Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13486g8.271ON90290244810.0
Kwal_56.237598.271ON86188629660.0
SAKL0H16830g8.271ON86291026330.0
Skud_12.1608.271ON89389625940.0
Suva_10.1768.271ON89389525650.0
YLR092W (SUL2)8.271ON89389925590.0
Smik_12.1518.271ON89390125570.0
KNAG0G020708.271ON89991325480.0
NCAS0B050508.271ON92394425220.0
KLLA0F19338g8.271ON89181125140.0
Suva_4.554na 1ON85082724900.0
TDEL0F039808.271ON86790324770.0
Kpol_543.438.271ON86683124710.0
KAFR0B027508.271ON83488224670.0
NDAI0B020208.271ON90592924590.0
Skud_2.424na 1ON86391624490.0
Smik_2.435na 1ON86382824400.0
YBR294W (SUL1)na 1ON85982924330.0
CAGL0L12342g8.271ON89191724200.0
TPHA0J008008.271ON91794623740.0
ZYRO0C01452g8.271ON90693623680.0
AGR077C8.271ON84888323600.0
TPHA0A017608.271ON89384123420.0
Ecym_42998.271ON87488222270.0
TBLA0F030508.271ON89750212971e-164
NDAI0B022108.99ON7065013032e-27
Kpol_467.118.99ON7444752952e-26
KLLA0E14059g8.99ON7064742933e-26
KNAG0D023908.99ON7164772923e-26
NCAS0B048008.99ON7244802899e-26
YPR003C8.99ON7544732871e-25
Ecym_7084na 2ON6894852763e-24
Suva_16.3228.99ON7424732763e-24
TPHA0H007208.99ON7874882747e-24
Skud_16.2868.99ON7455052702e-23
TBLA0C052708.99ON7764782702e-23
KLTH0G16764g8.99ON7104542692e-23
SAKL0B03124g8.99ON7445742692e-23
TDEL0C012808.99ON7274872683e-23
Smik_16.2418.99ON7444732674e-23
ZYRO0F04796g8.99ON7354662665e-23
CAGL0L09207g8.99ON7254722593e-22
Kwal_27.110398.99ON7261651818e-13
SAKL0H08800gna 2ON6204441737e-12
AGR213Cna 2ON6891901612e-10
TDEL0B023305.689ON70288781.2
KLLA0E04731g3.485ON1060156781.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13486g
         (902 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...  1730   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...  1147   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1018   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1003   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...   992   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...   990   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...   989   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...   986   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271    976   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...   972   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...   963   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...   958   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...   956   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...   954   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271    951   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...   947   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...   944   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...   941   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...   936   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....   919   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...   916   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   913   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   906   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   862   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   504   e-164
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   121   2e-27
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   118   2e-26
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   117   3e-26
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   117   3e-26
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   115   9e-26
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   115   1e-25
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   110   3e-24
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   110   3e-24
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   110   7e-24
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   108   2e-23
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   108   2e-23
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   108   2e-23
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...   108   2e-23
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...   107   3e-23
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...   107   4e-23
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   107   5e-23
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...   104   3e-22
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    74   8e-13
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    71   7e-12
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    67   2e-10
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    35   1.2  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    35   1.3  

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score = 1730 bits (4481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 850/902 (94%), Positives = 850/902 (94%)

Query: 1   MSNFQSSPGSKRESSFEVSRELSNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGA 60
           MSNFQSSPGSKRESSFEVSRELSNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGA
Sbjct: 1   MSNFQSSPGSKRESSFEVSRELSNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGA 60

Query: 61  QXXXXXXXXXXXXXXXXXXXXXXKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTF 120
           Q                      KPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTF
Sbjct: 61  QFAAEFGGEPGSGSGSGSGFPEAKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTF 120

Query: 121 TLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGL 180
           TLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGL
Sbjct: 121 TLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGL 180

Query: 181 YSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALL 240
           YSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALL
Sbjct: 181 YSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALL 240

Query: 241 CGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKV 300
           CGIIS              ISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKV
Sbjct: 241 CGIISLGLGVLRLGFLVELISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKV 300

Query: 301 IINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQA 360
           IINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQA
Sbjct: 301 IINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQA 360

Query: 361 LRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPEL 420
           LRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPEL
Sbjct: 361 LRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPEL 420

Query: 421 PASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALK 480
           PASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALK
Sbjct: 421 PASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALK 480

Query: 481 AKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWR 540
           AKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWR
Sbjct: 481 AKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWR 540

Query: 541 LSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTN 600
           LSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTN
Sbjct: 541 LSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTN 600

Query: 601 XXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGK 660
                           TAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGK
Sbjct: 601 SGAGAGVGMSSGNSAGTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGK 660

Query: 661 VEGHVTDGGSPRAPRFHTKWVPFDRYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQ 720
           VEGHVTDGGSPRAPRFHTKWVPFDRYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQ
Sbjct: 661 VEGHVTDGGSPRAPRFHTKWVPFDRYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQ 720

Query: 721 YDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPPKFLRKLFKSSSEDLENRAVARDE 780
           YDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPPKFLRKLFKSSSEDLENRAVARDE
Sbjct: 721 YDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPPKFLRKLFKSSSEDLENRAVARDE 780

Query: 781 RPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSG 840
           RPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSG
Sbjct: 781 RPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSG 840

Query: 841 FGTVNDEFADESLLVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWDY 900
           FGTVNDEFADESLLVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWDY
Sbjct: 841 FGTVNDEFADESLLVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWDY 900

Query: 901 SD 902
           SD
Sbjct: 901 SD 902

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score = 1147 bits (2966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/886 (66%), Positives = 672/886 (75%), Gaps = 31/886 (3%)

Query: 21  ELSNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQXXXXXXXXXXXXXXXXXXX 80
            L     +DLDDLDAEYG FKN EHS+   G   +S  GA                    
Sbjct: 3   NLERQTSLDLDDLDAEYGHFKNTEHSEIGGGP--SSNPGAAVGVGASTKLGQDQNGDKSG 60

Query: 81  XXXKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLP 140
                     P  +  +   ++E  VT  E+Y   +R + T +    YLR LLP++ WLP
Sbjct: 61  ATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLP 120

Query: 141 HYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVC 200
           HYN RW YQD+VAGITVGCVLVPQSMSYA IATL PQ+GLYSSFVGA IYSFFATSKDVC
Sbjct: 121 HYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVC 180

Query: 201 IGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXXXXXXXXXXI 260
           IGPVAVMSLQTAKA+S V++ LP DT+IT+P++ATALA LCG+IS              I
Sbjct: 181 IGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISLGLGVLRLGFLVELI 240

Query: 261 SSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLV 320
           SSTAVAGFMTGSALNII+GQ+PALMGYNKLVNTRTSTYKVII +L+HLPDTKLDAVFGL+
Sbjct: 241 SSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLI 300

Query: 321 PLVILYVWKWGCSTGGPRLVQRY---GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGM 377
           PLV+LY WKW C++GGPRLV+RY   GSR+ R+W     YTQALRNAV+I+VFTAIAW +
Sbjct: 301 PLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSI 360

Query: 378 SHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKA 437
           SH   K    A ISLLG VPSGLKDVGVMK+P GL +KIAPELPASVIVL+LEHIAI+KA
Sbjct: 361 SHHKKK----APISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKA 416

Query: 438 FGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGAC 497
           FGRVNDYRVVPDQELIAIGATNL+GTFFNAYPATGSFSRSALKAKCNVSTPLSG+FSGAC
Sbjct: 417 FGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGAC 476

Query: 498 VLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITV 557
           VLLAIYCLTSAF++IPKATLSAVIIHAVSDLIASYKTTWS WRL+P DLVCFL TV I V
Sbjct: 477 VLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAV 536

Query: 558 FSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXT 617
           FSSIENGIYFAMCWSVAVLLF+ AFP  +FLGRV+IAE   TN                 
Sbjct: 537 FSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAEL-ATNEGVSAGSEFAPLSK--- 592

Query: 618 AVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFH 677
             + EK +  ++ + SVSSES +      AK     G  +       V    +     FH
Sbjct: 593 --DFEKGKGVSYASGSVSSESFN------AKKQGIEGGSQF------VGGASNAAGAGFH 638

Query: 678 TKWVPFDRYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRP 737
           TKWVPF+ YTRELNP+V VA PPPGVIVFRPSESWTYVNC+RQY+AIFDEVVR TRRG+ 
Sbjct: 639 TKWVPFEPYTRELNPQVPVAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKV 698

Query: 738 QIVAKSSSRPWNDPGEWHPPKFLRKLF-KSSSEDLENRAVARDERPVLRVIAMDWSQVAQ 796
           Q+ +K S RPWNDPGEWHPPKFLRK F K  SE LE + V  D+RPVLRVIAMDWSQVAQ
Sbjct: 699 QVTSK-SGRPWNDPGEWHPPKFLRKWFGKKYSESLE-QGVVSDDRPVLRVIAMDWSQVAQ 756

Query: 797 VDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVG 856
           VDSTGLQTL DLRKAV+KYADRQVEFHF+GII PW+KRGL+N+GFGTVN+E ADESLLVG
Sbjct: 757 VDSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVG 816

Query: 857 HKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWDYSD 902
           HK+  +AR    T DEE+ L  PATG N+PFFH E+PDFS+WD+SD
Sbjct: 817 HKTYQVARGGA-TGDEEALLPQPATGVNMPFFHAEMPDFSKWDFSD 861

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/910 (57%), Positives = 633/910 (69%), Gaps = 62/910 (6%)

Query: 1   MSNFQSSPGSKRESSFEVSRELSNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGA 60
           MS++ +     R SS ++    S+ A  +LDDL+AEY  +KNAE  +     D+      
Sbjct: 1   MSDYHTH---NRGSSKDLEHNSSDFAEPNLDDLEAEYDNYKNAEQ-NPREKSDVVETLPP 56

Query: 61  QXXXXXXXXXXXXXXXXXXXXXXKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTF 120
                                         PG        +HE  V   ++Y Q+L S  
Sbjct: 57  TTHQNDAKGLKNDGQTTVELYGTTSSGGVIPG--------YHEDTVNFKDYYDQSLSSNI 108

Query: 121 TLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGL 180
           + ++F  YL SL P++RW+PHYN  W+Y D+VAG+TVGCVLVPQSMSYAQIA+L  QYGL
Sbjct: 109 SFSSFREYLISLFPVIRWIPHYNFAWMYGDVVAGVTVGCVLVPQSMSYAQIASLPAQYGL 168

Query: 181 YSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALL 240
           YSSF+GAFIYSFFATSKDVCIGPVAVMSL+TAK I+ V   LP+DTEIT P+IATAL+LL
Sbjct: 169 YSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLL 228

Query: 241 CGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKV 300
           CG I+              IS  AVAGFMTGSA +II GQ+PALMGYN+ VNTR +TYKV
Sbjct: 229 CGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKV 288

Query: 301 IINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRY---GSRRSRMWDNVFLY 357
           +IN+L+HLPDTKLDAVFGL+PL+ILY+WK+GC+T GP  V R     S R++ W + F Y
Sbjct: 289 VINTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFY 348

Query: 358 TQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIA 417
            QALRNA VIV+FT IAWG++    K      ISLL TVPSGLK+VGVMK P  L + +A
Sbjct: 349 AQALRNAFVIVLFTLIAWGITRHKKKH----PISLLNTVPSGLKNVGVMKFPDHLATNLA 404

Query: 418 PELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRS 477
           PELPA+ I+L+LEHIAI+KAFGR+NDY+VVPDQELIAIG TNL+GTFFNAYPATGSFSRS
Sbjct: 405 PELPAAAIILLLEHIAIAKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRS 464

Query: 478 ALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWS 537
           ALKAKCNV TPLSG+F+GACVLLA+YCLT AF +IPKATLSAVIIHAVSDLIASY+TTW+
Sbjct: 465 ALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWN 524

Query: 538 FWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEAR 597
           FW+++P D +CFLVTV IT+FSSIENGIYFA+CWS A+LLF+ AFP+GKFLGRV+++E  
Sbjct: 525 FWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSE-- 582

Query: 598 VTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDK 657
                                V     RE         SE+++  +  K K   SA    
Sbjct: 583 ---------------------VINPTVREDLGVVEDFDSENINVASSTKPKLGLSADNSS 621

Query: 658 LGKVEGHVTDGGSPRAPRFHTKWVPFD-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVN 716
           +            P   RFHTKW+P +  Y RE N  + V PPPPGVIV+RPSESWTY+N
Sbjct: 622 IST---------GPSRVRFHTKWIPLENNYGREYNSGIVVQPPPPGVIVYRPSESWTYIN 672

Query: 717 CSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPPKFLRKLFKSSS--EDLENR 774
           CSRQYD IFDEV RLTRRG      K S RPWNDPG+W PP FL+KLFK     E   + 
Sbjct: 673 CSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLFLKKLFKRGKRLEQELSP 732

Query: 775 AVARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKR 834
            + RDERPVL+++AMDWSQV Q+D+TG+Q L DLRKA+NKYADRQVEFHF+GII PW+KR
Sbjct: 733 ELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKR 792

Query: 835 GLINSGFGTVNDEFADESLLVGHKSCHIARSAEPTEDEESRLAH------PATGTNLPFF 888
            L+  GFGTVNDEFADESL++GH S HI ++    +DEE+ +         A+GTN+PFF
Sbjct: 793 ALVAVGFGTVNDEFADESLILGHSSYHIVKTRP--QDEENHIGQGRYNISAASGTNMPFF 850

Query: 889 HLELPDFSEW 898
           H+E+PDFS+W
Sbjct: 851 HVEMPDFSKW 860

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/896 (56%), Positives = 634/896 (70%), Gaps = 42/896 (4%)

Query: 23  SNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQXXXXXXXXXXXXXXXXXXXXX 82
           + D+  +LDDL+ EY Q+KN E++   +  DL S   A                      
Sbjct: 20  NTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKGVKGSKI------ 73

Query: 83  XKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHY 142
            +   P+      +++ +F E  V++ E+Y+ ++RS  TL    +YL+S+ PI+ WLPHY
Sbjct: 74  -EYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHY 132

Query: 143 NARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIG 202
           N  W   DL+AGIT+GCVLVPQSMSYAQ+ATL  QYGLYSSF+GA+ YSFFATSKDVCIG
Sbjct: 133 NFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIG 192

Query: 203 PVAVMSLQTAKAISHVVSSLPE-DTEITSPMIATALALLCGIISXXXXXXXXXXXXXXIS 261
           PVAVMSLQTAK I+ V +  P+ DT IT P+IAT LALLCGIIS              IS
Sbjct: 193 PVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELIS 252

Query: 262 STAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVP 321
             AVAGFMTGSA NI+ GQVPALMGYNKLVNTR +TYKV+I +L+HLPDTKLDAVFGL+P
Sbjct: 253 LNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIP 312

Query: 322 LVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNV---FLYTQALRNAVVIVVFTAIAWGMS 378
           L +LYVWKW C T GPRL  RY S+ +R+   V   + Y QA RN ++I+VFT I W ++
Sbjct: 313 LFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAIT 372

Query: 379 HRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAF 438
               K      IS+LG+VPSGLK+VGV  VPSGL+SK+ P LP+S+IVL+LEHIAISK+F
Sbjct: 373 RG--KSSSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSF 430

Query: 439 GRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACV 498
           GR+NDY+VVPDQELIAIG +NL+GTFFNAYPATGSFSRSALKAKCNV TPLSGLFSG+CV
Sbjct: 431 GRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCV 490

Query: 499 LLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVF 558
           LLA+YCLT AF +IPKATLSAVIIHAVSDL+ASY+TTW+FW+++P D +CF+VTV+ITVF
Sbjct: 491 LLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVF 550

Query: 559 SSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAE---ARVTNXXXXXXXXXXXXXXX 615
           +SIE+GIYFAMCWS A+LL + AFPAGKFLGRV+IAE   A V                 
Sbjct: 551 ASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRI 610

Query: 616 XT-AVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAP 674
            T   N E E+E +   ++ SS+ +      K  A+ S+               G PR  
Sbjct: 611 STLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSI-------------GQPRI- 656

Query: 675 RFHTKWVPFD-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTR 733
           ++HTKW+PFD +YTRELNP+V + PPP  V+V+R SES+TY+NCSR Y+ I DEV R TR
Sbjct: 657 KYHTKWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATR 716

Query: 734 RGRPQIVAKSSSRPWNDPGEWHPPKFLR--KLFKSSSEDLE------NRAV--ARDERPV 783
           RG+     K S RPWNDPG W  P FL+  K +K    DLE      N ++   RDERP+
Sbjct: 717 RGQIIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPL 776

Query: 784 LRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGT 843
           L+++ +D+SQVAQ D+T LQ+L DLRKA+N+YADRQVEFHF GII PWVKRGLI+ GFGT
Sbjct: 777 LKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGT 836

Query: 844 VNDEFADESLLVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899
           +N+E++DES++ GH S H+AR     E+ +    + A+GTNLPFFH+++PDF++WD
Sbjct: 837 INEEYSDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWD 892

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/895 (55%), Positives = 627/895 (70%), Gaps = 52/895 (5%)

