Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13464g8.272ON59359331130.0
Kwal_56.237548.272ON58959222070.0
SAKL0H16808g8.272ON65759917710.0
TDEL0F039908.272ON63159217310.0
ZYRO0C01430g8.272ON59059317250.0
Kpol_543.448.272ON64360216370.0
KLLA0A04631g8.272ON57960315850.0
TPHA0A017508.272ON63661515630.0
AGR076C8.272ON68661415450.0
Kwal_26.6669singletonON59059614260.0
TBLA0F030408.272ON90659213311e-173
Ecym_42988.272ON67860511981e-156
KLLA0F17776gna 1ON5535239211e-116
SAKL0C02178gsingletonON5655418771e-110
SAKL0E04246gna 1ON5655378421e-105
Kwal_26.6697singletonON5775125295e-59
KLTH0E16720gsingletonON5745235014e-55
SAKL0A07480gsingletonON5735054937e-54
Suva_4.553na 2ON5625204655e-50
CAGL0J01375g2.473ON5644844621e-49
Skud_2.423na 2ON5604834612e-49
Smik_4.3638.272ON7655474648e-49
TDEL0C00120singletonON5695734561e-48
KLTH0H05456gna 3ON5685024435e-47
TDEL0A024902.473ON5544654303e-45
YDR119W (VBA4)8.272ON7685574349e-45
NCAS0A078102.473ON5684604261e-44
Skud_4.3798.272ON7596144321e-44
Smik_13.2722.473ON5614574242e-44
Suva_13.2652.473ON5614794233e-44
ZYRO0A00330gsingletonON5765134233e-44
YMR088C (VBA1)2.473ON5624694207e-44
Suva_2.2798.272ON7755774242e-43
Skud_13.2442.473ON5625164111e-42
KNAG0E025602.473ON5784664093e-42
Kwal_14.1585na 3ON5704444075e-42
NDAI0H022002.473ON5714604014e-41
KLLA0F13684g2.473ON5714883917e-40
ZYRO0G03234g2.473ON5624883881e-39
SAKL0E02992g2.473ON5705393821e-38
Kpol_467.242.473ON3703483632e-37
YBR293W (VBA2)na 2ON4744813656e-37
ZYRO0G21868gna 3ON6206033653e-36
Smik_2.434na 2ON4744393594e-36
KLTH0D05434g2.473ON5764943634e-36
Kwal_26.77552.473ON5595593537e-35
Ecym_73992.473ON5634923263e-31
TPHA0G031502.473ON6004613221e-30
ABL040W2.473ON5675032989e-28
ZYRO0G21890gsingletonON5764472981e-27
KLTH0B10142gsingletonON5684472934e-27
KLTH0B00132gsingletonON5684602793e-25
NDAI0J012808.272ON6945152642e-23
KLLA0E09879gsingletonON6305642572e-22
Smik_16.81na 4ON6252472544e-22
Kwal_14.728singletonON5685152501e-21
SAKL0A00726gsingletonON5981982392e-20
KLTH0C10120gsingletonON6511512367e-20
CAGL0B02079gna 4ON6242402332e-19
Skud_7.560na 4ON6421652322e-19
KLTH0C10142gsingletonON5733122303e-19
Kwal_26.9616singletonON5623282303e-19
SAKL0C05588gsingletonON6771942252e-18
TDEL0G03260singletonON6121652223e-18
YKR105C (VBA5)singletonON5825342223e-18
NCAS0C03460na 4ON6305352198e-18
KNAG0K01020singletonON5993062162e-17
YGR224W (AZR1)na 4ON6131522172e-17
KLLA0D19941gsingletonON6115302126e-17
YPR198W (SGE1)singletonON5431562108e-17
Skud_18.6singletonON6105852091e-16
SAKL0B12716gsingletonON6321732091e-16
KLTH0D16962gsingletonON5714712072e-16
Skud_16.503singletonON5433192072e-16
SAKL0F00198gsingletonON5371732027e-16
KLTH0B00594gsingletonON6184081983e-15
Smik_17.11singletonON5441541983e-15
SAKL0A08228gsingletonON5691641955e-15
Smik_6.22singletonON6364951851e-13
Smik_11.368singletonON5805011832e-13
CAGL0E04092gna 5ON6455511788e-13
YOL158C (ENB1)singletonON6062841733e-12
Suva_26.1singletonON5343611715e-12
SAKL0G06600gsingletonON6294531691e-11
Skud_6.14singletonON6364771681e-11
Kwal_14.722singletonON6115241681e-11
TBLA0C01040singletonON6695221681e-11
TDEL0H01600singletonON6043431672e-11
Smik_21.4singletonON6053471662e-11
SAKL0F00792gsingletonON6173051653e-11
Suva_10.9singletonON6374571635e-11
