct: 180 YAIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAI 239

Query: 246 RFLCSYLTENINMCKTDLIEPYRQFLTRIAD-AYEGGELASRFRDIILSGYIPEDLEDWL 304
           + L  YL  +I     +L+ PY +F+ R+ D AY   +L S    + L G +  DLEDWL
Sbjct: 240 KELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWL 299

Query: 305 CNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQ-EFGL 363
           CNS+G+KN+KRWK L    Y     +L L  +PACER+I+  E+L+GI +   +Q +F  
Sbjct: 300 CNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFND 359

Query: 364 ASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYK 422
           +S    +   V  L+   Q LL  +L+ +VDL +D  L   F  W  D + E +DEDYK
Sbjct: 360 SS----DLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYK 414

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  191 bits (485), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 202/413 (48%), Gaps = 21/413 (5%)

Query: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80
           +NPR  ++ +   K ++++R  D  R+A + +R    +    W+++ GK  ++FF +G +
Sbjct: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTI 67

Query: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMV 140
           RI+D    G L   + +          +   +W      ++    +     +   LP ++
Sbjct: 68  RIHDIFKDGRLVSFLRI------PRTKISRGIWDRIPL-KYESSNRNFANNVIDVLPKLI 120

Query: 141 RLVRDAKQLSVVPLETGKLRWLA----DPG--KDAAIFLGHDEKSGDYLMTVDGLLSVRV 194
           R V+D+K++++ P       W      DP   ++  I +  +E +    +  +G  ++ +
Sbjct: 121 RFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL 180

Query: 195 PSGIKKMHKILR---QGEDGTFVGVGADGTVQWVVL-RFLNSALMRELIRYSGQIRFLCS 250
           P    +  KIL+   + ++G +     DGTV    L R L S    +L+RY   I+ L  
Sbjct: 181 PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIG 240

Query: 251 YLTENINMCKTDLIEPYRQFLTRIAD-AYEGGELASRFRDIILSGYIPEDLEDWLCNSIG 309
           YL  +I     +L  PY  F+ RI D AY   +L S  + + L G +P DL+DWLCN++G
Sbjct: 241 YLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVG 300

Query: 310 DKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASPQEF 369
           +KN+KRWK L    Y     V  LA +P CER+I+  ++L+GI +   +Q          
Sbjct: 301 EKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQX---XXXXXX 357

Query: 370 ESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYK 422
           +   V  L+   Q LL+ +L+ ++DL +D  L   F  WF D + E +DEDYK
Sbjct: 358 DLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYK 410

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  181 bits (460), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 122/421 (28%), Positives = 199/421 (47%), Gaps = 37/421 (8%)

Query: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80
           +NP   ++     K +++ R  D  R+A + +R    +    W+   GK  ++FF +G +
Sbjct: 12  YNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKDGTI 71

Query: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMV 140
           RI+D    G L   + +          +   +W      ++    +     I   LP ++
Sbjct: 72  RIHDIFKDGRLVSFLRI------PSTKISKGIWDRIPL-RYEPNNRDFACNIIDDLPKLI 124

Query: 141 RLVRDAKQLSVVPLETGKLRWLADPGKD----------AAIFLGHDEK-----SGDY--L 183
           R V+D+K++++VP       W   P +D            +F   ++K     +GDY   
Sbjct: 125 RFVKDSKRINIVPYTQPNSLWRG-PDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVF 183

Query: 184 MTVDGLLSVRVPSGIKKMHKILRQGEDGTFVGVGADGTVQWVVL-RFLNSALMRELIRYS 242
           ++VD   ++   + +K + K+    +DG +     DGTVQ + L   L S     L+ Y 
Sbjct: 184 LSVD---NIENENSLKSIIKV----QDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYI 236

Query: 243 GQIRFLCSYLTENINMCKTDLIEPYRQFLTRIAD-AYEGGELASRFRDIILSGYIPEDLE 301
             I+ L  Y+  ++     +L  PY  F+ R+ D AY  G+L S    + L G I  DLE
Sbjct: 237 MVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLE 296

Query: 302 DWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEF 361
           DWLCNS+G+KN+KRWK L    Y     +L L  +PACER+I+  E+L+ I +   +Q  
Sbjct: 297 DWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQN- 355

Query: 362 GLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDY 421
            L+   +  + EV  L+   Q LL  +L  ++ L RD  L   F  WF D + E +DEDY
Sbjct: 356 KLSYTSDLTAVEV--LLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDY 413