Query: 29  DLDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQXXXXXXXXXXXXXXXXXXXXXXKPVAP 88
           DLDDL+ EY Q+KN E++ A    DL S                             +  
Sbjct: 26  DLDDLELEYDQYKNNENNGAFNDNDLESNSLTNHNTASEAKGVKGSKVEYFNTSDISL-- 83

Query: 89  AAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLY 148
                  +++ +F E  V+  E+Y  ++RS  TL    NYL+S+ PI+ WLPHYN  W  
Sbjct: 84  -----YDNSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYNVNWFI 138

Query: 149 QDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMS 208
            DL+AGIT+GCVLVPQSMSYAQ+ATL  QYGLYSSF+GA+ YSFFATSKDVCIGPVAVMS
Sbjct: 139 ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMS 198

Query: 209 LQTAKAISHVVSSLPE-DTEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAG 267
           LQTAK I+ V +  P+ DT IT P+IAT LALLCGIIS              IS  AVAG
Sbjct: 199 LQTAKVIADVTARYPDGDTTITGPIIATTLALLCGIISAAVGFLRLGFLVELISLNAVAG 258

Query: 268 FMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYV 327
           FMTGSA NI+ GQVPALMGYNKLVNTR +TYK++I+SL+HLPDT LDA FGL+PL ILY 
Sbjct: 259 FMTGSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPLFILYT 318

Query: 328 WKWGCSTGGPRLVQRYGSRRSRMWDNV---FLYTQALRNAVVIVVFTAIAWGMSHRALKE 384
           WKW C T GPRL  R+ S++ R+   V     Y QA RN ++I+VFT IAW ++    K 
Sbjct: 319 WKWWCGTYGPRLNDRFNSKKPRLHKIVKWTCFYAQASRNGIIIIVFTCIAWAITRG--KS 376

Query: 385 GGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDY 444
                IS+LG+VPSGLK+VGV  VP GL+SK+ P LPAS+IVL+LEHIAISK+FGRVNDY
Sbjct: 377 SADRPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDY 436

Query: 445 RVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYC 504
           +VVPDQELIAIG +NL+GTFFNAYPATGSFSRSALKAKCNV TPLSGLFSG+CVLLA+YC
Sbjct: 437 KVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYC 496

Query: 505 LTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENG 564
           LT AF +IPKATLSAVIIHAVSDL+ASY+TTW+FW+++P D +CF+VTV+ITVFSSIENG
Sbjct: 497 LTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFSSIENG 556

Query: 565 IYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNREKE 624
           IYFAMCWS A+ + + AFPAGKFLGRV+IAE  VT+                 A  R   
Sbjct: 557 IYFAMCWSCAIFILKVAFPAGKFLGRVEIAE--VTD-----------------AYVRADS 597

Query: 625 RETTFTAVSVSS-ESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGG--SPRA----PR-- 675
              +FT+ + +   +L     G+ +   +   +   K+E  V   G  SP A    PR  
Sbjct: 598 DSVSFTSENNNRISTLEEDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIK 657

Query: 676 FHTKWVPFD-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRR 734
           +HTKW+PFD +YT+ELNP+V + PPP GV+V+R SES+TY+NCSR Y+ I DE+ ++TRR
Sbjct: 658 YHTKWLPFDHKYTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRR 717

Query: 735 GRPQIVAKSSSRPWNDPGEWHPPKFLR--KLFKSSSEDLENRAVA--------RDERPVL 784
           G+     K S RPWNDPG W PP F +  K +K    D+E+   A        RD+RP+L
Sbjct: 718 GQLIRHRKKSDRPWNDPGPWEPPTFFKNLKFWKKKETDIESSENAVNNPTDAVRDDRPLL 777

Query: 785 RVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTV 844
           +++ +D+SQVAQ D+T LQ+L DLRKA+N+YADRQVEFHF GII PWVKRGLI+ GFGT+
Sbjct: 778 KILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTL 837

Query: 845 NDEFADESLLVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899
           N+E++DES++ GH S H+AR  +  E  +    + A+GTNLPFFH+++PDF++WD
Sbjct: 838 NEEYSDESIVAGHTSYHVARVPQNEETPDKYSVYTASGTNLPFFHIDIPDFAKWD 892

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score =  990 bits (2559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/899 (55%), Positives = 635/899 (70%), Gaps = 43/899 (4%)

Query: 20  RELSNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQXXXXXXXXXXXXXXXXXX 79
           +E +N  P DLDDL+ EY Q+KN E++D    +DL S   A+                  
Sbjct: 18  QETNNTVP-DLDDLELEYDQYKNNENNDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDY- 75

Query: 80  XXXXKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWL 139
                   P+      +++ +F E  V++ E+Y  ++RS  T+    +YL+S+ PI+ WL
Sbjct: 76  ------FNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWL 129

Query: 140 PHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDV 199
           PHYN  W   DL+AGIT+GCVLVPQSMSYAQ+ATL  QYGLYSSF+GA+ YSFFATSKDV
Sbjct: 130 PHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDV 189

Query: 200 CIGPVAVMSLQTAKAISHVVSSLPE-DTEITSPMIATALALLCGIISXXXXXXXXXXXXX 258
           CIGPVAVMSLQTAK I+ V +  P+ D+ IT P+IAT LALLCGIIS             
Sbjct: 190 CIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVE 249

Query: 259 XISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFG 318
            IS  AVAGFMTGSA NI+ GQVPALMGYN LVNTR +TYKV+I +L+HLPDTKLDAVFG
Sbjct: 250 LISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFG 309

Query: 319 LVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNV---FLYTQALRNAVVIVVFTAIAW 375
           L+PL +LYVWKW C T GPRL  RY S+  R+   +   + Y QA RN ++I+VFT I W
Sbjct: 310 LIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGW 369

Query: 376 GMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAIS 435
            ++    K      IS+LG+VPSGLK+VGV  VP GL+SK+ P LPAS+IVL+LEHIAIS
Sbjct: 370 AITRG--KSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAIS 427

Query: 436 KAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSG 495
           K+FGR+NDY+VVPDQELIAIG +NL+GTFFNAYPATGSFSRSALKAKCNV TPLSGLFSG
Sbjct: 428 KSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSG 487

Query: 496 ACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVI 555
           +CVLLA+YCLT AF +IPKATLSAVIIHAVSDL+ASY+TTW+FW+++P D +CF+VTV+I
Sbjct: 488 SCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLI 547

Query: 556 TVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAE---ARVTNXXXXXXXXXXXX 612
           TVF+SIE+GIYFAMCWS A+L+ + AFPAGKFLGRV++AE   A V              
Sbjct: 548 TVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENN 607

Query: 613 XXXXTAVNR-EKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSP 671
               T  +  E ++E++   V+ SS+ +      K   + S+   +             P
Sbjct: 608 NGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQ-------------P 654

Query: 672 RAPRFHTKWVPFD-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVR 730
           R  ++HTKW+PFD +YTRELNP+V + PPP GV+V+R SES+TY+NCSR Y+ I +EV +
Sbjct: 655 RI-KYHTKWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKK 713

Query: 731 LTRRGRPQIVAKSSSRPWNDPGEWHPPKFLRKL-----FKSSSEDLENRA-----VARDE 780
           +TRRG+     K S RPWNDPG W  P FL+ L      ++  E +EN       V RD+
Sbjct: 714 VTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDD 773

Query: 781 RPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSG 840
           RP+L+++ +D+SQVAQ D+T LQ+L DLRKA+N+YADRQVEFHF GII PWVKRGLI+ G
Sbjct: 774 RPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRG 833

Query: 841 FGTVNDEFADESLLVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899
           FGT+N+E++DES++ GH S H+AR  +  E+ E    + A+GTNLPFFH+++PDF++WD
Sbjct: 834 FGTLNEEYSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWD 892

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  989 bits (2557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/901 (55%), Positives = 631/901 (70%), Gaps = 47/901 (5%)

Query: 20  RELSNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQXXXXXXXXXXXXXXXXXX 79
           ++ SN  P DLDDL+ EY Q+KN E++DA    DL S   A+                  
Sbjct: 18  QDTSNTVP-DLDDLELEYDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEY- 75

Query: 80  XXXXKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWL 139
                   P+      +++ +F E  V++ E+Y  ++RS  TL    +YL+S+ PI+ WL
Sbjct: 76  ------FNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWL 129

Query: 140 PHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDV 199
           PHYN  W   DL+AGIT+GCVLVPQSMSYAQ+ATL  QYGLYSSF+GA+ YSFFATSKDV
Sbjct: 130 PHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDV 189

Query: 200 CIGPVAVMSLQTAKAISHVVSSLPE-DTEITSPMIATALALLCGIISXXXXXXXXXXXXX 258
           CIGPVAVMSLQTAK I+ V +  P+ D  IT P+IAT LALLCGIIS             
Sbjct: 190 CIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVE 249

Query: 259 XISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFG 318
            IS  AVAGFMTGSA NI+ GQVPALMGYN LVNTR +TYKV+I +L+HLPDTKLDAVFG
Sbjct: 250 LISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFG 309

Query: 319 LVPLVILYVWKWGCSTGGPRLVQRYGSRRSRM-----WDNVFLYTQALRNAVVIVVFTAI 373
           L+PL +LYVWKW C T GP L  RY S+  R+     W   + Y QA RN V+IVVFT I
Sbjct: 310 LIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKW--TYFYAQASRNGVIIVVFTCI 367

Query: 374 AWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIA 433
            W ++    K      IS+LG+VPSGLK+VGV  VPSGL+SK+ P LPAS+IVL+LEHIA
Sbjct: 368 GWAITRG--KSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIA 425

Query: 434 ISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLF 493
           ISK+FGR+NDY+VVPDQELIAIG +NL+GTFFNAYPATGSFSRSALKAKCNV TPLSGLF
Sbjct: 426 ISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLF 485

Query: 494 SGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTV 553
           SG+CVLLA+YCLT AF +IPKATLSAVIIHAVSDL+ASY+TTW+FW+++P D +CF+VTV
Sbjct: 486 SGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTV 545

Query: 554 VITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEAR----VTNXXXXXXXXX 609
           +ITVF+SIE+GIYFAMCWS A+LL + AFPAGKFLGRV+IAE        N         
Sbjct: 546 LITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSE 605

Query: 610 XXXXXXXTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGG 669
                  +    E E++++   ++ SS+ +      K+  + S+   +            
Sbjct: 606 NNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQ------------ 653

Query: 670 SPRAPRFHTKWVPFD-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEV 728
            PR  ++HTKWVPFD +YTRELNP++ + PPP GV+V+R SES+TY+NCSR Y+ I ++V
Sbjct: 654 -PRM-KYHTKWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKV 711

Query: 729 VRLTRRGRPQIVAKSSSRPWNDPGEWHPPKFLRKL-----FKSSSEDLENR-----AVAR 778
             +TRRG+     K S RPWNDPG W  P FL+ L      +S SE LEN         R
Sbjct: 712 KEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTER 771

Query: 779 DERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLIN 838
           D+RP+L+++ +D+SQVAQ D+T LQ+L DLRK +N+YADRQVEFHF GII PWVKRGL++
Sbjct: 772 DDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVS 831

Query: 839 SGFGTVNDEFADESLLVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEW 898
            GFGT+N+E++DES++ GH S H+AR  +  E+ +    + A+GTNLPFFH+++PDF++W
Sbjct: 832 RGFGTLNEEYSDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKW 891

Query: 899 D 899
           D
Sbjct: 892 D 892

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score =  986 bits (2548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/913 (55%), Positives = 629/913 (68%), Gaps = 44/913 (4%)

Query: 2   SNFQSSPGSKRESSFEVSRELSNDAPIDLDDLDAEYGQFKNAE-HSDATAGRDLTSEYGA 60
           ++F +  G++  ++ EVS      +  DLD+L+ EY Q+K  E H   T   +       
Sbjct: 15  NSFPNEYGAEYNNANEVS------STPDLDNLELEYDQYKADELHPQRTILSNQADTDRE 68

Query: 61  QXXXXXXXXXXXXXXXXXXXXXXKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTF 120
           +                      +    A   +    +  + E  VT  EF++ +LRS F
Sbjct: 69  KIANVFVEEQSVRDSNIPSASIEELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKF 128

Query: 121 TLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGL 180
           TL    NY+ S+ PI+ WLPHYN  W  QDL+AGITVGCVLVPQSMSYAQIATL PQYGL
Sbjct: 129 TLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGL 188

Query: 181 YSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALL 240
           YSSF+GAFIYS FATSKDVCIGPVAVMSL+TAK I+ V+   P D ++  P+IAT  ALL
Sbjct: 189 YSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALL 248

Query: 241 CGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKV 300
           CG I+              IS  AVAGFMTGSALNII+GQVPALMGY KLVNTRT+TYKV
Sbjct: 249 CGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKV 308

Query: 301 IINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRY---GSRRSRMWDNVFLY 357
           I+N+L+HLPDTKLDAVFGL+PL ILY W+W C+  GP+L  RY   GSR + +W   + Y
Sbjct: 309 IVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFY 368

Query: 358 TQALRNAVVIVVFTAIAWGMS-HRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKI 416
            QA R+ ++I+VFTAI+W ++ H   KE    RIS+LGTVP GLKDVG +KVP  L +KI
Sbjct: 369 AQASRSGIIIIVFTAISWSITRHVPSKE---RRISILGTVPKGLKDVGAIKVPPELPAKI 425

Query: 417 APELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSR 476
           APELPA+VIVL+LEHIAISK+FGR+NDY+VVPDQELIAIG TNLIGTFF+AYP TGSFSR
Sbjct: 426 APELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSR 485

Query: 477 SALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTW 536
           SALKAKCNV TPLSGLF+G+CVLLA+YCLT AF +IPKATLSAVIIH+VSDL+ASY TTW
Sbjct: 486 SALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTW 545

Query: 537 SFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEA 596
           +F++++P D VCFL T++ITVFSSIENGIYFA+CWS A+LLF+ AFPAGKFLGRV+IAE 
Sbjct: 546 NFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEV 605

Query: 597 RVTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTD 656
                                 +N      TT   VS    +   +       ++    D
Sbjct: 606 -----------------VDGEIINDNSVVMTTDDCVSEFGGNKEFSKDKLNGKSDFIVKD 648

Query: 657 KLGKVEGHVTDGGSPRAPRFHTKWVPFDR-YTRELNPEVFVAPPPPGVIVFRPSESWTYV 715
           KL       +   +    +++TKWVPFD  YTRELNP+V + PPPPGVIV+R S+S+TY+
Sbjct: 649 KLDSTAS--SSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYI 706

Query: 716 NCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPPKFLRKLF-------KSSS 768
           N S  YD I DE+ R+TRRG+     K S RPWNDPGEW PPKFL  +        K+ +
Sbjct: 707 NASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQT 766

Query: 769 EDLEN--RAVARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAG 826
            D+E+    + RDERPVL+V+ +D+SQVAQVDST LQ+L DLRKAVN YADRQVEFHFAG
Sbjct: 767 ADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAG 826

Query: 827 IIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIARSAEPTEDEESRLAHPATGTNLP 886
           II PW+KRGL+  GFGTVN+EF+DES++ GH S H+ ++    + E       ATGTNLP
Sbjct: 827 IISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNT-IGDIENGYQVKTATGTNLP 885

Query: 887 FFHLELPDFSEWD 899
           FFH+++PDF +WD
Sbjct: 886 FFHIDIPDFKKWD 898

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/944 (52%), Positives = 640/944 (67%), Gaps = 67/944 (7%)

Query: 1   MSNFQSSPGSKRESSFEVSREL------------SNDAPIDLDDLDAEYGQFKNAEHSDA 48
           MS    +P + RES  ++S +             S ++  +LDDL+ EY Q+K +E ++ 
Sbjct: 1   MSGTNGNPFNTRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETNNN 60

Query: 49  TAGRDLTSEYGA------QXXXXXXXXXXXXXXXXXXXXXXKPVAPAAPGNVPSALYEFH 102
               +  +          +                      + V+   P  +P+    + 
Sbjct: 61  DDVINNNNNNNNNNNNIPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPN----YD 116

Query: 103 ERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLV 162
           E+ V++ ++Y  ++R   TL    +Y  S+ PI RWLPHYN  W   DL+AGITVGCVLV
Sbjct: 117 EKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLV 176

Query: 163 PQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSL 222
           PQSMSYAQIATL  QYGLYSSF+GAF YS FATSKDVCIGPVAVMSL+TAK ++ V++  
Sbjct: 177 PQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKY 236

Query: 223 PE-DTEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQV 281
           P+ D  IT+P++ATAL+LLCGI++              IS  AV GFMTGSALNI+ GQV
Sbjct: 237 PDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQV 296

Query: 282 PALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQ 341
           P LMGYN  VNTRT+ YKVII +L+HLPDTKLDAVFGL+PL +LY+WKW C   GP+LV 
Sbjct: 297 PGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVD 356

Query: 342 RY-----GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTV 396
           ++       R +  +   + Y QA +NA++I+VFTAI+W ++    K      IS+LGTV
Sbjct: 357 KWFPKNKNERANFYFKKFYFYAQAAKNAIIIIVFTAISWSITRG--KAKADRPISILGTV 414

Query: 397 PSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIG 456
           P GLK+VGVMK+P GLLSK+APELPASVIVL+LEHIAI+K+FGR+NDY+VVPDQELIAIG
Sbjct: 415 PKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIG 474