KNAG0J02980singletonON6364801636e-11
KLLA0A10439gsingletonON6344791619e-11
NCAS0A11500singletonON6143681592e-10
TBLA0F00470singletonON7322961564e-10
YKR106W (GEX2)singletonON6153041564e-10
YCL073C (GEX1)singletonON6153041554e-10
ZYRO0G07414gsingletonON7074861555e-10
Suva_8.12na 5ON6334561538e-10
Skud_18.3singletonON5905631502e-09
KLTH0D18150gsingletonON6074691492e-09
Skud_8.3na 5ON6315271492e-09
KAFR0I01560singletonON6324591475e-09
KLLA0D19945gsingletonON6444341458e-09
KLLA0C19272gsingletonON6232911449e-09
Kpol_513.33singletonON6263471431e-08
KLTH0D00506gsingletonON6163061431e-08
TDEL0H00130singletonON6215211422e-08
YHL040C (ARN1)na 5ON6275371412e-08
Kwal_56.22298singletonON6104671412e-08
Suva_9.712.241ON5612381403e-08
KLLA0E14609gsingletonON6395621403e-08
Suva_8.435na 6ON5154141394e-08
Skud_15.545na 6ON5164081384e-08
YHL047C (ARN2)singletonON6205141368e-08
YOR378Wna 6ON5154731359e-08
KAFR0J016202.242ON5701641341e-07
Suva_10.11singletonON5402241341e-07
KLTH0C10560gna 6ON5154061322e-07
Kpol_1003.112.241ON5811861322e-07
Smik_15.560na 6ON5164091323e-07
Suva_13.4678.843ON5435251323e-07
CAGL0I07447g3.84ON5701881313e-07
Suva_5.2na 7ON6275511313e-07
TBLA0B083103.84ON6381971305e-07
Smik_8.1na 5ON6275311295e-07
NDAI0H00140na 5ON6325521296e-07
TPHA0B00180singletonON6336041297e-07
Kpol_1053.243.84ON6201301288e-07
SAKL0E00132gsingletonON6203211289e-07
ZYRO0A01474g2.242ON5382331271e-06
Smik_6.24na 8ON5444381261e-06
Kwal_23.5241na 9ON5914901261e-06
TBLA0E037902.241ON5502571261e-06
CAGL0M06281g8.570ON5421931261e-06
NCAS0B064802.241ON5872101242e-06
KLTH0A01562gna 9ON6154931242e-06
NDAI0A071103.84ON6022031243e-06
TPHA0A006203.84ON6341301233e-06
KLLA0C12309g3.84ON5691311233e-06
NDAI0B037702.242ON5711861233e-06
KNAG0E01160singletonON5721851233e-06
YIL120W (QDR1)2.242ON5632161215e-06
KLTH0B00110gsingletonON6274061215e-06
CAGL0G08624g2.242ON5832651215e-06
Skud_6.16na 8ON5492191215e-06
TDEL0C045802.241ON5571621216e-06
KLTH0D00110gsingletonON6203161208e-06
KLTH0B10450gsingletonON6203161208e-06
SAKL0C09350g3.84ON5781831191e-05
NCAS0C047603.84ON6072091191e-05
TDEL0B019008.446ON6871381181e-05
KLTH0A07964gsingletonON6192911181e-05
TBLA0E038002.242ON6081861181e-05
NCAS0C036002.242ON5722441171e-05
ZYRO0A09878g8.446ON6823001172e-05
KLLA0C00220gsingletonON6246051162e-05
TPHA0C031002.241ON6021901162e-05
Kpol_416.6singletonON5975271162e-05
Smik_5.22na 7ON6285161162e-05
KAFR0C014803.84ON5771311162e-05
Skud_5.24na 7ON6274881162e-05
TPHA0K02330singletonON6315241144e-05
KNAG0K006303.84ON6181311135e-05
YCL069W (VBA3)singletonON4584081135e-05
SAKL0F00110gsingletonON6205941135e-05
Kwal_27.102458.843ON5153351126e-05
YEL065W (SIT1)na 7ON6285901126e-05
NDAI0I02650na 7ON6384191126e-05
NCAS0I025203.84ON5871241127e-05
KAFR0C02660singletonON5913231119e-05
Skud_13.258.843ON5374091109e-05
Kwal_34.15711na 5ON6183781111e-04
TBLA0F01600singletonON5671091101e-04
SAKL0G03300gsingletonON6162931101e-04
Kwal_23.48142.241ON5291861091e-04
KLTH0G09350g2.241ON5632141091e-04
KNAG0E01170singletonON5732401092e-04
SAKL0C11066gsingletonON5801181092e-04
SAKL0E08778g2.241ON6002151092e-04
Kpol_534.276.155ON5021361082e-04
TDEL0B005508.843ON5373421082e-04
KNAG0I019102.242ON5981601082e-04
TDEL0H04480na 10ON5702431082e-04
Kwal_23.4853na 11ON6033951082e-04