Query: 422 K 422
           K
Sbjct: 414 K 414

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  180 bits (456), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 131/416 (31%), Positives = 196/416 (47%), Gaps = 33/416 (7%)

Query: 19  VVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNG 78
           V +NP   LY+    +  SV+R  D  RIA + +R   Q+ G QW+   GK  ++F+ +G
Sbjct: 6   VDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKDG 65

Query: 79  AVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIE--ITKQL 136
            VRIYD    G L   V L+    +  V+    +W   +     +  K  +I+  +T+ +
Sbjct: 66  TVRIYDGFRSGRL---VSLLRASSNGAVS---GIWDRIELLHSEENIKDWSIDHDVTEMM 119

Query: 137 PGMVRLVRDAKQLSVVPLETGKLRWLADPGKDA-AIFLGHDEKSGDYL-MTVDGLLSVRV 194
           P MV+  RD++QL VVP       W      D  A+   H  +  D L +  DG  ++ +
Sbjct: 120 PKMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLSVMFDGEFTISI 179

Query: 195 -----PSGIKKMHKILRQGEDGTFVGVGADGTVQWVVL-RFLNSALMRELIRYSGQIRFL 248
                PS + K      Q     ++    DG+V+   L   +       L++    +R L
Sbjct: 180 QLAAIPSPLVKFVSAQHQ-----YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQL 234

Query: 249 CSYLTENINMCKTDLIEPYRQFLTRIADAYEGGE--LASRFRDIILSGYIPEDLEDWLCN 306
             YL ++I + + DL++PY +FL R      GG   L  +  D++L G +  +LEDWL N
Sbjct: 235 HRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVN 294

Query: 307 SIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASP 366
           S+G+KN KRW++L T  Y     VL LA +PACERLI   ++  G           L S 
Sbjct: 295 SMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG----------NLLSR 344

Query: 367 QEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYK 422
           Q      +   I   Q  L   LE +  L+   RL   F DWF D V E++DEDYK
Sbjct: 345 QLTLQLPLLPPIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYK 400

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  179 bits (454), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/422 (28%), Positives = 200/422 (47%), Gaps = 39/422 (9%)

Query: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80
           +NPR  ++     K ++++R  D  RIA + +R    +    W+   GK  ++FF +G V
Sbjct: 12  YNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDGTV 71

Query: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEY--KGLNIEITKQLPG 138
           RI+D    G L   +      +     +   +W        ++EY  +     +   LP 
Sbjct: 72  RIHDIFKDGRLVSFL------RVPSTKISRGIWDRIP---LKREYDSETFAYNVIDILPK 122

Query: 139 MVRLVRDAKQLSVVPLETGKLRWLADPGKDA---------AIFLGHDEK-----SGDY-- 182
           ++R V+D+K++S+VP       W      D           IF   ++K     +GDY  
Sbjct: 123 LIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTI 182

Query: 183 LMTVDGLLSVRVPSGIKKMHKILRQGEDGTFVGVGADGTVQWVVLR-FLNSALMRELIRY 241
           L+ +D + + R+   + K+       +DG +     DG+V+ + L+  L S    +L+ Y
Sbjct: 183 LLPMDDIENERILESVVKV-------QDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHY 235

Query: 242 SGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIAD-AYEGGELASRFRDIILSGYIPEDL 300
              I+ L  YL  ++ +   +LI PY  F+ RI D AY   +L S    + L G +  DL
Sbjct: 236 IMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDL 295

Query: 301 EDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQE 360
           EDWLCNS+G+KN K+WK L    Y     +L L  +P CER+I+  E+L+G  +   +Q 
Sbjct: 296 EDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQN 355

Query: 361 FGLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDED 420
               S    +   V  L+   Q LL+ +L+ ++ L R+  L   F  WF D + E +DED
Sbjct: 356 ---KSNNTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDED 412

Query: 421 YK 422
           YK
Sbjct: 413 YK 414

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  177 bits (449), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 214/424 (50%), Gaps = 28/424 (6%)

Query: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80
           +NP  SLY    +K +S+ R  D  +IA V +R    L   QW+   GK   +F+ +G  
Sbjct: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70

Query: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMV 140
           RIYD    G L  ++ +      +   VD A+W   + ++    +K  +  +   +P M+
Sbjct: 71  RIYDAFQAGKLLALLRI------SKTRVDGAIWDRIELSRQEVTFK-FDHFVLNSMPKMI 123