Query: 457 ATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKAT 516
            TNLIGTFFNAYPATGSFSRSALKAKC V TPLSG+F+GACVLLA+YCLT AF +IPKAT
Sbjct: 475 VTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKAT 534

Query: 517 LSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVL 576
           LSAVII AVSDLIASYK TW+FW+++P D +CFLVTV ITVFSSIENGIYFA+CWS A+L
Sbjct: 535 LSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAIL 594

Query: 577 LFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSS 636
           L +  FPAGKFLGR+++AE  V +                +A +   + ET    +  +S
Sbjct: 595 LLKVCFPAGKFLGRIEVAE--VIDGYVDNSIESATTAEYSSASSPSSDNETDTKKIQKTS 652

Query: 637 ESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFDR-YTRELNPEVF 695
            S+S     KA A +++  D   KV             R++TKWVPFD  YTRELNP V 
Sbjct: 653 -SISFGKDAKAVAVSTSPVDCNPKV-------------RYYTKWVPFDHAYTRELNPSVN 698

Query: 696 VAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWH 755
           + PPPPGVIV+R ++S+TY+NCSR YD IFDEV R TRRG+     K + RPWNDPGEW 
Sbjct: 699 ILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWE 758

Query: 756 PPKFLRKLF---------KSSSEDLENRAVARDERPVLRVIAMDWSQVAQVDSTGLQTLQ 806
            P+FL+ LF         + S+ D+ + +  RD RP+L+++ +D+SQVAQ+D++ +Q+L 
Sbjct: 759 APQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLV 818

Query: 807 DLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIARSA 866
           DLRK++N+YADRQVEFHFAGI+ PWVKRGLIN GFGT+NDEF+D S++ GH S H+ R+ 
Sbjct: 819 DLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTL 878

Query: 867 EPTE-DEESRL----------AHPATGTNLPFFHLELPDFSEWD 899
             ++ D ES               ATGTNLPFFH+++PDFS+WD
Sbjct: 879 PDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWD 922

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/811 (59%), Positives = 589/811 (72%), Gaps = 44/811 (5%)

Query: 100 EFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGC 159
            + E  V   + Y + LR   T +    YL SL P+++W+ HYN  WLY DLVAGITVGC
Sbjct: 111 NYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKWVHHYNFNWLYNDLVAGITVGC 170

Query: 160 VLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVV 219
           VLVPQSMSYAQIATL  QYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSL+TAK I+ V+
Sbjct: 171 VLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVL 230

Query: 220 SSLPEDT-EITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIA 278
             + ED  EIT+P+IAT L+L+CG ++              IS  AVAGFMTGSA+NI++
Sbjct: 231 EKVGEDNPEITAPIIATTLSLICGGVALGVGLLRLGFLVEFISLNAVAGFMTGSAINIMS 290

Query: 279 GQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPR 338
           GQVP LMGY+K VNTR STYKVIIN+L+HLPDTKLDAVFGL+PL ILY WK+ C T GP+
Sbjct: 291 GQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVFGLIPLFILYSWKYFCGTLGPK 350

Query: 339 LVQRYGSR----RSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLG 394
           LV RY +R    R+  +  +  Y QALRNA VI++FT I+WG++    KE     ISLLG
Sbjct: 351 LVDRYVARSDVKRAAAYKYILFYLQALRNAFVIIIFTLISWGITRHKAKE--DLPISLLG 408

Query: 395 TVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIA 454
           TVPSGLK+VGVMK+P GL+S +A ELP+++I+LVLEHIAISKAFGRVN Y+VVPDQELIA
Sbjct: 409 TVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIAISKAFGRVNGYKVVPDQELIA 468

Query: 455 IGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPK 514
           IG TNLI TFFNAYPATGSFSRSALKAKCNV TPLSG+F+GACVLL++YCLT AF FIPK
Sbjct: 469 IGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIFTGACVLLSLYCLTDAFYFIPK 528

Query: 515 ATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVA 574
           A LSA+IIHAVSDL+ASYKTTW+FW ++P D VCF+VTV+IT+FSSIENGIYFA+CWS A
Sbjct: 529 AALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVIITIFSSIENGIYFAVCWSCA 588

Query: 575 VLLFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSV 634
           +LL +  FP G+FLG V+I +  V+N                       E +     + +
Sbjct: 589 LLLLKVVFPTGQFLGYVEICQ--VSNA----------------------EVDENIDRIVL 624

Query: 635 SSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPF-DRYTRELNPE 693
           S +S   T        N+A   K+G V     +       ++HTKW+P  + Y RELNP+
Sbjct: 625 SEDSQPKTIEDNVTKNNTAV--KVGVV---ANESFGHSQLQYHTKWLPLNNHYQRELNPD 679

Query: 694 VFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGE 753
           V V  PPPGVIV+RPSESWTYVNCSRQYD IFD V  LTR G+         + WNDPGE
Sbjct: 680 VVVQAPPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVSKHDKMWNDPGE 739

Query: 754 WHPPKFLRKLFK-SSSEDLENRAVARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAV 812
           W PP  ++KLFK  +  DLE   V  DERPVL+++AMDWSQV Q+DSTG+Q L DLRKA+
Sbjct: 740 WEPPFLVKKLFKLGNKHDLEGGEVI-DERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAI 798

Query: 813 NKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIARSAEPTEDE 872
           NKYA+RQVEFHF+GII PW+KR LIN+GFGTVN+EF+DES++VGH S  + ++    +D 
Sbjct: 799 NKYANRQVEFHFSGIISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSLVKNRPDLQDP 858

Query: 873 ESRLAHP-----ATGTNLPFFHLELPDFSEW 898
           E+ L  P     A G NLPFFHLE+P+F +W
Sbjct: 859 EAALPEPIALHTALGVNLPFFHLEMPEFHKW 889

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/827 (59%), Positives = 592/827 (71%), Gaps = 74/827 (8%)

Query: 101 FHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCV 160
           + E  VT+ E+Y  +++++ T  +  NY+ SL PI++WLPHYN  W Y DLVAGITVGCV
Sbjct: 69  YEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAGITVGCV 128

Query: 161 LVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVS 220
           LVPQSMSYAQIA+LSP+YGLYSSFVGAFIYS FATSKDVCIGPVAVMSLQTAK I+ V+ 
Sbjct: 129 LVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLK 188

Query: 221 SLPED-TEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAG 279
             P+D TE+T P+IATAL LLCGI++              IS  AVAGFMTGSA +II G
Sbjct: 189 KYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSAFSIIWG 248

Query: 280 QVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRL 339
           QVPALMGYNKLVNTR STYKV+IN+L+HLP+TKLDAVFGL+PLVILYVWKW C T G  L
Sbjct: 249 QVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCGTYGITL 308

Query: 340 VQRYGSRRSRMWDNV---FLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTV 396
             R+     ++ +N+   + Y QA+RNAVVIVVFTAI+W ++     E     IS+LGTV
Sbjct: 309 ANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASE--DRPISILGTV 366

Query: 397 PSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIG 456
           PSGL +VGVMK+P GLLS ++ ELPAS+IVLVLEHIAISK+FGR+NDY+VVPDQELIAIG
Sbjct: 367 PSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAIG 426

Query: 457 ATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKAT 516
            TNL+GTFF++YPATGSFSRSALKAKCNV TP SGLF+G CVLLA+YCLT AF FIPKAT
Sbjct: 427 VTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFFIPKAT 486

Query: 517 LSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVL 576
           LSAVIIHAVSDL+ SY+TTW+FW+ +P D V F+VTV ITVFSSIENGIYFAMCWS A+L
Sbjct: 487 LSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCWSCAIL 546

Query: 577 LFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSS 636
           L + AFPAG+FLGRV++AE                      ++N   ++  T   V  SS
Sbjct: 547 LLKQAFPAGRFLGRVEVAE--------ILNPTLQNNVSAVVSLNESNKQVKTTVDVLRSS 598

Query: 637 ESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFDR-YTRELNPEVF 695
           E                                     RF TKWVPFD  Y+RELN    
Sbjct: 599 EY------------------------------------RFTTKWVPFDHEYSRELNRCAK 622

Query: 696 VAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWH 755
           + PPPPGVIV+R S+S+TYVNCSR YD IFD V   TRRG+   + K S RPWNDPGEW 
Sbjct: 623 ICPPPPGVIVYRLSDSFTYVNCSRHYDIIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWK 682

Query: 756 PPKFLRKLF----KSSSEDLE----NRAVARD--ERPVLRVIAMDWSQVAQVDSTGLQTL 805
            P  L+ LF    KS +E+ E    N +  R   E+P+L+VI +D+SQVAQVDST +Q+L
Sbjct: 683 MPTSLKTLFRFKRKSVTENEEPSVSNGSTNRGSYEKPLLKVICLDFSQVAQVDSTAIQSL 742

Query: 806 QDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIARS 865
            DLRKAVNKYADRQVEFHFAGII PW+KR L +  FGTVN+E++DES++ GH S H+ + 
Sbjct: 743 VDLRKAVNKYADRQVEFHFAGIISPWIKRSLSSVDFGTVNEEYSDESVIAGHSSVHVTKF 802

Query: 866 AEPTE----DEESRLAHP---------ATGTNLPFFHLELPDFSEWD 899
           +   +    DEES ++ P         ATGTNLPFFH+++PDFS+WD
Sbjct: 803 SSDDDADYTDEESHISAPYSNYGTLCAATGTNLPFFHIDIPDFSKWD 849

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/903 (54%), Positives = 620/903 (68%), Gaps = 76/903 (8%)

Query: 25  DAPIDLDDLDAEYGQFKNAEH--SDATAGRDLTSEYGAQXXXXXXXXXXXXXXXXXXXXX 82
           D+   LDDL+AEY  +K  E    +         +YG +                     
Sbjct: 12  DSAFKLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYG------ 65

Query: 83  XKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHY 142
             P   A  GN+P     F E  V+V ++Y+Q +R   TL +  +Y+ SL PI++W PHY
Sbjct: 66  -SPGPEAIGGNIPG----FEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHY 120

Query: 143 NARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIG 202
           N  W Y DLVAGITVGCVLVPQSMSYAQIA+L PQYGLYSSF+GAFIYS FATSKDVCIG
Sbjct: 121 NLTWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIG 180

Query: 203 PVAVMSLQTAKAISHVVSSLPE-DTEITSPMIATALALLCGIISXXXXXXXXXXXXXXIS 261
           PVAVMSLQTAK I+ V +  PE D  +T+P+IATAL+LLCGI++              IS
Sbjct: 181 PVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELIS 240

Query: 262 STAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVP 321
             AVAGFMTGSA NI+ GQVPALMGY+  VNTR STYKV+I+SL+HLPDTKLDAVFGLVP
Sbjct: 241 LNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVP 300

Query: 322 LVILYVWKWGCSTGGPRLVQR---YGSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMS 378
           L +LY+WKW C T GP+L  R   +  ++ R+    + Y+ A+RNAV+I+VFTAI+W ++
Sbjct: 301 LCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRIT 360

Query: 379 HRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAF 438
               KE     I +LGTVPSGL+DVGV K+P GLL+K+AP++PAS+IVL+LEHIAISK+F
Sbjct: 361 KNKDKE--HRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSF 418

Query: 439 GRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACV 498
           GR+NDY+VVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKC V TP SG+F+G CV
Sbjct: 419 GRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCV 478

Query: 499 LLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVF 558
           L+AIYCLT AF FIP ATLSAVIIHAVSDL+ASYKTTW+FW+++P D   F+VTV+ITVF
Sbjct: 479 LVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVF 538

Query: 559 SSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTA 618
           SSIENGIYFAMCWS A+LL + AFPAG+FLGRV++AE  V N                  
Sbjct: 539 SSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAE--VIN----------------PT 580

Query: 619 VNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHT 678
           V  + E      A+S++ +              S G  K  K +       S    +FH+
Sbjct: 581 VVEDVE------AISINDQ-----------IEGSVGKSKSLKADKGAISASSGSNYKFHS 623

Query: 679 KWVPFDR-YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRP 737
           KWV     Y RELNP+V + PPPPGV+V+R S+S+TY+NCSR YD IFD + + TRRG+ 
Sbjct: 624 KWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQL 683

Query: 738 QIVAKSSSRPWNDPGEWHPPKFLRKLF---KSSSEDLENRAV------ARDERPVLRVIA 788
             + K S RPWNDPGEW     ++K F   K +  D+E++         RDERP+L++I 
Sbjct: 684 LHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAIDNTRDERPLLKIIC 743

Query: 789 MDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEF 848
           +D+SQV QVDST +Q+L DLRKAV+KYADRQVEFHF GII  WVKR L++ GFGTVN  +
Sbjct: 744 LDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASY 803

Query: 849 ADESLLVGHKSCHIARSAEPTEDE------------ESRLAHPATGTNLPFFHLELPDFS 896
           +DES++ GH S HIA++ +P  D+            +S+  + ATGTN+PFFHL++PDFS
Sbjct: 804 SDESIIAGHSSYHIAKTTKPLADDFTTDSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFS 863

Query: 897 EWD 899
           +WD
Sbjct: 864 KWD 866

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/831 (57%), Positives = 603/831 (72%), Gaps = 66/831 (7%)

Query: 93  NVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLV 152
           NVP     + E  VT+ E+Y+ ++R   T  +F NYL S+ PI++WLP YN +WL  DL+
Sbjct: 77  NVP----RYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLI 132

Query: 153 AGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTA 212
           AGIT+GCVLVPQSMSYAQIATL PQYGLYSSFVGA+ YS FATSKDVCIGPVAVMSLQTA
Sbjct: 133 AGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTA 192

Query: 213 KAISHVVSSLPED--TEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMT 270
           K I HV SSL E+  T IT+P+IAT LALLCGIIS              IS  AV GFMT
Sbjct: 193 KVIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMT 252

Query: 271 GSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKW 330
           GSALNII+GQVPALMGY   VNTR +TYKVIIN+L+HLPDTK+DA+FGL+PLVILY WKW
Sbjct: 253 GSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKW 312

Query: 331 GCSTGGPRLVQRY--GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSA 388
             S+ GP+LV RY   S+  +     + Y  A+R+ ++I+V T+I+W ++    K     
Sbjct: 313 WFSSMGPKLVDRYYPNSKYKKYIKAFYFYGNAMRSGIIIIVMTSISWSVTRG--KSKSER 370

Query: 389 RISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVP 448
            IS+LGTVPSGL++VGV   P+GLL+K+APELP+S+IVL+LEHIAI+K+FGRVNDY+VVP
Sbjct: 371 PISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVP 430

Query: 449 DQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSA 508
           DQELIAIG +NLIGTFFN+YP TGSFSRSALKAKCNV TPLSG+F+G+CVLLA+YCLT A
Sbjct: 431 DQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGA 490

Query: 509 FKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFA 568
           F +IPKATLSAVIIHAVSDL+ASYKTTWSFW+++P D +CF+ TV ITVF+SIE+GIYF 
Sbjct: 491 FFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFT 550

Query: 569 MCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNREKERETT 628
           MCWS A+LLF+ AFPAGKFLG V+IAE  + N                  V+ +   E  
Sbjct: 551 MCWSAAILLFKVAFPAGKFLGYVKIAE--IVNPE---------------IVDSDYLVEKA 593

Query: 629 FTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFDR-YT 687
            T+V  S+  ++   P K + +  +      ++             ++H KW+P+D  YT
Sbjct: 594 ETSVQYSTVLMN---PEKGELSYLSSKSSESQL-------------KYHIKWIPYDHAYT 637

Query: 688 RELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRP 747
           +E+NP V V PPP GVIV+R +ES+TY+NCSR Y+ ++D+V  LTR G+     K S RP
Sbjct: 638 KEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRP 697

Query: 748 WNDPGEWHPPKFLRKLF---KSSSED-----LENRAVARDERPVLRVIAMDWSQVAQVDS 799
           WNDPG+W PPKFL+ +    K+ ++D      +N+ V  D RP+L++I +D+SQVAQ DS
Sbjct: 698 WNDPGDWKPPKFLKNIINWRKNKNKDDEPTTFDNKVV--DTRPILKIICLDFSQVAQTDS 755

Query: 800 TGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKS 859
           T LQ+L DLR+A+NKYADRQVEFHF+GI+ PWVK+GL+N GFGTVN E++DES+++GH S
Sbjct: 756 TALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTS 815

Query: 860 CHIARS-----------AEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899
            H+ ++            EP ++  S   H  TGTN PFFH+E+PDFS+W+
Sbjct: 816 YHVVKTEDLENNPMTTVEEPNQN-SSYYIHAGTGTNFPFFHIEIPDFSKWN 865

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/882 (53%), Positives = 604/882 (68%), Gaps = 73/882 (8%)

Query: 29  DLDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQXXXXXXXXXXXXXXXXXXXXXXKPVAP 88
           +LDDL+ E+ Q+K  E         LT     Q                         + 
Sbjct: 14  NLDDLEQEFNQYKKIE---------LTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIFSL 64

Query: 89  AAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLY 148
                VP+    + E  +T+ ++Y+ +LR  FT  T T+Y++SL PI  WLPHYN  W  
Sbjct: 65  TQQQQVPT----YEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFI 120