Query: 141 RLVRDAKQLSVVPLETGKLRW-LADPGKDAA--------IFLGHDEKSGDYLMTVDGLLS 191
           R  RD +Q+ ++P E     W LA   +D          + L H E +G  LM +DG   
Sbjct: 124 RFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLVLM-LDGDFI 182

Query: 192 VRV---PSGIKKMHKILRQGEDGTFVGVGADGTVQWVVL-RFLNSALMRELIRYSGQIRF 247
           +R+   PSG     K +   + G +     D TV+ + L + +      +LI++   I+ 
Sbjct: 183 LRLAAGPSG--PALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQ 240

Query: 248 LCSYLTENINMCKTDLIEPYRQFLTRIADAYEG-GELASRFRDIILSGYIPEDLEDWLCN 306
           L  YL +++++ K DL+ PY +FLT+I DA  G   L      ++L G +  +LE+W C 
Sbjct: 241 LNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGLSVELENWFCY 300

Query: 307 SIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASP 366
           ++G+KN+K+WK++   MY     +L L+ IPACER+IL +E+ +   K L+L E    + 
Sbjct: 301 TVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTT- 359

Query: 367 QEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYKRPQN 426
              +S+E   L +  Q  L +++E +  ++    L   F  WF D + E +DEDYK+  +
Sbjct: 360 ---DSSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLS 416

Query: 427 RDSH 430
            DS+
Sbjct: 417 IDSN 420

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  158 bits (399), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/421 (23%), Positives = 203/421 (48%), Gaps = 33/421 (7%)

Query: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80
           +NP   LY+   D+ ++V R  D  ++A + ++    + G +W+   G+  ++F  +G +
Sbjct: 14  YNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGTI 73

Query: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMV 140
           RIYD    G L   +       S+   VD+ +W  A+++    + +  +  I + LP ++
Sbjct: 74  RIYDIFKNGRLVSYI-----RSSSQKNVDSCLWDRAEFS-IPSKLQLFDSNIIECLPTLI 127

Query: 141 RLVRDAKQLSVVPLETGKLRWL------ADPGKDAA------IFLGHDEKSGDYLMTVDG 188
           + V+D++ ++++        W        D  K+        + + H+    ++ + ++G
Sbjct: 128 KFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNG 187

Query: 189 LLSVR---VPSGIKKMHKILRQGEDGTFVGVGADGTVQWVVLR-FLNSALMRELIRYSGQ 244
           +  +    +P   K     L +  +G ++    +G  + +     L+  +   L+    +
Sbjct: 188 VYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILE 247

Query: 245 IRFLCSYLTENINMCKTDLIEPYRQFLTRIA-DAYEGG--ELASRFRDIILSGYIPEDLE 301
           IR L  Y+ +++++ K +LI PY  F+ +I  DAY GG  +L      ++L+G I  + +
Sbjct: 248 IRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFK 307

Query: 302 DWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEF 361
           DWL N IGD+N K+W++L   M+  +  +L LA+IP+CER ++  E+  G   G      
Sbjct: 308 DWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGY----- 362

Query: 362 GLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDY 421
            + +  +F   ++  L      L+  S+ ++  LN   +   IF++W  D + E  DEDY
Sbjct: 363 -MKTDTDF--YDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDY 419

Query: 422 K 422
           K
Sbjct: 420 K 420

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score =  158 bits (400), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 134/509 (26%), Positives = 229/509 (44%), Gaps = 42/509 (8%)

Query: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAV--NLRGDGQLIGAQWELAEGKLFALFFGNG 78
           WN RLSL+ VL  + +S+ R IDG+R+ A+   LR + +L+  QWE  +G+LFA+   +G
Sbjct: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSG 79

Query: 79  AVRIY------DCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKG-LNIE 131
           +V+IY      +   G    E+V  V  G+     ++  VW+  +W + R+ + G  +  
Sbjct: 80  SVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKW-RVREPFCGEFDSP 138

Query: 132 ITKQLPGMVRLVRDAK-QLSVVPLETGKLRWLADPGKDAA-IFLGHDEKSGDYLMTVDGL 189
           + + LP +  +   A+ +L   PL      W A    D + +FL  D  +   ++++DG 
Sbjct: 139 LVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESNMFLTFDNNTRKVVLSIDGT 198

Query: 190 LSVRVPSGIK---KMHKILRQGEDGTFVGVGADGTVQWVVLRFLNSALMRELIRYSGQIR 246
            + R     K   K+  IL   E+        D  +Q + L F     + EL++    I+
Sbjct: 199 FNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLEFTEYHQVHELMKCCSHIQ 258

Query: 247 FLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPED-LEDWLC 305
           FL  Y+ +N  +  T L+EP+  F   +    +  +     +D+   GY  +  +E+W  
Sbjct: 259 FLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVENWFT 318

Query: 306 NSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLAS 365
             +G      WKQ +   +     VL   +IPACERLI++A++L G+ K LKL  FGL  
Sbjct: 319 LKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVKSLKLNVFGLDD 378

Query: 366 PQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHA---IFADWFYDVVMETVDEDYK 422
             E  + EV +L+     LL   +E V   +    +      + ++  D ++   DED  
Sbjct: 379 DNELTAVEVQDLLQMSLGLLKGLVEQVEQFHVGENVSKDGLAWIEYMMDSLLHNEDEDAH 438

Query: 423 RPQNRDS-------HQDCYGDR----ALALDQYI----SHCWENSEVWTRFERLLPQLAA 467
               +D          + Y        L L++YI     + W  S+  ++ E L+ Q   
Sbjct: 439 NLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKPYSWIKSDFPSQLEVLMRQFDL 498

Query: 468 DADISATKLDHIYTRAWVLEQVHVTSPVR 496
                   +   YT  W+ + + V  PVR
Sbjct: 499 --------VQKNYTAKWIKKLIKVPGPVR 519

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score =  156 bits (395), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 138/557 (24%), Positives = 247/557 (44%), Gaps = 70/557 (12%)

Query: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLR--GDGQLIGAQWELAEGKLFALFFGNG 78
           WN RLSL+ +     V++ R IDG+++ ++ LR   + +++  Q E  +G LFA+   +G
Sbjct: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79

Query: 79  AVRIYDCATGGSLREVVDLVDEGQSADV------------TVDTAVWSGAQWAQFRQEYK 126
           +V++Y        R+ VD  D    AD+             ++  VW+  +W   R  +K
Sbjct: 80  SVKVYKG------RQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKWKS-RGAFK 132

Query: 127 G-LNIEITKQLPGMVRL-VRDAKQLSVVPLETGKLRWLADPGKDAA-IFLGHDEKSGDYL 183
           G  +  +T+ LP +  + V    +L+  PLE     W A   ++ + +FL +D  +   +
Sbjct: 133 GDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESNMFLTYDNATRKVM 192

Query: 184 MTVDGLLSVRVPSGIK---KMHKILRQGEDGTFVGVGADGTVQWVVLRFLNSALMRELIR 240
           +++DG  + R     K   K+  IL    +        D  +Q + L F  S  M EL++
Sbjct: 193 VSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLEFTESHQMHELMK 252

Query: 241 YSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPE-D 299
              QI+FL  YL +N  +    L+EP+  F+  +    +   L    +D+   GY  E +
Sbjct: 253 CCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDVFYLGYSAEKN 312

Query: 300 LEDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQ 359
           +E+W    +G      WKQ +   +     +L   +IPACERLI+A ++LQG+ K LKL 
Sbjct: 313 IENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKSLKLN 372

Query: 360 EFGLASPQEFESAEVTELITGCQALLHASLELVVDLNR-----DTRLHAI-FADWFYDVV 413
            FGL   +E  + EV EL+   Q  L    E+V  + +     +  +  + + ++  D +
Sbjct: 373 IFGLDDDEELIAPEVDELL---QMGLDTLTEIVKQVEKFHIGENMSIDGLTWIEYMIDSL 429

Query: 414 METVDEDYKRPQNRDSHQDC-YGDRALALDQYI------------------SHCWENSEV 454
           +   ++D     N  + QDC   +   ALD Y                   ++ W  ++ 
Sbjct: 430 LRGEEDD----GNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQTYKWIKNDF 485

Query: 455 WTRFERLLPQLAADADISATKLDHIYTRAWVLEQVHVTSPVRACDVDSVEVLD--VQACN 512
             + E L+ Q           +   YT  W+ + + V+ P+R     + + L   +   +
Sbjct: 486 PNKLESLIRQFDL--------VQKNYTAKWIKKMIKVSGPIRKLRSITGQRLKDAIMDGD 537