Query: 149 QDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMS 208
            DL+AGITVGCVLVPQSMSYAQIATLSPQ+GLYSSF+GAF YS FATSKDVCIGPVAVMS
Sbjct: 121 SDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMS 180

Query: 209 LQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGF 268
           LQTAK I+ V   LP DT+IT+  IAT LALLCGII+              IS  AVAGF
Sbjct: 181 LQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGF 240

Query: 269 MTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVW 328
           MTGSALNII+GQVP LMGYN  VNTRTSTYKVII++L+HLPDTKLDAVFGL+PL +L+ W
Sbjct: 241 MTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAW 300

Query: 329 KWGCSTGGPRLVQRY-----GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALK 383
           KW C   GPRL +R+       R  R+  N + Y Q  +NA++I+VFT I+W ++     
Sbjct: 301 KWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTS 360

Query: 384 EGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVND 443
           E  +  IS+LG+VP GLKDV    VPSGL++K+APELPAS+IVL+LEHIAI+K+FGR+ND
Sbjct: 361 E--TRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRIND 418

Query: 444 YRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIY 503
           Y++VPDQE++AIG TNL+GTFF+AYPATGSFSRSALKAKCNV TPLSGLFSGACVLLA+Y
Sbjct: 419 YKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALY 478

Query: 504 CLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIEN 563
           CLT AF +IPKATL AVIIHAVS+LIASYK T +FW+++P D  CFLVTV+ITVF+SIE+
Sbjct: 479 CLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIED 538

Query: 564 GIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNREK 623
           GIYFAMCWSVAVLLF+ AFP GKFLG+++I E                         +  
Sbjct: 539 GIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEV---------------------LDGKLV 577

Query: 624 ERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPF 683
              +  T+   +SE L  T  G +    S   +                   ++TKWVPF
Sbjct: 578 GDSSVLTSSDENSEILPTTKAGYSVEVVSNHNEN----------------TNYYTKWVPF 621

Query: 684 D-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAK 742
           D  YT+ELNP+  + PPPPGVIV+R ++S+TY+NCSR +D +FDE+ R T+RG+   + +
Sbjct: 622 DFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMR 681

Query: 743 SSSRPWNDPGEWHPPKFLRKL-----FKSSSEDLENRAVARDERPVLRVIAMDWSQVAQV 797
            S RPWNDPG+W P  F++K      +   + D+E+R +  D+RP L++I +D+SQV+Q+
Sbjct: 682 KSDRPWNDPGKWEPRVFIKKYLRRENYDEDNVDIEDRVI--DDRPFLKIICLDFSQVSQI 739

Query: 798 DSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGH 857
           D+T +Q L DLRK+VNKYADRQVEFHF GII PW+K+ L N GFGT+N+E++DES+++GH
Sbjct: 740 DATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGH 799

Query: 858 KSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899
            S H+ +  +  +         ATGTNLPFFH+++P+F++WD
Sbjct: 800 SSYHLTKDVDGIK--------AATGTNLPFFHIDIPNFNKWD 833

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/929 (53%), Positives = 634/929 (68%), Gaps = 61/929 (6%)

Query: 5   QSSPGSKRESS---FEVSREL-----SNDAPIDLDDLDAEYGQFKNAE-HSDATAGRDL- 54
           Q+ P  K E++    E   EL     S+ +  +L DL+ EY Q+K +E ++ +  G DL 
Sbjct: 3   QTIPFQKNENNTNDIENQYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLE 62

Query: 55  TSEYGAQXXXXXXXXXXXXXXXXXXXXXXKPVAPAAPGNVPSALYEFHERPVTVGEFYSQ 114
           T+    Q                         A +    +PS    F E  ++  ++Y  
Sbjct: 63  TNNLDVQFSNTYNTGDKKNSIKNHQIQINTFNADSVI--IPS----FEEHAISFKDYYRH 116

Query: 115 NLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATL 174
           +L+  F+L +   Y  S+ PI+RWLPHYN  W   DL+AGITVGCVLVPQSMSYAQIATL
Sbjct: 117 SLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATL 176

Query: 175 SPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPE-DTEITSPMI 233
            PQYGLYSSF+GAF YS FATSKDVCIGPVAVMSL+T K I+ V++  PE D  IT+P+I
Sbjct: 177 PPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVI 236

Query: 234 ATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNT 293
           AT LA LCG+I+              IS  AV GFMTGSALNI+ GQ+PALMGY   VNT
Sbjct: 237 ATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNT 296

Query: 294 RTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSR---M 350
           RTSTYKVII SL+HLPDTKLDAVFGL+PL ILY+WKW C   GPR+  ++ +   +    
Sbjct: 297 RTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFY 356

Query: 351 WDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPS 410
               + Y QA +NAV+I+VFTAIAW ++    K+     IS+LG+VP GLK+VGVMK+P 
Sbjct: 357 LKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKD--ERPISILGSVPKGLKEVGVMKLPD 414

Query: 411 GLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPA 470
           GL SKIAPELPASVIVL+LEHIAI+K+FGR+NDY+VVPDQELIAIG TNLIGTFFNAYPA
Sbjct: 415 GLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPA 474

Query: 471 TGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIA 530
           TGSFSRSALKAKC V TPLSGLF+G+CVLLA+YCLT  F +IPKATLSAVIIHAVSDLIA
Sbjct: 475 TGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIA 534

Query: 531 SYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGR 590
           SY TTW+FW+++P D   F+VTV ITVFSSIENGIYFAMCWS A+L+ + AFPAGKFLGR
Sbjct: 535 SYHTTWNFWKMNPLDCFSFIVTVFITVFSSIENGIYFAMCWSCAILVLKVAFPAGKFLGR 594

Query: 591 VQIAEARVTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSSESLSHTAPGKAKAA 650
           V+IAE  V N                     E    ++ + +S+S+++++H    K    
Sbjct: 595 VEIAE--VVNGCVDDSF--------------EVTDYSSNSNLSLSADTINHNKKLKILHI 638

Query: 651 NSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFDR-YTRELNPEVFVAPPPPGVIVFRPS 709
               T K  ++   ++        R++TKW+PFD  YT+ELNP V + PPPPGVIV+R +
Sbjct: 639 PLLKTLK-DQLFSDISSIQGKSKIRYYTKWLPFDHAYTKELNPNVIILPPPPGVIVYRLT 697

Query: 710 ESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPPKF---LRKL-FK 765
           +S+TY+NCS+ YD IF+E+ + T+RG+     K S RPWNDPGEW  P F    +KL F+
Sbjct: 698 DSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPNFSKLWKKLSFR 757

Query: 766 SSSEDLENRAV--------ARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYAD 817
            +  + +N            RD+RP+L+V+ +D+SQVAQVD+T LQ+L DLRKA+NKYAD
Sbjct: 758 RNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYAD 817

Query: 818 RQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIARSAEPTEDEE---- 873
           RQVEFHFAGI+ PW+K+GLIN GFGT+N+E++DES++ GH S H+AR   P +D E    
Sbjct: 818 RQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLARI--PGDDLELPTM 875

Query: 874 ---SRLAHPATGTNLPFFHLELPDFSEWD 899
              +   + ATGTNLPFFH+++PDF +WD
Sbjct: 876 RGGNYKVYTATGTNLPFFHIDIPDFYQWD 904

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/916 (54%), Positives = 618/916 (67%), Gaps = 84/916 (9%)

Query: 11  KRESSFEVSRELSNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQXXXXXXXXX 70
           K+ S    +  L N    D++  ++EY  ++ +E   A   RD       Q         
Sbjct: 4   KKNSHKSSTEVLDNQEDTDIEVFESEYRTYRESE---AAENRDNFQNGDDQSWKINGKQK 60

Query: 71  XXXXXXXXXXXXXKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLR 130
                          V+  A  ++P+    + E  VT+ E+Y  +++S+ T+ +  +YL 
Sbjct: 61  YEVTK--------SEVSDVAYDSIPA----YEESTVTLKEYYDHSIKSSLTVKSAGDYLY 108

Query: 131 SLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIY 190
           SL PI++WLPHYN  W Y DLVAGITVGCVLVPQSMSYAQIA+LSP+YGLYSSF+GAFIY
Sbjct: 109 SLFPIIKWLPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIY 168

Query: 191 SFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPE-DTEITSPMIATALALLCGIISXXXX 249
           S FATSKDVCIGPVAVMSLQTAK I+ V+   PE  TE+T P+IATAL  LCG++S    
Sbjct: 169 SLFATSKDVCIGPVAVMSLQTAKVIAEVLKKYPEGQTEVTGPIIATALCFLCGVVSTALG 228

Query: 250 XXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLP 309
                     IS  AVAGFMTGSA +II GQ+PALMGYN LVNTR +TYKV+IN+L+HLP
Sbjct: 229 VLRLGFLVELISLNAVAGFMTGSAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLP 288

Query: 310 DTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNV---FLYTQALRNAVV 366
           +TKLDAVFGL+PLVILYVWKW C T G  L  RY   + ++ + +   + Y QA+RNAVV
Sbjct: 289 NTKLDAVFGLIPLVILYVWKWWCGTFGITLADRYYRNQPKIANRLKSFYFYAQAMRNAVV 348

Query: 367 IVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIV 426
           I+VFTAI+W ++    K      IS+LGTVPSGL +VGVMK+P GLLS ++ ELPAS+IV
Sbjct: 349 IIVFTAISWRITRN--KSSKERPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIV 406

Query: 427 LVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVS 486
           LVLEHIAISK+FGR+NDY+V+PDQELIAIG TNLIGTFF++YPATGSFSRSALKAKCNV 
Sbjct: 407 LVLEHIAISKSFGRINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVR 466

Query: 487 TPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDL 546
           TP SG+F+GACVLLA+YCLTSAF FIPKATLSAVIIHAVSDL+ SYKTTW FW+ +P D 
Sbjct: 467 TPFSGIFTGACVLLALYCLTSAFFFIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDC 526

Query: 547 VCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNXXXXXX 606
           + F+ TV ITVFSSIENGIYFAMCWS A+LL + AFPAGKFLGRV++AE  V N      
Sbjct: 527 ISFIATVFITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAE--VLNPTV--- 581

Query: 607 XXXXXXXXXXTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVT 666
                              +    AV+ S+E      P +      +  D L   E    
Sbjct: 582 -------------------QEGINAVTSSNE-----LPNELSKQVKSTVDVLPAPEY--- 614

Query: 667 DGGSPRAPRFHTKWVPFDR-YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIF 725
                   +F  KW+PFD  Y+RELN    V PPPPGVIV+R ++S+TYVNCSR YD IF
Sbjct: 615 --------KFSVKWIPFDHDYSRELNRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDIIF 666

Query: 726 DEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPPKFLRKLF----KSSSEDLE------NRA 775
           D +   TRRG+   + K S RPWNDPGEW  P   + LF    KS++ D E         
Sbjct: 667 DRIKEETRRGQLISLRKKSDRPWNDPGEWKMPNSFKALFKFKRKSATTDNELPVSSGRNN 726

Query: 776 VARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRG 835
               E+P+L+V+ +D+SQVAQVDST +Q+L DLRKAVNKYADRQVEFHFAGII PW+KR 
Sbjct: 727 QESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRS 786

Query: 836 LINSGFGTVNDEFADESLLVGHKSCHIARSAEPTED---EESRLAH---------PATGT 883
           L++  FGT N+E++D+S++ GH S H+A+  +   D   E+SR++           ATGT
Sbjct: 787 LLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTEEDSRISTSYSNYETLCAATGT 846

Query: 884 NLPFFHLELPDFSEWD 899
           NLPFFH+++PDFS+WD
Sbjct: 847 NLPFFHIDIPDFSKWD 862

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/828 (57%), Positives = 591/828 (71%), Gaps = 73/828 (8%)

Query: 101 FHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCV 160
           + E  VT+ ++Y   ++   TL +  +YL SL PI++WLPHYN  W Y DLVAGITVGCV
Sbjct: 79  YEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVAGITVGCV 138

Query: 161 LVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVS 220
           LVPQSMSYAQIA+LSP+YGLYSSF+GAFIYS FATSKDVCIGPVAVMSLQTAK I+ V+ 
Sbjct: 139 LVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLK 198

Query: 221 SLPED-TEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAG 279
             PED  E+T P+IAT L LLCG+++              IS  AVAGFMTGSA +II G
Sbjct: 199 KYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGSAFSIIWG 258

Query: 280 QVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRL 339
           Q+PALMGYNKLVNTR +TYKV+IN+L+HLP+TKLDAVFGL+PLVILY+WKW C + G +L
Sbjct: 259 QIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWCGSFGIKL 318

Query: 340 VQRYGSRRSRMWDNV---FLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTV 396
           V R+ S + +  + +   + Y QA+RNAVVI+VFTAI++ ++    KE     IS+LGTV
Sbjct: 319 VDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKE--KRPISILGTV 376

Query: 397 PSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIG 456
           PSGL +VGVMK+P GLLS ++ ELPAS+IVLVLEHIAISK+FGR+NDY+V+PDQELIAIG
Sbjct: 377 PSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELIAIG 436

Query: 457 ATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKAT 516
            TNLIGTFF++YPATGSFSRSALKAKCNV TP SG+F+GACVLLA+YCLTSAF +IPKAT
Sbjct: 437 VTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFFYIPKAT 496

Query: 517 LSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVL 576
           LSAVIIHAVSDL+ASY+TTW+FW+++P D + F+VTV+ITVFSSIENGIYFAMCWS A+L
Sbjct: 497 LSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMCWSCAML 556

Query: 577 LFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSS 636
           L + AFPAGKFLGRV++AE                                         
Sbjct: 557 LLKQAFPAGKFLGRVEVAEV---------------------------------------- 576

Query: 637 ESLSHTAPGKAKAANSAGT--DKLGKVEGHVTDGGSPRAPRFHTKWVPFDR-YTRELNPE 693
             L+ T  G   +  S     ++  K      D       +F  KWVPFD  YTRELN  
Sbjct: 577 --LNPTIQGHIDSIVSPNESPNEFSKQVKSSVDALPSSEYKFSVKWVPFDHAYTRELNSY 634

Query: 694 VFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGE 753
             V PPPPGVIV+R S+S+TYVNCSR YD IFD +   TRRG+   + K S RPWNDPGE
Sbjct: 635 TRVRPPPPGVIVYRFSDSFTYVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWNDPGE 694

Query: 754 WHPPKFLRKLFK------SSSEDL----ENRAVARDERPVLRVIAMDWSQVAQVDSTGLQ 803
           W  P   + +F+      + + +L    +N      E+P+L+V+ +D+SQVAQVDST +Q
Sbjct: 695 WKLPNSFKNIFRVKRGLATKNSELPAVNDNTNSESYEKPLLKVVCLDFSQVAQVDSTAVQ 754

Query: 804 TLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIA 863
           +L DLRKAVNKYADRQVEFHFAGII PW+KR L++  FGT+N+EF+D S++ GH S HIA
Sbjct: 755 SLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTINEEFSDTSIITGHSSFHIA 814

Query: 864 RSAEPT---EDEESRLA---------HPATGTNLPFFHLELPDFSEWD 899
           +  +      DE+S ++           ATGTNLPFFH+++PDFS+WD
Sbjct: 815 KVLKDEVDYTDEDSPISVTCSNYDTLCAATGTNLPFFHIDIPDFSKWD 862

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score =  941 bits (2433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/829 (57%), Positives = 591/829 (71%), Gaps = 75/829 (9%)

Query: 101 FHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCV 160
           + E  VT+ E+Y  ++++  T  +  +YL SL PI++W PHYN  W Y DLVAGITVGCV
Sbjct: 75  YEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTWGYADLVAGITVGCV 134

Query: 161 LVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVS 220
           LVPQSMSYAQIA+LSP+YGLYSSF+GAFIYS FATSKDVCIGPVAVMSLQTAK I+ V+ 
Sbjct: 135 LVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLK 194

Query: 221 SLPED-TEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAG 279
             PED TE+T+P+IAT L LLCGI++              IS  AVAGFMTGSA NII G
Sbjct: 195 KYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGSAFNIIWG 254

Query: 280 QVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRL 339
           Q+PALMGYN LVNTR +TYKV+IN+L+HLP+TKLDAVFGL+PLVILYVWKW C T G  L
Sbjct: 255 QIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGTFGITL 314

Query: 340 VQRYGSRRSRMWDNV---FLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTV 396
             RY   + ++ + +   + Y QA+RNAVVIVVFTAI+W ++    K      IS+LGTV
Sbjct: 315 ADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRN--KSSKDRPISILGTV 372

Query: 397 PSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIG 456
           PSGL +VGVMK+P GLLS ++ E+PAS+IVLVLEHIAISK+FGR+NDY+VVPDQELIAIG
Sbjct: 373 PSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAIG 432

Query: 457 ATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKAT 516
            TNLIGTFF++YPATGSFSRSALKAKCNV TP SG+F+G CVLLA+YCLT AF FIPKAT
Sbjct: 433 VTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFFIPKAT 492

Query: 517 LSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVL 576
           LSAVIIHAVSDL+ SYKTTW+FW+ +P D + F+VTV ITVFSSIENGIYFAMCWS A+L
Sbjct: 493 LSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCWSCAML 552

Query: 577 LFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSS 636
           L + AFPAGKFLGRV++A                                          
Sbjct: 553 LLKQAFPAGKFLGRVEVA------------------------------------------ 570