Query: 513 KVIMVCRVQTKEGSGAT 529
            + M+C   +   S  T
Sbjct: 538 VIYMICSKSSSTTSQGT 554

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  145 bits (367), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 110/428 (25%), Positives = 197/428 (46%), Gaps = 41/428 (9%)

Query: 22  NPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAVR 81
           NP   LY    DK +++    D   +A + ++    ++   W+   GK     F +G++R
Sbjct: 15  NPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGSIR 74

Query: 82  IYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQ-FRQEYKGLNIEITKQLPGMV 140
           +YD    G L      V   +S    +    W      +   Q+ K  + ++T  +P +V
Sbjct: 75  VYDIFKLGRL------VSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLV 128

Query: 141 RLVRDAKQLSVVP------------------LETGKLRWLADPGKDAAIFLGHDEKSGD- 181
           + V+D + L +VP                  LE  K     D   D  I L + E   D 
Sbjct: 129 KFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLD--IHLLYTESGMDN 186

Query: 182 YLMTVDG---LLSVRVPSGIKKMHKILR--QGEDGTFVGVGADGTVQWV-VLRFLNSALM 235
           + + V+G   L  + VP+  +  +K+++  +   G ++G   + + + + V  F ++ + 
Sbjct: 187 FAVLVNGVYDLSDIHVPN--RSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDIR 244

Query: 236 RELIRYSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRI-ADAYEGGE-LASRFRDIILS 293
             L+  S  +R   S L E I + K +LI P+  F+  +  DAYEG + L     +++L+
Sbjct: 245 VNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTNLLLT 304

Query: 294 GYIPEDLEDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIH 353
           G I E+ EDWL N+IG++N ++WK L   +   L  +L+L  IP  E+ I+ AE++Q   
Sbjct: 305 GEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYI 364

Query: 354 KGLKLQEFGLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVV 413
             ++L +    S      +E+ +LI     +L  S++ +  LN D     IF DW  + +
Sbjct: 365 TAMRLSD---NSKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFEIFIDWIRNTI 421

Query: 414 METVDEDY 421
              +DE+Y
Sbjct: 422 YLIIDENY 429

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  144 bits (364), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 124/478 (25%), Positives = 213/478 (44%), Gaps = 56/478 (11%)

Query: 14  PKHRG-VVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFA 72
           PK R   V+N +L LY   G K + V R  D   IA   ++    + G  W+   GK  +
Sbjct: 6   PKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLS 65

Query: 73  LFFGNGAVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEI 132
           +FF +G++RI D    G L   +      ++    VD   W   +  Q   E K  N  I
Sbjct: 66  IFFRDGSIRIIDVFKDGKLVAFL------RTQFKNVDCTYWDRIE-EQTTNEMKQFNKNI 118

Query: 133 TKQLPGMVRLVRDAKQLSVVPLETGKLRWL---ADPGKDAAIFLG--HDEKSGDYLMTVD 187
              +P +++ V  A +LS++P       W    A   K+  I +   H  ++  +LM ++
Sbjct: 119 VDLMPSLIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLN 178

Query: 188 G--LLSVRVPS---GIKKMHKILRQGEDGTFVGVGADGTVQWV-VLRFLNSALMRELIRY 241
           G   L+++ P      K     L +  +  +  +  DG+ + +    FL+S    +L+  
Sbjct: 179 GDYYLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLEC 238

Query: 242 SGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGE-LASRFRDIILSGYIPEDL 300
              ++ +  Y   ++++ +  +I+PY  FL +I D   G E L +  +   L G I ++L
Sbjct: 239 ILSLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDEL 298

Query: 301 EDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQE 360
           +DWL  S+GDKN  +W+ L    Y     +  +A++ ACER+IL +E+            
Sbjct: 299 QDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERC----------- 347

Query: 361 FGLASPQEFESA--------EVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDV 412
           FGL    +FES         E+ EL++  Q +L + +    +      +  IF  W  D 
Sbjct: 348 FGLIMAFQFESGADDNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDR 407

Query: 413 VMETVDEDYKRPQNRDSHQDCYGDRALALDQYISHCWENSEVWTRFERLLPQLAADAD 470
           V E +D+DYK PQ             L++ Q  + C+   ++   FE LL +   D++
Sbjct: 408 VHEELDDDYK-PQ-------------LSITQNSNTCY---KLGKSFEYLLQEGKKDSE 448

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  140 bits (354), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 121/511 (23%), Positives = 224/511 (43%), Gaps = 28/511 (5%)

Query: 19  VVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNG 78
           V +NP     L       +V R  D  +I  + +R    +I   W         + F +G
Sbjct: 9   VSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDG 68

Query: 79  AVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPG 138
           + RI+D    G L  ++ L D  Q     +DT +WS  +  Q   E +  + +I+  +P 
Sbjct: 69  SARIHDIFREGKLMTLLRLQDGFQKC---MDTGIWSKLEVRQKPNEGE-FDRDISGLMPS 124

Query: 139 MVRLVRDAKQLSVVPLETGKLRW--LADP---GKDAAIFLGHDEKSGDYLMTVDGLLSVR 193
            ++ V +A QL VVP    + +W  +  P        I + H+  + +YL+ ++G+  + 
Sbjct: 125 PIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLT 184

Query: 194 V-PSGI-----KKMHKILRQGEDGTFVGVGADGTVQWVVLR-FLNSALMRELIRYSGQIR 246
           + P+        ++HKI+   +   F     D     + L   + S     L+    +++
Sbjct: 185 IQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMK 244

Query: 247 FLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPEDLEDWLCN 306
            L  Y+ +++++   DL +P   FL  + +     +L+   +  IL G + + L  WLCN
Sbjct: 245 QLHRYIVDHLDIIDNDLKKPLDDFL-EVTNILNIKDLSKSLKSFILYGLMAKSLNHWLCN 303

Query: 307 SIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASP 366
            +G+KN K+WK+LS   Y  +  +++LAV+PA E+L L + + + +   + L   G    
Sbjct: 304 VVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASG--HM 361

Query: 367 QEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYKRPQN 426
           QE E  +  +  T   AL + +L +    + + +  ++F  W  D++ E VDEDY    N
Sbjct: 362 QELEYFDSLKRTTA--ALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLN 419

Query: 427 RDSHQDCYGDRALALDQYISHCW-ENSEVWTRFERLLPQLAADADISATKLDHIYTRAWV 485
                         +DQ+      E S   T   + L +  +D   +   +D  Y R  +
Sbjct: 420 ICEDGSVVPTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISD---TLENIDSSYVRNML 476

Query: 486 LEQVHVTSPVRACDVD---SVEVLDVQACNK 513
           L+ + +    R+   +    V +LD+  C K
Sbjct: 477 LKTMKIRGTARSFTENFDEDVTILDIFYCAK 507

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  135 bits (339), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 119/486 (24%), Positives = 218/486 (44%), Gaps = 24/486 (4%)

Query: 22  NPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAVR 81
           N  L LY+  G K + VNR  D   IA+  +R   Q++  QW+   G++ ++ F +G++R
Sbjct: 16  NNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIR 75

Query: 82  IYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMVR 141
           I D      L  ++      ++    +D  +W   +     Q  +     IT+ LP +V+
Sbjct: 76  INDVMYDAKLVALL------RTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVK 129

Query: 142 LVRDAKQLSVVPLETGKLRW-LADPGKDAAIFLGH--DEKSGDYLMTV-DGLLSVRVPSG 197
            +      S+ P       W   + G    I   H   +K GD L+ + +G   +++   
Sbjct: 130 FMGSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQLTGP 189

Query: 198 IKKMHKILRQ------GEDGTFVGVGADGTVQWVVLR-FLNSALMRELIRYSGQIRFLCS 250
            ++    LR+       +   +      G V+ V L  F+      +L+      +    
Sbjct: 190 HQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLG 249

Query: 251 YLTENINMCKTDLIEPYRQFLTRIA-DAYEGGELASRFRDIILSGYIPEDLEDWLCNSIG 309
           Y   ++   +T+ +EPY++F+ R+  DA+   +L     D  L G + E+L DWL  S+G
Sbjct: 250 YFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSLG 309

Query: 310 DKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASPQEF 369
           ++N + WK L    Y   + V+ + ++P  ERLI+  EQLQ +    +L E G+      
Sbjct: 310 ERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSE-GMVG-DSL 367

Query: 370 ESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYKRPQNRDS 429
           E +E T+L+  CQ LL   L+ V  L +D +   +F  W  +V+  T+++DY  P N + 
Sbjct: 368 EISEFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDY--PPNFNV 425

Query: 430 HQDCYGDRALALDQYISHCWENSEVWTRFERLLPQLAADADISATKLDHIYTRAWVLEQV 489
             +C G         ++   E ++    F     ++  +      ++D++Y R  +L +V
Sbjct: 426 -SEC-GKFGFLFTSGLALTLEPAKKTVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKV 483