Query: 637 ESLSHTAPGKAKAANSAGT--DKLGK-VEGHVTDGGSPRAPRFHTKWVPFDR-YTRELNP 692
           E L+ T      A  S+    ++L K V+  V    +P   +F  KWVPFD  Y+RELN 
Sbjct: 571 EVLNPTVQEDIDAVISSNELPNELNKQVKSTVEVLPAPEY-KFSVKWVPFDHGYSRELNI 629

Query: 693 EVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPG 752
              V PPPPGVIV+R  +S+TYVNCSR YD IFD +   TRRG+   + K S RPWNDPG
Sbjct: 630 NTTVRPPPPGVIVYRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDRPWNDPG 689

Query: 753 EWHPPKFLRKLFK------SSSEDLENRAVARD----ERPVLRVIAMDWSQVAQVDSTGL 802
           EW  P  L+ LFK      +++ DL     + +    E+P+L+V+ +D+SQVAQVDST +
Sbjct: 690 EWKMPDSLKSLFKFKRHSATTNSDLPISNGSSNGETYEKPLLKVVCLDFSQVAQVDSTAV 749

Query: 803 QTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHI 862
           Q+L DLRKAVN+YADRQVEFHFAGII PW+KR L++  FGT N+E++D+S++ GH S H+
Sbjct: 750 QSLVDLRKAVNRYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHV 809

Query: 863 ARSAEPT---EDEESRLAH---------PATGTNLPFFHLELPDFSEWD 899
           A+  +      DE+SR++           ATGTNLPFFH+++PDFS+WD
Sbjct: 810 AKVLKDDVDYTDEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWD 858

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/917 (52%), Positives = 609/917 (66%), Gaps = 75/917 (8%)

Query: 29  DLDDLDAEYGQFKNAEH-SDATAGRDLTSEYGAQXXXXXXXXXXXXXXXXXXXXXXKPVA 87
           +LD+L+ EY QFKN E  S+  AG D+      +                          
Sbjct: 3   ELDNLELEYNQFKNNERPSNTNAGADIEKGLDTKKYFERSITDN---------------- 46

Query: 88  PAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWL 147
            +  G    ++  + E  +T+ ++Y  NLR  FT A+  +Y+RSL P++ WLP YN +W 
Sbjct: 47  -STYGKKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWF 105

Query: 148 YQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVM 207
             DL+AGITVG VLVPQSMSYAQIATL P+YGLYSSF+GA +YSFFATSKDVCIGPVAVM
Sbjct: 106 LSDLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVM 165

Query: 208 SLQTAKAISHVVSSLPE-DTEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVA 266
           SLQTAK I+ V    P+ D  IT P+IAT LA +CGII+              IS  AVA
Sbjct: 166 SLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVA 225

Query: 267 GFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILY 326
           GFMTGSA NII GQ+P LMGY+K VNTR STY V+I+SL+HLPDTKLDA FGL+PL  L+
Sbjct: 226 GFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLF 285

Query: 327 VWKWGCSTGGPRLVQRY-----GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRA 381
            WKW C++ GP+L  RY       R ++ W   + Y QA RN ++I++FTA+++G++   
Sbjct: 286 FWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGV 345

Query: 382 LKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRV 441
            K+    RIS+LGTVP GL+  GVMK+P G+L+ IA E+P+S+IVL+LEHIAISK+FGRV
Sbjct: 346 AKD--KRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRV 403

Query: 442 NDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLA 501
           NDY++ P+QE+IAIG +NL+GTFFNAYPATGSFSRSALKAKCNV TPLSG+FS ACVLLA
Sbjct: 404 NDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLA 463

Query: 502 IYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSI 561
           IYCLT AF +IPKATLSAVIIHAV DLIASY TTWS W+++  D + F+ TV ITVFSSI
Sbjct: 464 IYCLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSI 523

Query: 562 ENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNR 621
           ENGIYFA+CWS A+LL+  AFPAGKFLGR++IAE  V N                   N 
Sbjct: 524 ENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAE--VVNPKIVDDDDFSFENS-----NE 576

Query: 622 EKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWV 681
             + E  +   SV+ + L  T+    K  N AG  K   + G + +G +    R++TKWV
Sbjct: 577 SFDDEGIYFDNSVAEDKLG-TSSNDLKKFN-AGV-KTRSINGELVNGQTSSDIRYYTKWV 633

Query: 682 PFDR-YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIV 740
           PFD  Y++ELNP V + PPPPGVIV+R S+S+TY+NCSR YD IFDE+ R+TRRG+    
Sbjct: 634 PFDHAYSKELNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQH 693

Query: 741 AKSSSRPWNDPGEWHPPK-------------FLRKLFKSSSEDLEN-----------RAV 776
                RPWNDPGEW  P              F RK+    + + EN           +  
Sbjct: 694 RHKWDRPWNDPGEWEAPDLKKFFNVKKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKN 753

Query: 777 ARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGL 836
            +DERP+LRV+ +D+SQVA  D+T LQ+L DLRKAVNKYADRQVEFHF GI  PW+KRGL
Sbjct: 754 DKDERPLLRVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGL 813

Query: 837 INSGFGTVNDEFADESLLVGHKSCHIARSAEPTEDEESRLAH--------------PATG 882
            N GFGT N+E++DES++ GH S H++R  E  +D  + L                 A+G
Sbjct: 814 RNLGFGTTNEEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASG 873

Query: 883 TNLPFFHLELPDFSEWD 899
           TNLPFFH+++PDFS+WD
Sbjct: 874 TNLPFFHVDIPDFSKWD 890

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/946 (51%), Positives = 608/946 (64%), Gaps = 85/946 (8%)

Query: 8   PGSKRESSFEVSREL--------SNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYG 59
           P  K+  +   +R+L        SN   +DL+ L+ EY Q+K  E  +  +G  L S   
Sbjct: 2   PTDKKNDTTVDNRDLDNIELSSYSNSNTVDLEALEEEYDQYKKEEEIEYISGNYLNSS-P 60

Query: 60  AQXXXXXXXXXXXXXXXXXXXXXXKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRST 119
            Q                               +    +   +E  +T  E+Y+ +L+  
Sbjct: 61  TQNINVTSNPKYEEYKKLKHLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEY 120

Query: 120 FTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYG 179
           FT     NY  S+ PI+ WLP YN  W   DL+AGIT+GCVLVPQSMSYAQIATL PQYG
Sbjct: 121 FTFNAAKNYALSIFPIIHWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYG 180

Query: 180 LYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALAL 239
           LYSSF+GAF+Y+ FATSKDVCIGPVAVMSL+TAK I+ V S    D ++T P+IAT LAL
Sbjct: 181 LYSSFIGAFVYALFATSKDVCIGPVAVMSLETAKVIADVSSHFQNDPDVTGPIIATTLAL 240

Query: 240 LCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYK 299
           LCG I+              IS  AV GFMTGSA NI+ GQVP LMGY+KLVNTR +TYK
Sbjct: 241 LCGGIAAAVGFLRLGFLVELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYK 300

Query: 300 VIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRM---WDNVFL 356
           V+I++L+HLPDTKLDAVFGL+PL ILYV KW C+  G +L ++  S   R        + 
Sbjct: 301 VVIDTLKHLPDTKLDAVFGLIPLFILYVVKWWCTNYGLQLAEKQFSSNERYRFYLKKFYF 360

Query: 357 YTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKI 416
           YT A+RNAVVI++FTAI+W ++    K      I++LGTVPSGLKD+GV K  + ++ KI
Sbjct: 361 YTNAMRNAVVIIIFTAISWSITRN--KSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKI 418

Query: 417 APELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSR 476
            P+LPAS+IVL+LEHIAI+K+FGR+NDY++VPDQELIAIG +NL+GTFF+AYPATGSFSR
Sbjct: 419 GPQLPASIIVLLLEHIAIAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSR 478

Query: 477 SALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTW 536
           SAL AKCNV TPLSG+F+G CVLLA+YCLT AF +IPKATLSAVIIHAVSDLIASY+TT 
Sbjct: 479 SALNAKCNVKTPLSGIFTGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTL 538

Query: 537 SFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEA 596
           SFW ++P D +CFLVTV+ITVFSSIENGIYFAMC+S A+ +FR+AFPAGKFLGR++IAE 
Sbjct: 539 SFWNMNPLDTLCFLVTVLITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEV 598

Query: 597 RVTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTD 656
                                A  ++  +   F     S  +          A  S G  
Sbjct: 599 -------------------INATPKDDFQMDNFNGFETSEYN-------NFPADQSYGKF 632

Query: 657 KLGKVEGHVTDGGSPRAPR-FHTKWVPFDR-YTRELNPEVFVAPPPPGVIVFRPSESWTY 714
            +     H  +  SP   + F+TKWVPFD  YT+ELN +V +  PPPGVIV+R S+S+ Y
Sbjct: 633 DIANKNTHKYN--SPHCSKNFYTKWVPFDHTYTKELNKDVEILEPPPGVIVYRLSDSFIY 690

Query: 715 VNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPP-----KF-LRKLFKSSS 768
           +NCSR +D IFDEV R T+RG+     K S RPWNDPGEW  P     KF +R LFK   
Sbjct: 691 LNCSRHFDTIFDEVKRKTKRGKFIGNIKKSQRPWNDPGEWEAPTWMTKKFSIRNLFKRKQ 750

Query: 769 E------------DLE---NRAVARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVN 813
           E            DL+   N+ +  D RPVL+VI +D+SQV+Q D+T LQ+L DLRK+VN
Sbjct: 751 EAESNVPNEDASTDLDISNNKDIDMDHRPVLQVICLDFSQVSQTDNTALQSLFDLRKSVN 810

Query: 814 KYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIAR--------- 864
            YADRQVEFHF GII PWVKRGLI  GFGTVN+ ++D S +VGH S HI +         
Sbjct: 811 SYADRQVEFHFCGIISPWVKRGLIKLGFGTVNEAYSDASTIVGHVSYHIVKNPTFRNKSF 870

Query: 865 SAEPTEDEESRL-----------AHPATGTNLPFFHLELPDFSEWD 899
           S+  +ED  S +              A+GTN PFFH+++P+FS+WD
Sbjct: 871 SSHTSEDTISDMNIEAKDYNNYSIEAASGTNYPFFHIDIPNFSKWD 916

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/936 (52%), Positives = 625/936 (66%), Gaps = 76/936 (8%)

Query: 1   MSNFQSSPGSKRESSFEVSRELSNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGA 60
           +S   + P S+    FE   ELS  +  +LDDL+ EY Q+K AE  +   GR    EY  
Sbjct: 9   LSGSGTPPPSQLPPRFESEVELSEVS--NLDDLEQEYDQYKAAEDRERVVGRG-DDEYDD 65

Query: 61  QXXXXXXXXXXXXXXX-XXXXXXXKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRST 119
                                     +AP A   VPS    + E  V   + +  +L+  
Sbjct: 66  DLRKGKVDYKETELEYWNSTNGTTNLLAPKA--TVPS----YEEGQVGPFDIFYHDLKDR 119

Query: 120 FTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYG 179
            TL    +Y  S  PI++WLP YN +W Y DLVAGITVGCVLVPQSMSYAQIATL PQYG
Sbjct: 120 MTLGAVKHYFESAFPIIKWLPFYNWKWGYADLVAGITVGCVLVPQSMSYAQIATLPPQYG 179

Query: 180 LYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLP-EDTEITSPMIATALA 238
           LYSSFVGAFIYSFFATSKDVCIGPVAVMSL+TAK I   +   P ED E+T P+IATALA
Sbjct: 180 LYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIQETLEKFPKEDHEVTGPLIATALA 239

Query: 239 LLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTY 298
           LLCGI++              IS  AVAGFMTGS+LNII+GQVPALMG+ K V+TR STY
Sbjct: 240 LLCGIVAMGAGVLRLGFLVELISLNAVAGFMTGSSLNIISGQVPALMGFKKYVHTRDSTY 299

Query: 299 KVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRY---GSRRSRMWDNVF 355
           K+IINSL++L  T+LDAVFGL+PLV+LY WKW CS+ GP+L  R+     ++  +    +
Sbjct: 300 KIIINSLKNLKHTQLDAVFGLIPLVLLYTWKWWCSSYGPKLADRHFKNNPKKRDILKTFY 359

Query: 356 LYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSK 415
            Y QA+R+AV+I+VFTAI++G++    K   + RIS+LG VP GLKDV VM++P GLLSK
Sbjct: 360 FYAQAMRSAVIIIVFTAISYGIT----KGRKTPRISVLGKVPKGLKDVHVMRIPEGLLSK 415

Query: 416 IAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFS 475
           +   +P+++I+L+LEHI+I+K+FGRVN+Y+VVPDQELIAIGATNLIGTFFNAYPATGSFS
Sbjct: 416 MGSSIPSAIIILLLEHISIAKSFGRVNNYKVVPDQELIAIGATNLIGTFFNAYPATGSFS 475

Query: 476 RSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTT 535
           RSALKAKCNV TPLSG+FSGACVLLA+YCLT  F +IP ATLSAVIIHAVSDL ASYKT+
Sbjct: 476 RSALKAKCNVRTPLSGVFSGACVLLALYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTS 535

Query: 536 WSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAE 595
           W+F++++P D + F+VTV ITVFSSI+ GIYFAMCWS A+ L +  F  G+FLGRV++AE
Sbjct: 536 WNFYKMNPGDFIAFIVTVFITVFSSIDYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAE 595

Query: 596 ARVTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGT 655
                                  VN + +        SVS  + SH    +A+++  + +
Sbjct: 596 V----------------------VNAQVDPNVE----SVSESAGSHLDGFQAQSSIESSS 629

Query: 656 DKL-----GKVEGHVTDGGSPRAPR-----------FHTKWVPFDR-YTRELNPEVFVAP 698
            KL       V  +  +GG   +             +HTKW+ +DR Y+RE NPEV + P
Sbjct: 630 KKLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQKLVYHTKWISYDRSYSREFNPEVPIQP 689

Query: 699 PPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPPK 758
           PPPGVIV+R  +S+TY+NCSR YD I+DEV R TRRG+     K   RPWNDPGEW  P+
Sbjct: 690 PPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVDRPWNDPGEWEAPR 749

Query: 759 FLRKLFK--------SSSEDLENRAVAR---DERPVLRVIAMDWSQVAQVDSTGLQTLQD 807
           + +KL          + +E  E++A  +   D RP+L++I +D+SQ +Q D+T +Q L D
Sbjct: 750 WFKKLTSKKKTAEEWAETEAQESKAAEQKLQDNRPLLKIICLDFSQCSQTDATAIQNLTD 809

Query: 808 LRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIARSAE 867
           LRK VN+YADRQVEFH  G+  PWVKR L+N GFGTVN+E++DESLL GH+S H+AR+  
Sbjct: 810 LRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNEEYSDESLLAGHRSYHVARAPT 869

Query: 868 PTEDEESRLA----HPATGTNLPFFHLELPDFSEWD 899
             ED     A    +PA+GTNLPFFH+E+PDFS+WD
Sbjct: 870 SLEDGLGSPAQYSVYPASGTNLPFFHVEIPDFSKWD 905

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/883 (55%), Positives = 592/883 (67%), Gaps = 77/883 (8%)

Query: 29  DLDDLDAEYGQFKNAE-HS--DATAGRDLTSEYGAQXXXXXXXXXXXXXXXXXXXXXXKP 85
           D++ L AEY Q K  E HS   AT G   + +Y                         KP
Sbjct: 30  DIEALQAEYDQLKAGEVHSAQGATHGDIGSRQYSGSG---------------------KP 68

Query: 86  VAPAAPGNVPS--ALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYN 143
            A     NV S  A+ E+ E  V+V ++Y+  LR   +L T  +Y  S+ P+ RW+ HYN
Sbjct: 69  AAQYLGLNVNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYN 128

Query: 144 ARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGP 203
             W+Y D+VAGITVGCVLVPQSMSYAQ+A+LSPQYGLYSSFVGAFIYSFFATSKDVCIGP
Sbjct: 129 VAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGP 188

Query: 204 VAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXXXXXXXXXXISST 263
           VAVMSL+TAK I+ V  +LPEDT IT P+IATAL LLCG I+              IS T
Sbjct: 189 VAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISIT 248

Query: 264 AVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLV 323
           AV GFMTGSAL+II+GQVP+LMGY+K VNTR +TYKVII SL+HL DT ++A FGLVPLV
Sbjct: 249 AVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLV 308

Query: 324 ILYVWKWGCSTGGPRLVQRY----GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSH 379
           +L++WKW C + GPRLV RY     SR SR W+  F Y QALRNAV+IVVFTAI+WG+S 
Sbjct: 309 LLFLWKWICGSLGPRLVDRYLQFKPSRASR-WNAAFFYLQALRNAVIIVVFTAISWGISR 367

Query: 380 RALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFG 439
             L++     ISLLG VPSGLK+VG +++P GL+ K+ PELPA+ I+L+LEHIAI+K+FG
Sbjct: 368 HKLEK---PPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFG 424

Query: 440 RVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVL 499
           R+N+Y+VVPDQELIAIG TNL  TFFNAYPATGSFSRSALKAKCNV TPLSGLF+GACVL
Sbjct: 425 RINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVL 484