Query: 490 HVTSPV 495
            V  P+
Sbjct: 484 IVGDPI 489

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  127 bits (320), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 105/431 (24%), Positives = 200/431 (46%), Gaps = 48/431 (11%)

Query: 17  RGVVWNPRLSLYLVLGDK-TVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFF 75
           R + +NP+  L+ +  D  ++ + R  D   I  +N+R    L+   W+  +GK  ALF 
Sbjct: 9   RFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFL 68

Query: 76  GNGAVRIYDCATGGSLREVVDLVDEGQSADV-TVDTAVWSGAQWAQF-RQEYKGLNIEIT 133
            +G+VRIYD   GG L   + ++     ++  ++D  +W      +    E +  N ++T
Sbjct: 69  KDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLT 128

Query: 134 KQLPGMVRLVRDAKQLSVVPLETGKLRWLA---DPGKDAAIFLGHDEKSGDYLMTVDG-- 188
           + +P +V+ V+DAKQ+ ++P  +    W +   +  K   + LG+   S    + ++G  
Sbjct: 129 ESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKKVVDVHLGYSCSSAQVTILINGEY 188

Query: 189 ----------LLSVRVPSGIKK------MHKILRQGEDGTFVGVGADGTVQWVVLRFLNS 232
                      +  ++P  + K      +++I    +D + + +   G +       LN 
Sbjct: 189 LIEKSVSDINQIQKKIPISLNKKEFCEAIYEI--HFDDYSRLQIDLTGIL-------LND 239

Query: 233 ALMRELIRYSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIIL 292
             + +LI    ++      + ++ N+ +  ++ PY +FL  I    +   L   F    L
Sbjct: 240 DKL-DLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLDVLERLF----L 294

Query: 293 SGYIPEDLEDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGI 352
            G +   L +W   +I +KN K+W +L    Y +   VL +  +P CERL++   ++ G+
Sbjct: 295 IGELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGM 354

Query: 353 HKGLKLQEFGLASPQEFESAEVTELITGCQALLHASLELVVDLNRD-TRLHAIFADWFYD 411
            KG+ LQE      QE    +++EL    Q+ L+  L+L+ +LN D T     F  W  D
Sbjct: 355 IKGIDLQE-----SQETSLLDISEL----QSFLNLVLKLLAELNEDETYFKQDFLPWLTD 405

Query: 412 VVMETVDEDYK 422
            V E+++ +YK
Sbjct: 406 KVYESINNEYK 416

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  124 bits (312), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 94/342 (27%), Positives = 150/342 (43%), Gaps = 22/342 (6%)

Query: 22  NPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAVR 81
           NP L L L   D  + V R  D   I    +R    +I  QWE   G   A+FF  G V 
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 82  IYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMVR 141
           IYD   G     ++ +++ G+     VD  +W    +     E    + +IT  +P +++
Sbjct: 73  IYD---GIKTSRLLAMLNGGKP---NVDAGIWDRYYFPN-DNEKDIFDSDITLYMPTLIQ 125

Query: 142 LVRDAKQLSVVPLETGKLRWLADPGKDAA-----IFLGHDEKSGDYLMTVDGLLSVRVPS 196
           ++RD +++           W A   +        I L H      +   ++G L +  PS
Sbjct: 126 IIRDKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPS 185

Query: 197 GIKKMHKI-LRQGEDGTFVGVGADGTVQWVVLRFL-----NSALMRELIRYSGQIRFLCS 250
                  I + +GE+  F+    D TV+ +    L     N  L+   IR    I  L  
Sbjct: 186 NSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIR----INHLLK 241

Query: 251 YLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPEDLEDWLCNSIGD 310
           YL E+I   K ++  P+ +FLT +        +      +++SGYI  +LE+W+ N+IG 
Sbjct: 242 YLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIGI 301

Query: 311 KNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGI 352
           KN  RW  L    Y    +++ L VIPACER ++   +LQG+
Sbjct: 302 KNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGL 343

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  119 bits (297), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 118/501 (23%), Positives = 210/501 (41%), Gaps = 84/501 (16%)

Query: 16  HRGVVWN--------PRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAE 67
           HR   WN        P   LYL     ++   R +DG +I+ + +R    +I   W+   
Sbjct: 14  HRDEQWNFAPISYINPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKT 73

Query: 68  GKLFALFFGNGAVRIYDCATGGSLREVV----DLVDEGQSADVTVDTAVWSGAQWAQFRQ 123
           GK   + F +G  RIYD    G L  +V    +L+D  +     VD A+W         Q
Sbjct: 74  GKYLTINFDDGTFRIYDIFQDGKLITLVRPQRNLLDIHRKT--KVDNAIWDRLIILNSIQ 131

Query: 124 EYKGLNIEITKQLPGMVRLVRDAKQLSVVPLETGKL----RWLADPGKDAAIFLGHD--- 176
           E +  N +ITK +P +++ V+D+  + +VP    +     R          I    D   
Sbjct: 132 ELE-FNHDITKLMPTLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAID 190

Query: 177 -------EKSGDYL--------------MTVDGLLSVRV------PSGIKKMHKILRQGE 209
                  EKS  YL              + ++G   + +       +   K+ +IL+   
Sbjct: 191 MTTNQEVEKSMRYLDLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTV 250

Query: 210 DGTFVGVGADGTVQWVVL-RFLNSALMRELIRYSGQIRFLCSYLTENINMCKTDLIEPYR 268
            G +     +G+++ +    F +S L  EL+    +I  +  Y   ++++    L++ + 
Sbjct: 251 HGVYHCFHENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFT 310

Query: 269 QFL--TRIADAYEGG--ELASRFRDIILSGYIPEDLEDWLCNSIGDKNYKRWKQLSTRMY 324
            FL  T   +   GG   +  + +  +LSG + E+L +WL  SIG+KN K+WK+LS  +Y
Sbjct: 311 DFLYPTIFEEKQNGGGNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELY 370

Query: 325 GDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQE------------------FGLASP 366
                + +LA+IPACE  +L +++   I   +++++                    L S 
Sbjct: 371 SKSIQIFSLALIPACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSR 430

Query: 367 Q-----EFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDY 421
           Q     EF S    ELI   Q      L+ +  ++   +  ++F  W  +++   +DED+
Sbjct: 431 QDKILTEF-SPSFLELIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDH 489

Query: 422 KRPQNRDSHQDCYGDRALALD 442
             P+      D Y +  + LD
Sbjct: 490 -VPK-----LDTYSNPIICLD 504

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 89/201 (44%), Gaps = 13/201 (6%)

Query: 167 KDAAIFLGHDEKSGDYLMTVDGLLSVRV------PSGIKKMHKILRQGEDGTFVGVGADG 220
           K   IF+  D K+   +++++G L+++V      P  IK++ K+      G ++ +G D 
Sbjct: 155 KPIDIFMAIDSKTNKLILSIEGTLNIKVGEKLKLPKDIKRIIKV----SSGKYMCLGKDW 210

Query: 221 TVQWVVLRFLNSALMRELIRYSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEG 280
           + Q + L FL    + +LI+ + +   L  YL +     +  L EPY +F+  +      
Sbjct: 211 SYQVLDLTFLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEHK 270

Query: 281 GELASRFRDIILSGYIPEDLEDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACE 340
             L   F   +    + E+L +    +       +W  LS  +  +   ++    IP  E
Sbjct: 271 NALQELFYIGVTKLEVMEELHEVQLQTF---RLDKWSALSNDLCSNSIGLMVACTIPLLE 327

Query: 341 RLILAAEQLQGIHKGLKLQEF 361
           R+I+ A  ++ + + +   +F
Sbjct: 328 RMIVLAASIEALCEAITWIKF 348

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 13/92 (14%)

Query: 204 ILRQGEDGTFVGVGADGTVQWVVLRFLNSALMRELIRYSGQIRFLCSYLTENINMCKTDL 263
           ILR  +   F  +  D    WV   +L +    ELIR+   + F   Y+  N++   T +
Sbjct: 621 ILRLADAEEFWYINYDKNEGWVASHYLLNEKPNELIRHLEVVDFFTKYMKSNLSRVSTFI 680

Query: 264 IEPYRQ---FLTRIADAYEGGELASRFRDIIL 292
            E Y +   FL R           +R++D ++
Sbjct: 681 REDYHKDDVFLRRY----------TRYKDFVM 702

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,576,515
Number of extensions: 2659989
Number of successful extensions: 5944
Number of sequences better than 10.0: 23
Number of HSP's gapped: 6038
Number of HSP's successfully gapped: 26
Length of query: 645
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 529
Effective length of database: 40,180,143
Effective search space: 21255295647
Effective search space used: 21255295647
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)