Query: 500 LAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFS 559
           LA+YCLT AF FIPKATLSAVIIHAV+DLIASYK TW FWR +P D   F+VTV+ITVFS
Sbjct: 485 LALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFS 544

Query: 560 SIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAV 619
           SIE+GIYF++ WS AVLL + AFP GKFLG + +AE                      ++
Sbjct: 545 SIEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEV--------------IEPAGPPSI 590

Query: 620 NREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTK 679
           N E +             S+ ++A  +    +     KL  VE  + D  +    RFH +
Sbjct: 591 NSEADL-----------ASIDNSATFQQIDKDGG---KLNTVESVLPDPHT----RFHRR 632

Query: 680 WVPFDR-YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQ 738
           W+P D  Y+RELNPE  V PPPPGVIV+RP++SWTY+NCSR +D I D V   TR G+  
Sbjct: 633 WIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLV 692

Query: 739 IVAKSSSRPWNDPGEWHPPKFLRKLFKSSSEDLENRAVARDERPVLRVIAMDWSQVAQVD 798
               +  R W DPG W PP+  R+       D    +   D RPVLRV+AMDWSQV+QVD
Sbjct: 693 NHLSNKERLWCDPGPWRPPRIFRRFIA----DKRTGSAVADARPVLRVLAMDWSQVSQVD 748

Query: 799 STGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHK 858
           STG+Q L DLR A+NKYADR VEFHFAGI+ PW+KR L+N+GFG      AD  L+    
Sbjct: 749 STGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFG-----IADPPLISSRV 803

Query: 859 SCHIAR-SAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWDY 900
           S H+ R  A+P           A GTN PFFHL++PDF  W +
Sbjct: 804 SYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPDFETWRH 846

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/841 (53%), Positives = 581/841 (69%), Gaps = 57/841 (6%)

Query: 101 FHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCV 160
           ++E+PVT+ +FY + +   F++     YL SL P+++WLPHYN  WL QDL+AGITVGCV
Sbjct: 67  YNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCV 126

Query: 161 LVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVS 220
           LVPQSMSYAQIATL+PQYGLYSSF+GAFIYSFFATSKDVCIGPVAVMSLQTAK I  V S
Sbjct: 127 LVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTS 186

Query: 221 SLPEDTEI--TSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIA 278
            L  D +   T+P+IATALALLCGIIS              IS  AVAGFMTGSA NII 
Sbjct: 187 GLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIIC 246

Query: 279 GQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPR 338
           GQVPALMGYNK VNTR STY+V+IN+L+HLPDTKLDAVFGL+PL ILY+ KW  S+ GP+
Sbjct: 247 GQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGPQ 306

Query: 339 LVQRYGSRRS---------RMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSAR 389
            + +  +RR+         +   N F Y+ A+RN VVI+VFTAI+W ++    K   S  
Sbjct: 307 YLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRG--KSSTSVP 364

Query: 390 ISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPD 449
           IS+LGTVP GLK+V V KVP GL  K+AP+LP+S+I+L+LEHIAISK+FGRVNDY++VPD
Sbjct: 365 ISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKIVPD 424

Query: 450 QELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAF 509
           QELIAIG TNLIGTFF AYPATGSFSRSALKAKC+V TPLSGLFSGACVLLA+YCLT AF
Sbjct: 425 QELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAF 484

Query: 510 KFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAM 569
            +IPKATLSAVIIHAVSDL+ASYKTT +F++++P D VCF+ TV ITVFSSIE GIYFA+
Sbjct: 485 YYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFAI 544

Query: 570 CWSVAVLLFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNREKERETTF 629
           C+S A L+F+  FP G FLG ++IAE  V N                + +  E  ++   
Sbjct: 545 CFSCAQLIFKNMFPVGSFLGYIKIAE--VLNPTLSTNDYTILLDDSSSVLGEENTKDD-- 600

Query: 630 TAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPF-DRYTR 688
              SV +    +  P  ++   S            ++         ++ +WVP  + Y R
Sbjct: 601 ---SVKNRLDQNENPKSSEKEYSEFKSY------EMSSNSKTTNLSYYVRWVPMKNDYHR 651

Query: 689 ELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPW 748
           E+NP + + PPPPG+IV+R  +S+TY+NCSR YD I+DEV + TR+G   +  +   RPW
Sbjct: 652 EVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPW 711

Query: 749 NDPGEWHPPKFLRKLF--------------KSSSEDLENRAVAR--DERPVLRVIAMDWS 792
           ND GEW  PK L+ LF              K  +E +E+ + A   D +P L++I  D+S
Sbjct: 712 NDVGEWECPKSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFS 771

Query: 793 QVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADES 852
           QV Q D+T +Q+L DLRKAVN+Y+++Q+E+HF+GII  WVK+ LI  GFGTVND ++D+S
Sbjct: 772 QVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKS 831

Query: 853 LLVGHKSCHIARSAEPTEDEESRL--------------AHPATGTNLPFFHLELPDFSEW 898
           +++GH+S H+++     +  E+++                  TGTN PFFH+++PDFS W
Sbjct: 832 IIIGHQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNW 891

Query: 899 D 899
           +
Sbjct: 892 E 892

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/882 (49%), Positives = 581/882 (65%), Gaps = 60/882 (6%)

Query: 30  LDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQXXXXXXXXXXXXXXXXXXXXXXKPVAPA 89
           LD+L+ +Y +FK  E S   +G +       +                       P   A
Sbjct: 40  LDELETDYTRFKTNEDSAGYSGAE-----NERSRIDKFDSVGSSLQFAKYDGNALPDFKA 94

Query: 90  APGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQ 149
            P         ++E  VT  E+Y + +RS    + F +Y  SL PI++W+ HYN  W+Y 
Sbjct: 95  PP---------YYETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYS 145

Query: 150 DLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSL 209
           D +AGITVGCVLVPQSMSYAQ+A L P+YGLYSSF+GAFIYSFFATSKDVCIGPVAVMS+
Sbjct: 146 DFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSV 205

Query: 210 QTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFM 269
           Q +K ISHV+  LPE T IT+PM+A+ALAL   I+               IS TAVAGFM
Sbjct: 206 QVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFM 265

Query: 270 TGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWK 329
           TGSAL+I+A Q+P+L+G  K +NTR  TY+V+I++L+HL  + ++A FGL+ L +L+ WK
Sbjct: 266 TGSALSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWK 324

Query: 330 WGCSTGGPRLVQRY---GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGG 386
           W C   GP+L+ +Y    S+++R+W + F Y QALRNA V+ + T ++W +  R  K+  
Sbjct: 325 WTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKK-- 382

Query: 387 SARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRV 446
              IS+LGTVPSGLK VGV  +PSGL+ K+ P+LP +VI+L+LEHI I+K+FGR+N+Y++
Sbjct: 383 -TSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKI 441

Query: 447 VPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLT 506
           VPDQELIAIG TNLIG+FFNAYPATGSFSRSALKAKCNV TPLSGLFSGACVLLA+Y LT
Sbjct: 442 VPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLT 501

Query: 507 SAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIY 566
           SAF +IPKA LSAVIIHAV DLIASYK ++  W  +P DL+ FL T+++T+FSSIENGIY
Sbjct: 502 SAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIY 561

Query: 567 FAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNXXXXXXXXXXXXXXXXTAVNREKERE 626
           FA+ +S+A LL + AFP+GKFLG V+I E    N                   N + E  
Sbjct: 562 FAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIG----------NNDPELP 611

Query: 627 TTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFDR- 685
                  +S +S     P    +AN                  S    RFHTKWVP D  
Sbjct: 612 Q-----EISKDSKLAKDPDVHASANLM---------------ASKLDVRFHTKWVPLDNG 651

Query: 686 YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSS 745
           Y+RELNPE+ V  PPPGVIV+RP+ESW Y+NCSRQ+D I D V  LTR G+     + S 
Sbjct: 652 YSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSE 711

Query: 746 RPWNDPGEWHPPKFLRKLFKSSSEDLENRAVAR--DERPVLRVIAMDWSQVAQVDSTGLQ 803
           + W +PG+W PP FLRK FK          V    D RPVL+++AMDW+QV  VDST +Q
Sbjct: 712 QLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQ 771

Query: 804 TLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIA 863
           +L DLRK +N+YADRQV FHF+GI+ PW+KR L+++GFGT+N+ ++++ LL+ + + H+ 
Sbjct: 772 SLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVV 831

Query: 864 R---SAEPTEDEESRLAHP---ATGTNLPFFHLELPDFSEWD 899
           +   SA+    + S ++     A+GTN PFFH+++PDF++WD
Sbjct: 832 QNVLSADEENQQNSEISASLDVASGTNFPFFHIDMPDFTKWD 873

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  504 bits (1297), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 261/502 (51%), Positives = 343/502 (68%), Gaps = 27/502 (5%)

Query: 101 FHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCV 160
           + E+ VT+ E ++  +   FT  +   YL SLLPI +W+ HYN +W   D++AGITVGCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 161 LVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVS 220
           LVPQSMSYAQIATL PQYGLYSS +G FIY+ FATSKD+CIGPVA+MSLQTAKAI+HV  
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 221 SLPEDTEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQ 280
             P   +I + +IA+ +A++CG I+              I  TAV GF +GSA NI+ GQ
Sbjct: 123 KHP---DIPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWGQ 179

Query: 281 VPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLV 340
           +P LMGY+K VNTR  TYKV++++L+ LP T ++AV GL+PL  L+VWK+GC        
Sbjct: 180 IPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCD------- 232

Query: 341 QRYGSRRSRM--W-DNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVP 397
             Y  RR  +  W   +  Y  +LR  +VI++ +A A+G  + +LK        +LG +P
Sbjct: 233 --YALRRGNLKPWPKRIVFYLLSLRVTIVIIICSAAAYGAKNPSLK--------VLGKIP 282

Query: 398 SGL---KDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIA 454
            G     D  +  +PS L+S I  E+PASVIVLVLEH++I+K+F RVN+YRV  DQEL A
Sbjct: 283 KGFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTA 342

Query: 455 IGATNLIG-TFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIP 513
           IG +N++G     AYP TGSFSR+ALKA+C V TPL  +FSG CV++AI  LTSA  +IP
Sbjct: 343 IGVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIP 402

Query: 514 KATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSV 573
           KATLSAVIIHAVS LI+SYK T   +++ P D + FLVT+ ITVFS IE G+YFA+CW+ 
Sbjct: 403 KATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWAC 462

Query: 574 AVLLFRTAFPAGKFLGRVQIAE 595
            +L+ R AFP G FLG V++ E
Sbjct: 463 FLLMIRIAFPYGAFLGYVRVRE 484

 Score =  184 bits (466), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 127/211 (60%), Gaps = 13/211 (6%)

Query: 680 WVPFD-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQ 738
           W+P+  R+TRELNP V + PPPPGV+V+R S+S TY+NCSR YD I D +   T+ G   
Sbjct: 688 WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEID 747

Query: 739 IVAKS-SSRPWNDPGEWHPPKFLRKLFKSSSEDLENRAVARDERPVLRVIAMDWSQVAQV 797
           +++ +   +PWN+PG W  PK   K ++ +  ++  +    D+RP LR++ +D+SQVAQ+
Sbjct: 748 VLSDALYVKPWNNPGPWEKPKL--KFWEHADPEIARKKRMADKRPTLRILCLDFSQVAQI 805

Query: 798 DSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGH 857
           DST LQ L DLR  VN Y    VE+HF GII PWV+R LI  GFG +N EF         
Sbjct: 806 DSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKINKEF--------F 857

Query: 858 KSCHIARSAEPTEDEESRLAHPATGTNLPFF 888
              + + + E   D E      A G N+PFF
Sbjct: 858 PKVNDSSTVEVISDLEYN-GELALGENVPFF 887

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 120/501 (23%), Positives = 213/501 (42%), Gaps = 53/501 (10%)

Query: 115 NLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIAT 173
           N RS  T +   +YL    P   W+P+Y       DL AG++V    +P ++SYA  +A 
Sbjct: 42  NNRSILTTSNIWDYLAYYFPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAH 101

Query: 174 LSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMI 233
           + P  GLYS  +  FIY+ F +   + +GP + +SL   +A+  +V+    D  I++  I
Sbjct: 102 VEPLSGLYSLAITPFIYAIFGSVPQMIVGPESAISLVVGQAVEPMVN---HDERISTISI 158

Query: 234 ATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNT 293
           +  +  + G                 +S   + GF+      +I   + + +  +K++ T
Sbjct: 159 SIVVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLAT 218

Query: 294 RTSTYKVIINSL----------RHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRY 343
               Y      +           H P T + +++  + L+++ V K        RL++R+
Sbjct: 219 SPEHYHTPFEKILFLIKYGQHNYHAP-TAILSLYSFIILMLMKVMK-------KRLMKRF 270

Query: 344 GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVP-SGLKD 402
                  W    ++   +   +V  +  +  + + H+         IS++G    +G   
Sbjct: 271 K------W---VIFVPEILIVIVGTIMFSFHFDIKHKF-------DISIIGDFKVNGFDS 314

Query: 403 V-GVMKVPSGLLSKIAPELPASVIVLVL---EHIAISKAFGRVNDYRVVPDQELIAIGAT 458
           +   +   + LL K  P L A ++  VL   E    SKA G   D  V  ++EL+A+G+ 
Sbjct: 315 LHNPLDKTNRLLLK--PLLDAGIVCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSM 372

Query: 459 NLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLS 518
           N++G+ F A PA G + RS + A     T +SG+  G+  L  I          P   LS
Sbjct: 373 NIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLS 432

Query: 519 AVIIHAVSDLIASYKTTWSFWRLSP--PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVL 576
            V       L+    T   F+  S    +L+   +T + T+F S+E GI    C+S+  +
Sbjct: 433 VVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYSIISI 492

Query: 577 LFRTAFPAGKFLGRVQIAEAR 597
           +  +A        R+QI   R
Sbjct: 493 IKHSA------QSRIQILAKR 507

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 122/475 (25%), Positives = 212/475 (44%), Gaps = 41/475 (8%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP   W+P Y    L  D +AGI++    +P ++SYA  IA + P  GLYS  +  FIY+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
            F +   + +GP + +SL   +++  + S    D+ +    I+  L  + G         
Sbjct: 149 VFGSVPQMIVGPESAISLVVGQSVELLKS---HDSALEIINISVVLTFISGAALLILGIL 205

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKL-----VNTRTSTYKVIINSLR 306
                   +S + + GF++   L +I   +   +  NKL     V+  TS  KV    ++
Sbjct: 206 RLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQF-LIK 264

Query: 307 HLPDT--KLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQALRNA 364
           + P    K  A+   +  V L+           RL+++    + R W     +   +   
Sbjct: 265 YAPTNYHKPTALLSAIAFVTLF---------SIRLLKKRWMAKHR-W---LAFIPEILMV 311

Query: 365 VVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVP-SGLLSKIAPELPAS 423
           V+I ++ +  W       K+ G   I ++G   +   D   +K P S    KI P+L  +
Sbjct: 312 VIISIYLSATWEFK----KQYG---ILIVGDFNTHAID--KLKNPISKENRKIMPQLLNT 362

Query: 424 VIVLVL----EHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSAL 479
            +++ L    E +  SK+ G   D  +  ++EL+A+G+ N+I + F A P+ G + RS +
Sbjct: 363 GVLISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGGYGRSKI 422

Query: 480 KAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSF- 538
            A     T +SG+F G+  L+ I  L     +IP   LS +       L+    +   F 
Sbjct: 423 NAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGISLLEEAPSELKFH 482

Query: 539 WRLSPPD-LVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQ 592
           +R    D L  F +TV+ T+  S+E GI     +S+  ++  +A    + LGRVQ
Sbjct: 483 FRCKGYDELFVFAITVLATLLYSVEMGICIGCGYSIISIVKHSAKSRIQILGRVQ 537

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 115/474 (24%), Positives = 208/474 (43%), Gaps = 41/474 (8%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP   W+P Y+ +    D +AG+++    +P +MSYA  +A + P  GLYS      +Y+
Sbjct: 74  LPCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYSLVFSPAVYT 133

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
              +   + +GP + +SL   +AI    + L ED ++ +  I   +  + G++       
Sbjct: 134 VLGSVPQMIVGPESAISLILGQAIE---ARLSEDPKLKAINICLVITFISGLVLLTGGLL 190

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTY----KVIINSLRH 307
                   +S   + GF++G  + ++   +   +  N +  TR   Y    + ++  +++
Sbjct: 191 RLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPFEKVLFIMKY 250

Query: 308 LPDT--KLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQALRNAV 365
            P+   K  A+  LV  VIL   +           +RYG +        F +   L + +
Sbjct: 251 GPENYHKPTAILSLVAFVILMSLRI--------FKKRYGKK--------FKWLVLLPDIL 294

Query: 366 VIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKD-VGVMKVP-SGLLSKIAPELPAS 423
           V+V  +       H   + G    I ++  +P   KD +  +K P S +      +L ++
Sbjct: 295 VVVALSIFVSYKMHLKSRYG----IEIINDIP---KDSMKHLKNPFSNVNVATFKDLFST 347

Query: 424 VIVLVL----EHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSAL 479
             ++ +    E    SK+ G   +  +  ++ELIA+G+ N++G+ F   PA G + RS +
Sbjct: 348 GFMVAMLGFFESATASKSLGTSYNLAISSNRELIALGSMNVVGSMFAILPAFGGYGRSKI 407

Query: 480 KAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSF- 538
            A     T +SG F G   L  I  L    ++IP   LS +       L+        F 
Sbjct: 408 NAYSGAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILSVITTVVGLTLLEEAPHDLKFH 467

Query: 539 WRLSP-PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRV 591
           WR     +L  F VT++ T+F S+E GIY     S+  ++  +A    + LGRV
Sbjct: 468 WRCKGYSELTVFTVTLLATLFYSLEAGIYIGCACSIINVIKHSAKSRIQILGRV 521

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  117 bits (292), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 119/477 (24%), Positives = 208/477 (43%), Gaps = 45/477 (9%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP + W+P+YN +    D +AG+++    +P  +S+A  +A + P  GLYS  V  FIY+
Sbjct: 72  LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYA 131

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
            F +   + +GP + +SL   +A+  + S    D  + +  IAT ++ + G+        
Sbjct: 132 LFGSVPHMIVGPESAISLVVGQAVETLTS---HDLSLETVDIATMISFMSGLTLLFGGIF 188

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKV----IINSLR- 306
                   +S   + GF++     +I   +   +  NKL+ T    Y      I+  +R 
Sbjct: 189 RLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKILFLVRY 248

Query: 307 -----HLPDTKLD-AVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQA 360
                HLP + L  AVF  +  +              R+ ++   RR + W  VF+    
Sbjct: 249 GPSNYHLPTSFLSLAVFTTLMTI--------------RIFKKKMMRRIK-WI-VFI---- 288

Query: 361 LRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPS-GLKDVG--VMKVPSGLLSKIA 417
               + +V+F+ +   M     K      IS++G   + G  D    + K   GL+  + 
Sbjct: 289 -PEILSVVIFSIVLSYMCDLKKK----YDISVIGDFNTDGFDDFRNPLSKCNRGLIPALR 343

Query: 418 PELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRS 477
                S ++  LE I  SK+ G   +     ++EL+A+G  N IG+ F   PA G + RS
Sbjct: 344 DVSLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRS 403

Query: 478 ALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLI--ASYKTT 535
            + A     T ++G+F G+  L  I  L     +IP   LS +       L+  A +   
Sbjct: 404 KINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAPHDIK 463

Query: 536 WSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQ 592
           +        +L+ F++T + T F SIE GI     +S+  ++  +A    + L RV+
Sbjct: 464 FHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIVKHSAQSRIQILARVE 520

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  115 bits (289), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 111/480 (23%), Positives = 206/480 (42%), Gaps = 35/480 (7%)

Query: 124 TFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYS 182
           +F + L+  LP   WLP Y  +    D++AGIT+    +P ++SYA  +A + P  GLYS
Sbjct: 72  SFYDRLKYYLPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYS 131

Query: 183 SFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCG 242
             +  F+Y  F +   + +GP + +SL   +A+  +V+    + ++ +  I+  +  L G
Sbjct: 132 LAITPFVYCVFGSVPQMIVGPESAISLVVGQAVEKLVT---HNEKVGTINISVVVTFLSG 188

Query: 243 IISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVII 302
            I               +S   + GF++   L ++   +   +   KL+ T    Y    
Sbjct: 189 AILLIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPF 248

Query: 303 NSLRHL----PDT--KLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFL 356
             ++ L    P+   K  A+  L   +IL   ++       +L++RY S        V  
Sbjct: 249 EKVQFLFKYGPENLHKPTAILSLCSFIILMTLRFL----KKKLMKRYKS--------VIF 296

Query: 357 YTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVP-SGLKDVG--VMKVPSGLL 413
           + +     ++++V +++   ++    K+     IS+LG    SG   +   + K    L 
Sbjct: 297 FPE-----ILLIVISSLIISVNFNLKKD---FDISMLGDFSTSGFDKLNNPLGKDNRSLC 348

Query: 414 SKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGS 473
            ++        I+   E    SK+ G + D  +  ++EL+A+G+ NL+G+ F A P+ G 
Sbjct: 349 HELLSVGLMCAILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALPSFGG 408

Query: 474 FSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYK 533
           + RS + A     T +SG   G   L  I  L     + P   LS +       L+    
Sbjct: 409 YGRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAP 468

Query: 534 TTWSFWRLSP--PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRV 591
           +   F        +L+ F +  V T+  S+E GI     +S+  ++  +A    + L RV
Sbjct: 469 SDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQILTRV 528

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 113/473 (23%), Positives = 203/473 (42%), Gaps = 39/473 (8%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP   WLP Y    L+ D++AGI+V    +P ++SY   IA + P  GLYS  +  F+Y 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
              +   + +GP + +SL   +A+  +     E+  +    I+T +  + G I       
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESITLH-KENVSLID--ISTVITFVSGTILLFSGIS 221

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDT 311
                   +S   + GF++   L +I   + + +  +K + +    Y      +  L D 
Sbjct: 222 RFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLIDY 281

Query: 312 KL------DAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQALRNAV 365
                    A+F    L++L++          RL++R   +  +   +   +   L   V
Sbjct: 282 APAQYHIPTAIFSGCCLIVLFL---------TRLLKR---KLMKYHKSAIFFPDILL-VV 328

Query: 366 VIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVP-SGLLSKIAPEL-PAS 423
           ++ +  ++ + + HR         IS++G     + +   +K P +    K+ P+L  AS
Sbjct: 329 IVTILISMKFNLKHRY-------GISIIGDF--SMDNFDELKNPLTRPRRKLIPDLFSAS 379

Query: 424 VIVLVL---EHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALK 480
           +IV +L   E    SK+ G   +  V  ++EL+A+G  N++ + F A PA G + RS + 
Sbjct: 380 LIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYGRSKIN 439

Query: 481 AKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWR 540
           A     + +SG+F G   L+ +  L     +IP   LS +       L+        F  
Sbjct: 440 ALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIKFHL 499

Query: 541 LSP--PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRV 591
                 +L  F VT   T+F SIE GI     +S+  ++  +A    + L RV
Sbjct: 500 RCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILARV 552

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 111/485 (22%), Positives = 210/485 (43%), Gaps = 54/485 (11%)

Query: 127 NYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVG 186
           +Y+   LPI++W P Y+ + L +DL+AGI++    +P ++S + +A +SP  GL+S  + 
Sbjct: 42  SYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFAISLSTMAHVSPYAGLFSLVIP 101

Query: 187 AFIYSFFATSKDVCIGPVAVMSL---QTAKAISHVVSSLPEDTEITSPMIATALALLCGI 243
             IY+ F +   + +GP  V+SL   Q+ +A SH          + S +    +A   G 
Sbjct: 102 PLIYAVFGSVPTMVVGPQTVVSLVVGQSCEAWSH--------KSVDSLVTVAVIACTSGF 153

Query: 244 ISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLV-------NTRTS 296
           I               IS   + GF+   A+ ++  ++   +    L        N  T+
Sbjct: 154 ILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLPELQLEDLYRDEVAQGNAGTT 213

Query: 297 TYKVIINSLRHLPD------TKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRM 350
           T+      L++ P+       KL  +   + +V  YV K+          ++ GS+  R 
Sbjct: 214 TWDKFNFILKYGPEHADSFSMKLSFIAFSILMVCKYVKKY--------FTEKRGSKLCRF 265

Query: 351 WDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPS 410
           + ++ L         V+  F  +++   +         RI  +G +P         KVP 
Sbjct: 266 FPDLLL---------VVAGFIYLSY---YNDWSSTMGTRI--IGNLPPNKNH---FKVPI 308

Query: 411 GLLSKIAPELPASVIVLVL---EHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNA 467
               +       S +V +L   +     KA G   D  +  ++EL+++G  N++ + F+A
Sbjct: 309 TSFKEFKELFDISFLVAILGLFDSATAFKAIGEKFDIDISSNRELVSLGLINVVSSVFSA 368

Query: 468 YPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSD 527
            PA G + RS L   C+  TP++G+      +  +  +  AF ++P   L+ +I +   +
Sbjct: 369 LPAFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGAFHYLPLCVLAVIISYIAYN 428

Query: 528 LIASYKTTWSF-WRLSP-PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAG 585
           L+    +   F W +    +L+ F+  VV T+  S + G+   +  ++  LL  T     
Sbjct: 429 LLEEIPSDLFFYWSVGGYQELLTFVAVVVTTLVWSPQFGVSIGVGLTMIRLLKHTTQSRV 488

Query: 586 KFLGR 590
           + LGR
Sbjct: 489 QILGR 493

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 111/473 (23%), Positives = 206/473 (43%), Gaps = 39/473 (8%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP   WLP Y    L+ D++AGI++    +P ++SY   IA + P  GLYS  +  F+Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
              +   + +GP + +SL   +A+  +  +L +D  ++   I+  +  + G I       
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESI--TLHKD-NVSLIDISIVITFVSGAILLFSGIS 211

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPD- 310
                   +S   + GF++   L +I   + + +  +K + +    Y      +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLIDY 271

Query: 311 -----TKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQALRNAV 365
                 K  A+F     +IL V +        +L++R+ S  +  + ++ L        V
Sbjct: 272 APAQYHKPTAIFSGCCFIILIVMRLL----KKKLMKRHKS--AVFFPDILL-------VV 318

Query: 366 VIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVP-SGLLSKIAPEL-PAS 423
           ++ +  ++   +  R         IS++G     + +   +K P +    K+ P+L  AS
Sbjct: 319 IVTILISMKLSLKQRY-------GISIVGDF--SMDNFDKLKNPLTHSRRKLMPDLFSAS 369

Query: 424 VIVLVL---EHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALK 480
           +IV +L   E    SK+ G   +  V  ++EL+A+G  N+  + F A P+ G + RS + 
Sbjct: 370 LIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSKIN 429

Query: 481 AKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWR 540
           A     + +SG+F G   L+ +  L     +IP   LS +       L+        F  
Sbjct: 430 ALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHL 489

Query: 541 LSP--PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRV 591
                 +L  F VT  +T+F SIE+GI     +S+  ++  +A    + L R+
Sbjct: 490 QCGGYSELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILARI 542

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  110 bits (274), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 116/488 (23%), Positives = 207/488 (42%), Gaps = 40/488 (8%)

Query: 124 TFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYS 182
           TF   ++  LP +RWLP YN    + D ++GI++    +P ++SYA  IA + P  GLYS
Sbjct: 105 TFYQLIQYYLPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYS 164

Query: 183 SFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSL----PEDTEITSPMIATALA 238
             +   IY    +   + +GP   +SL   +A+  +  S      ED  I+   I+  + 
Sbjct: 165 LAITPVIYGILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTIT 224

Query: 239 LLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLV--NTRT- 295
            L G++               +S   +  F++     ++   +   M  N ++  N R  
Sbjct: 225 FLSGLVLFICGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDALITEMKLNCILIDNDRHY 284

Query: 296 -STYKVIINSLRHLPDT--KLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWD 352
            + ++ I+  +++ P+   K   V  +V   ILY  ++ C        ++Y  +   +  
Sbjct: 285 HTAFEKIMFIIKYAPNNFHKPTTVLSVVCFSILYFVRY-CK-------KKYIIKHKSL-- 334

Query: 353 NVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGL 412
            +FL        ++IVV   I+ G+   +     +  IS++G V S   ++    + + L
Sbjct: 335 -IFL------PEILIVV---ISTGILSASYNFKDNYGISIIGDVNSNNSNLIAGNLQNPL 384

Query: 413 LSKIAPELP-------ASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFF 465
            S      P       A   +   E    SK+ G   +  +  ++EL+A+G  NL  +  
Sbjct: 385 SSSNKELFPILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLL 444

Query: 466 NAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAV 525
              P+ G + RS + A     T +SG+  G   +L I  L +   FIP   LS +     
Sbjct: 445 GGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVG 504

Query: 526 SDLIASYKTTWSF-WRLSP-PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFP 583
             LI        F WR     +L+ F +T   T+F S+E GI     +S+  ++  +A  
Sbjct: 505 LSLIEEAPGEVKFHWRCKGYNELIIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKS 564

Query: 584 AGKFLGRV 591
             + LGR+
Sbjct: 565 RIQILGRI 572

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 116/505 (22%), Positives = 213/505 (42%), Gaps = 43/505 (8%)

Query: 105 PVTVGEFYS----QNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCV 160
           PV V  F S     N  S +   T    +   LP   WLP Y    L+ D++AGI++   
Sbjct: 63  PVNVSRFESFNSMSNNDSVYDNNTIFETVPYYLPCFSWLPEYTFNKLWGDIIAGISLASF 122

Query: 161 LVPQSMSYA-QIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVV 219
            +P ++SY   IA + P  GLYS  +  F+Y    +   + +GP + +SL   +A+  + 
Sbjct: 123 QIPLALSYTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESI- 181

Query: 220 SSLPEDTEITSPMIATALALLCGIISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAG 279
            +L +D  ++   I+  +  + G I               +S   + GF++   L +I  
Sbjct: 182 -TLHKD-NVSLIDISVVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIIN 239

Query: 280 QVPALMGYNKLVNTRTSTYKVIINSLRHLPD------TKLDAVFGLVPLVILYVWKWGCS 333
            + + +  +K + +    Y      +  L D       K  A+F    L++L+  +    
Sbjct: 240 ALISELKLDKFLLSLPQHYHTPFEKVLFLIDYAPAQYHKPTAIFSGCCLIVLFSMRLLKK 299

Query: 334 TGGPRLVQRYGSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLL 393
                       + +  + ++ L        V++ +F ++ + + HR         I+++
Sbjct: 300 K------LVKHHKSAIFFPDILL-------VVIVAIFISMKFSLKHRY-------GITII 339

Query: 394 GTVPSGLKDVGVMKVP-SGLLSKIAPEL-PASVIVLVL---EHIAISKAFGRVNDYRVVP 448
           G     + +   +K P +    K+ P+L  AS+IV +L   E    SK+ G   +  V  
Sbjct: 340 GDF--SMDNFDKLKNPFTHSRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSS 397

Query: 449 DQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSA 508
           ++EL+A+G  N++ + F A P+ G + RS + A     + +SG+F G   L+ +  L   
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 509 FKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSP--PDLVCFLVTVVITVFSSIENGIY 566
             +IP   LS +       L+        F        +L  F VT  +T+  SIE GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGVTILCSIEAGIC 517

Query: 567 FAMCWSVAVLLFRTAFPAGKFLGRV 591
               +S+  ++  +A    + L RV
Sbjct: 518 IGCVYSILNIIKHSAKSRIQILARV 542

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 112/478 (23%), Positives = 198/478 (41%), Gaps = 51/478 (10%)

Query: 124 TFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYS 182
           T+   +R  LP + WLP+Y    L  DL+AGIT+    +P ++SYA  IA + P  GLY+
Sbjct: 101 TWIELIRYYLPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYA 160

Query: 183 SFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCG 242
             V  F Y+ F ++  + +GP   +SL   + +       P+   I   +I  A+ L+ G
Sbjct: 161 LAVSPFFYAIFGSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPI---LIVIAVTLISG 217

Query: 243 IISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVII 302
            I               ++   + GF+         G V  +M  + L+N          
Sbjct: 218 TILLISGIFRLGYLGNILNKALLHGFI---------GSVGFVMIIDSLIN---------- 258

Query: 303 NSLRHLPDTKLDAVFGLVP-------LVILYVWKWG-----CSTGGPRLVQRYGSRRSRM 350
                  + KL  +    P       L I+++WK+        T     +        R 
Sbjct: 259 -------ELKLGDILADTPEHYNTPFLKIVFLWKYAFQNFHVPTTLISFISIIILLIVRA 311

Query: 351 WDNVFLYTQALRNAV--VIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDV---GV 405
           +  V ++       +  +++V T +   +S++ L    +  I +LG   S    +    +
Sbjct: 312 FKKVLMHRHRWLIFIPEILIVLTTVLI-LSYK-LDFADTYDIDILGDFKSNENSIFHNPL 369

Query: 406 MKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFF 465
                GL+  +      + I    E    SKA G  ++  V  ++EL+A+G +N++ +  
Sbjct: 370 SNKNRGLIHVVFNIGIITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTL 429

Query: 466 NAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAV 525
            A P+ G + RS + A     T LSG+F G   +LAI  L     +IP   LS +     
Sbjct: 430 GALPSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIG 489

Query: 526 SDLIASYKTTWSF-WRLSP-PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTA 581
             L+       SF WR     +L   ++T + ++F S+E  +Y    +S+  ++  +A
Sbjct: 490 FTLLEEIPKEVSFHWRCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYSILNIIKHSA 547

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 111/454 (24%), Positives = 186/454 (40%), Gaps = 37/454 (8%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP   WLP Y+   L +D +AG ++    +P +MSY+  +A + P  GL +     F+Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
            F +   + +GP + +SL   +AI      +  D  +    +   L  + G I       
Sbjct: 130 VFGSVPHMIVGPESAISLVVGQAIE---KQMKHDKSLDVVNLCLILTFISGAILFCFGIM 186

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDT 311
                   +S   + GF++   L ++   +   +   K+ N     Y        H P  
Sbjct: 187 RFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY--------HAPFQ 238

Query: 312 KLDAVFGLVPL-----VILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQALRNAVV 366
           KL  +F   P        L            RLV++   R SR++  V    +      +
Sbjct: 239 KLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKK---RLSRVYKKVIFVPE------I 289

Query: 367 IVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVP--SGLLSKIAPELPASV 424
           ++V   +  G  H + K      I ++G +  G  D    + P     LS  +    A  
Sbjct: 290 LIVVALVTLGSYHFSFKL--RYNIDIVGDIEVG--DTSKFRNPLSKKNLSLFSELFHAGF 345

Query: 425 IVLVL---EHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKA 481
           +V +L   E    SK+ G   +  V  ++EL+A+G+ NL+G+ F A P+ G + RS + A
Sbjct: 346 MVALLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINA 405

Query: 482 KCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLI--ASYKTTWSFW 539
               +T +SG+F G    +    L +A   IP   LS +       L   A     + F 
Sbjct: 406 YSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADLRYHFR 465

Query: 540 RLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSV 573
                +L+ F +TV+ T F S+E GI     +SV
Sbjct: 466 CRGYNELLIFALTVLTTFFYSVEAGITLGCGYSV 499

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 130/574 (22%), Positives = 226/574 (39%), Gaps = 64/574 (11%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP   WLP Y+ R  + D +AG+++    +P +MSYA  IA + P  GLY+     F Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
            F +   + +GP + +SL   +AI  ++     D  ++S  +   +  + G++       
Sbjct: 157 IFGSVPQMIVGPESAISLVVGQAIEPMIR---HDPSLSSLDLCVIITFISGVVLFTFGVF 213

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDT 311
                   +S   + GF++   + ++   +   +   K+ +   S Y        H P  
Sbjct: 214 RFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHY--------HSPFE 265

Query: 312 KLDAVFGLVP--------LVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQALRN 363
           K+  +    P        L+ L  +    S    +       R    +  + L       
Sbjct: 266 KVLFLIKYAPANYHLPTSLLSLCCFLILMSLRLIKKKLLKRFRSLVFFPEILL------- 318

Query: 364 AVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAP----E 419
            VV V+F +  + + HR         I ++G + + + D    K+ + L     P     
Sbjct: 319 VVVTVIFFSYNFDLKHRY-------NIEVVGDIEASVFD----KLRNPLSKNKRPFYGDL 367

Query: 420 LPASVIVLVL---EHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSR 476
             A  +V +L   E    SK+ G   D  V  ++EL+A+G+ NLIG+ F A P+ G + R
Sbjct: 368 FSAGFMVAMLGFFESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGR 427

Query: 477 SALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTW 536
           S + A     T +SG   G   +  I  L    ++IP   LS +       L+       
Sbjct: 428 SKINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADL 487

Query: 537 SFWRLSP--PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIA 594
            F        +L+ F++TV+ T F S+E GI     +S+  ++  +     + LG++   
Sbjct: 488 RFHIRCRGYNELISFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQILGKLA-- 545

Query: 595 EARVTNXXXXXXXXXXXXXXXXTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAG 654
               TN                  VN + E       V +  E L+ T     K      
Sbjct: 546 ---GTNKFVNADEYEGKNSTSERRVNPQLEEIEGCLIVRI-PEPLTFTNTDDLKT----- 596

Query: 655 TDKLGKVEGHVTDGGSPRAPRFH----TKWVPFD 684
             +L ++E + +    P APR      TK+V FD
Sbjct: 597 --RLNRLELYGSTKTHPAAPRSRDQEMTKYVIFD 628

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 121/487 (24%), Positives = 209/487 (42%), Gaps = 47/487 (9%)

Query: 124 TFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYS 182
           +F + L   LP   W+P Y       DLVAGIT+    +P ++SYA  +A + P  GLYS
Sbjct: 73  SFRDVLPYYLPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYS 132

Query: 183 SFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCG 242
                FIY+ F +   + +GP + +SL   +A+  + +    + EI++  I+  +  + G
Sbjct: 133 LAFTPFIYAIFGSVPQMIVGPESAISLVVGQAVEKLRA---HNHEISTMSISVLVTFISG 189

Query: 243 IISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVII 302
           +                +S   + GF++   + +I   + + +  +KL+      +    
Sbjct: 190 MFLFVFGICRFGFLGNVLSRALLRGFISSVGVVMIVNSLISELKLHKLLLETKGHFHTPF 249

Query: 303 NSLR----------HLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWD 352
             +R          H+P     AV  L   +IL            R++++   RR R W 
Sbjct: 250 QKIRFIIKYAPANYHIPT----AVLSLTCFIILVT---------ARVIKKKLMRRRR-WP 295

Query: 353 NVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPS-GLKDVGVMKVPSG 411
            VF+    +               +SH+  K      IS++G   + GL  V      S 
Sbjct: 296 -VFVPEILIL--------IITTIILSHK-FKFKKHYEISIVGDFDTDGL--VNFYNPISK 343

Query: 412 LLSKIAPEL-PASVIVLVL---EHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNA 467
              ++AP L  A  IV +L   E    +K+ G   ++ +  ++EL+A+G+ NL  +   A
Sbjct: 344 SNRELAPNLMNAGFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGA 403

Query: 468 YPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSD 527
            PA G + RS + +     T +SG+  G  VLL +    S  ++IP   LS +       
Sbjct: 404 LPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVGIS 463

Query: 528 LI--ASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAG 585
           L+  A     + F      +L+ F VTV+ T F S+E G+     +SV  ++  +A    
Sbjct: 464 LLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVCIGCGYSVISIIKHSAKSRI 523

Query: 586 KFLGRVQ 592
           + L RV+
Sbjct: 524 QILARVE 530

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 109/473 (23%), Positives = 205/473 (43%), Gaps = 39/473 (8%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP   WLP Y    L+ D++AGI++    +P ++SY   IA + P  GLYS  +  F+Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
            F +   + +GP + +SL   +A+  +  +L +D  ++   I+  +  + G I       
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESI--TLHKD-NVSLIDISIVITFVSGAILLFSGIS 211

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPD- 310
                   +S   + GF++   L +I   + + +  +K + +    Y      +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLIDY 271

Query: 311 -----TKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQALRNAV 365
                    A+F    L+IL++ +                + +  + ++ L        V
Sbjct: 272 APAQYHMPTAIFSGCCLIILFLMRLLKRKLLKY------HKGAIFFPDILL-------VV 318

Query: 366 VIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVP-SGLLSKIAPEL-PAS 423
           ++ +  ++ + + HR         I+++G     + +   +K P +    K+ P+L  AS
Sbjct: 319 IVTILISMKFDLKHRY-------GITIVGDF--SMDNFDKLKNPLTRSRRKLIPDLFSAS 369

Query: 424 VIVLVL---EHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALK 480
           +IV +L   E    SK+ G   +  V  ++EL+A+G  N++ + F A P+ G + RS + 
Sbjct: 370 LIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKIN 429

Query: 481 AKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWR 540
           A     + +SG+F G   L+ +  L     +IP   LS +       L+    +   F  
Sbjct: 430 ALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPSDIKFHL 489

Query: 541 LSP--PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRV 591
                 +L  F VT  +T+F SIE GI     +S+  ++  +A    + L RV
Sbjct: 490 RCGGYSELFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKSRIQILARV 542

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 109/466 (23%), Positives = 197/466 (42%), Gaps = 23/466 (4%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP   WLP+YN      DL+AG+++    +P ++S+A  +A + P  GLYS     FIY+
Sbjct: 90  LPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYA 149

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
              +   + +GP + +SL   +A+  ++S  P+   + +  ++  +  + G         
Sbjct: 150 ILGSVPQMIVGPESAISLVVGQAVEKMISHNPD---LHTLQLSAVITFISGGFLFFFGLC 206

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDT 311
                   +S   + GF++   L +I   + +    +K++      Y      +  L   
Sbjct: 207 RLGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKILKDLPVHYHTPFEKILFLVTY 266

Query: 312 KLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQALRNAVVIVVFT 371
             +   G    + L  +     T   +++++    R R W    ++   +   ++  +F 
Sbjct: 267 APNNYHGPTTALSLSCFFILIMT---KIIKKKLMPRCR-W---IVFVPDILLLIIGTIFL 319

Query: 372 AIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVL-- 429
           +I +   H       +  IS +G   +   D  +  + +     I   L A  I  +L  
Sbjct: 320 SIKYRFKH-------NYSISTVGDFNTKGLDKLLNPLSAENRGLIPQLLSAGFITAMLGF 372

Query: 430 -EHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTP 488
            E    SK+ G   D  +  ++EL+A+G+ NL  +   + PA G + RS + A     T 
Sbjct: 373 FESTTASKSLGSSYDLAISSNRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTV 432

Query: 489 LSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLI--ASYKTTWSFWRLSPPDL 546
           +SG F G  VLL I  L     +IP   LS V       L+  A     + F      +L
Sbjct: 433 MSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDEL 492

Query: 547 VCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQ 592
           + F +TV+ T+F S+E GI     +SV  ++  +A    + L RVQ
Sbjct: 493 LVFTLTVLTTMFYSVEVGICIGCGYSVISIIKHSAKSRIQILARVQ 538

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 103/472 (21%), Positives = 192/472 (40%), Gaps = 35/472 (7%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP M W+PHY+    + DLVAGI++    +P ++SYA  IA + P  GLYS  +   IY+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
            F +   + +GP + +SL   +A     +    D+EI++  I   +  + G++       
Sbjct: 134 IFGSVPQMIVGPESAISLVVGQATEKFSA---HDSEISTVTITMMITFISGVVLFFLGSV 190

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPD- 310
                   +S   + GF++   L +I   +   +  N  +      Y   +  +  L   
Sbjct: 191 RLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFLFRY 250

Query: 311 -----TKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNVFLYTQALRNAV 365
                 K  A+  L+  ++L   +        +L+ RY            ++   +   V
Sbjct: 251 ASEYYHKPTAILSLICFLVLISTR----IAKKKLMNRY---------RFLIFVPEILLVV 297

Query: 366 VIVVFTAIAWGMSHRALKEGGSARISLLGTVPS-GLKDVG--VMKVPSGLLSKIAPELPA 422
            + +  ++ +   H       S  IS +G   + G   +G  +      L S +  E  A
Sbjct: 298 SVTILLSLKYDFKH-------SYGISTIGEFNADGFGSIGNPLSNENRALYSSLWNEGLA 350

Query: 423 SVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAK 482
             ++   E    SK+ G   +     ++ELIA+G  N++G+ F A P+ G + RS +   
Sbjct: 351 VAMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVF 410

Query: 483 CNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLS 542
               T +SG   G   LL    L     + P   LS +       L+    +   F    
Sbjct: 411 SGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHC 470

Query: 543 P--PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQ 592
               +L  F +T + T+  S+E G+     +S+ +++  +A    + L +++
Sbjct: 471 SGYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILAKLE 522

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 79/165 (47%), Gaps = 2/165 (1%)

Query: 429 LEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTP 488
            E    SK+ G   D  +  ++EL+A+G+ NL+G+ F A P+ G + RS + A    +T 
Sbjct: 368 FESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATV 427

Query: 489 LSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLI--ASYKTTWSFWRLSPPDL 546
           +SG+F G   L+    L +A + IP   LS +       L   A     + F      +L
Sbjct: 428 MSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNEL 487

Query: 547 VCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRV 591
           + F +TV+ T F S+E GI     +S+   +  +     + LGR+
Sbjct: 488 LTFAITVLTTFFYSVEAGITLGCGYSIIRAIKNSTQSGIQILGRI 532

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 71/162 (43%), Gaps = 7/162 (4%)

Query: 133 LPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYA-QIATLSPQYGLYSSFVGAFIYS 191
           LP   WLP Y+A     DL+AG ++    +P +MSY+  +A + P  GL +      +Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 192 FFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISXXXXXX 251
            F +   + +GP + +SL   +AI  +      D  +    +   L  + G I       
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLTK---HDASLNVTNLCVVLTFISGSILFSFGLM 201

Query: 252 XXXXXXXXISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNT 293
                   +S   + GF++   L ++   + +L+   KL +T
Sbjct: 202 RFGFLDSVLSRALLRGFISAVGLIMV---INSLISELKLKDT 240

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 101/444 (22%), Positives = 173/444 (38%), Gaps = 46/444 (10%)

Query: 164 QSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSL---QTAKAISHVVS 220
            S+S + +A L P  GLYS  +   IY    T     +GP  V+SL   Q+ +  SH  S
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSHR-S 59

Query: 221 SLPEDTEITSPMIATALALLCGI--ISXXXXXXXXXXXXXXISSTAVAGFMTGSALNIIA 278
             P  T      ++  +    G+  +               +SS A+   +T     +  
Sbjct: 60  LEPLSTVAVIGCVSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELLPELKL 119

Query: 279 GQVPALMGYNKLVNTRT-STYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGP 337
            ++ A       + T T   ++ I+       DT              + W     T   
Sbjct: 120 EELYAHYVAQGYIGTTTWEKFRFILEKAPENSDT--------------FTWNLSLFTFIL 165

Query: 338 RLVQRYGSR---RSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLG 394
            +  RY  R       W     + +     ++IVV  +I    + +  +  G   I ++G
Sbjct: 166 LMTIRYLKRHLAEKCGWKKCIFFPE-----ILIVVVGSITLSNTQKWSELKG---IKIIG 217

Query: 395 TVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVL---EHIAISKAFGRVNDYRVVPDQE 451
            +P     +   KVP    S+       S ++ +L   E   + K+    ++     ++E
Sbjct: 218 DIPPNSDHI---KVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDASSNRE 274

Query: 452 LIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYC---LTSA 508
           L+++G  NL+ + F+A PA G + RS +   C   T  SG+F     LLAI C   L +A
Sbjct: 275 LVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVS---LLAIICMNFLMNA 331

Query: 509 FKFIPKATLSAVIIHAVSDLIASYKTTWSF-WRLSP-PDLVCFLVTVVITVFSSIENGIY 566
           F  +P   L+ +I      L+        F W +    +L  F++ VV T+  S + G+ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 567 FAMCWSVAVLLFRTAFPAGKFLGR 590
             MC ++  LL  +     + LGR
Sbjct: 392 MGMCLTMIRLLKHSTRSRVQILGR 415

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 90/190 (47%), Gaps = 5/190 (2%)

Query: 406 MKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVN---DYRVVPDQELIAIGATNLIG 462
           +KVP     +      AS +V +L     + AF  ++   D  V  ++EL+++G  N++G
Sbjct: 304 IKVPIQSFQEFKDLFDASFLVAILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVG 363

Query: 463 TFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVII 522
           + F++ PA G + RS L   C   TP++G+F     +  +  L   F ++P   L+ +I 
Sbjct: 364 SVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVIIS 423

Query: 523 HAVSDLIASY-KTTWSFWRLSP-PDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRT 580
               +L+       + +W +S   +L+ F   V+ T+  S + G+   +  ++  LL  T
Sbjct: 424 FIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIWSPQFGLVMGLGLTMIRLLKHT 483

Query: 581 AFPAGKFLGR 590
                + LG+
Sbjct: 484 TQSRIQILGK 493

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (58%), Gaps = 3/94 (3%)

Query: 127 NYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVG 186
           +Y+   LPI+RWLP Y+   + +D++AG+T+    +P ++S   +A +SP  GLY+  + 
Sbjct: 42  SYVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIPLAISLTTMAHVSPYAGLYALVIP 101

Query: 187 AFIYSFFATSKDVCIGPVAVMSL---QTAKAISH 217
             IY+ F +   + +GP  V SL   Q+  A +H
Sbjct: 102 PLIYAVFGSVPTMVVGPQTVASLVVGQSCDAWAH 135

>TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {ON}
           Anc_5.689 YOR080W
          Length = 702

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 136 MRWLPHYNARWLYQDLVAGITVGCV-LVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFA 194
           +R LPH  + ++ Q   A +T   + L+ +S+ Y      S    L SS  GA +Y F  
Sbjct: 587 LRSLPHLESLFMPQ--CAALTDDTMSLMTESVDYLNDLK-SLDVSLNSSLTGASLYEFLK 643

Query: 195 TSKDVCIGPVAVMSLQTAKAISHVVSSL 222
             +DV   P+  +++    +ISH+  ++
Sbjct: 644 ALRDVRSAPLEYLNIDGCASISHITVNM 671

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 67/156 (42%), Gaps = 10/156 (6%)

Query: 441 VNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLL 500
           V+ Y V  D+ELIA G +NLI  F  +      ++ S L  +    +P++G+       +
Sbjct: 555 VDKYDV--DKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFI 612

Query: 501 AIYCLTSAFKFIPKATLSAVIIHAVSDLIA-SYKTTWSFWRLSPPDLVCFLVTV----VI 555
            +        FIP   + ++I     +LI  +   TW   +L P + +   + V    V+
Sbjct: 613 VMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWG--KLQPFEYLTIWIIVITMGVV 670

Query: 556 TVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRV 591
                I  GI  A C+S  V   +     G++ G+V
Sbjct: 671 DFVIGIIVGILLA-CFSFLVNSTQLQTINGEYDGKV 705

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,467,331
Number of extensions: 3425678
Number of successful extensions: 8557
Number of sequences better than 10.0: 50
Number of HSP's gapped: 8528
Number of HSP's successfully gapped: 77
Length of query: 902
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 783
Effective length of database: 39,836,145
Effective search space: 31191701535
Effective search space used: 31191701535
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)