KAFR0D00930singletonON6141701082e-04
Suva_14.213.23ON5412901072e-04
Kwal_23.2794singletonON6192911072e-04
YNL318C (HXT14)3.23ON5402881072e-04
AFR343C3.84ON5712501072e-04
KLTH0C09372g3.84ON6081391072e-04
YOL103W (ITR2)3.84ON6092151072e-04
TBLA0H00750singletonON4841601063e-04
KLTH0G18854g8.22ON502711063e-04
KLTH0G11154gna 10ON5722011063e-04
KAFR0J009302.242ON5661971063e-04
Kwal_27.116388.446ON7231871064e-04
TDEL0G05000singletonON1861111014e-04
TPHA0G03780singletonON6122481064e-04
TPHA0M00120singletonON6193731054e-04
Smik_4.7743.84ON5841971054e-04
KNAG0C046205.469ON5461871054e-04
KLLA0C18931gna 12ON5532191055e-04
NDAI0D010202.242ON5921791055e-04
Smik_15.543.84ON611701055e-04
Skud_15.513.84ON587701045e-04
KLTH0C03806g8.843ON5252471037e-04
Suva_4.2singletonON5703111037e-04
TPHA0C047908.843ON5562801037e-04
KLLA0B00352gna 6ON4982661037e-04
KLLA0A03223g8.446ON6771991037e-04
TPHA0B039001.432ON5541421037e-04
Suva_15.623.84ON609641038e-04
KLTH0H16214gsingletonON5511291020.001
ZYRO0C00374gna 10ON5642721020.001
ZYRO0B06688g3.84ON5931521020.001
SAKL0H09328g8.570ON5962781020.001
SAKL0H12518g8.446ON7301941020.001
KAFR0B039408.843ON5473941020.001
TDEL0G04740singletonON6014991020.001
KLTH0E10406g8.446ON7331851020.001
Kwal_23.6547na 6ON5113891010.001
TBLA0C01100na 13ON6491551010.001
ADL258W2.242ON5341821010.001
CAGL0L02519gna 6ON5294011010.001
KLTH0G09504gna 11ON6243741010.001
SAKL0F00440gsingletonON5444151010.001
NCAS0I00110na 5ON4522891000.002
KLLA0E09021gna 10ON5661861000.002
Kwal_56.227243.84ON5781421000.002
KNAG0H031808.272ON677961000.002
NCAS0B037808.272ON589217990.002
Ecym_23175.469ON55744990.002
TDEL0D06610singletonON497121990.002
SAKL0C12122gna 9ON611336990.002
SAKL0G03432g5.469ON537186990.002
KNAG0J002608.843ON550404990.003
Kwal_23.48242.242ON553226980.003
Ecym_2054na 14ON484215980.003
YML116W (ATR1)8.843ON542277980.003
AFR333WsingletonON500117980.003
TDEL0B00140singletonON632612980.003
Skud_14.213.23ON541290970.003
Kpol_358.4na 7ON617560980.003
KAFR0D00790singletonON561236970.004
KAFR0G00160singletonON636122970.004
KLLA0F03311g2.242ON542148970.004
TBLA0A08520singletonON632301970.004
NDAI0F020606.155ON502138960.004
TDEL0D054003.84ON585160960.005
NOTE: 1 genes in the same pillar as KLTH0G13464g were not hit in these BLAST results
LIST: KAFR0B05450

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13464g
         (593 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...  1203   0.0  
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...   854   0.0  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...   686   0.0  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   671   0.0  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...   669   0.0  
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...   635   0.0  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...   615   0.0  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   606   0.0  
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...   599   0.0  
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...   553   0.0  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...   517   e-173
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...   466   e-156
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...   359   e-116
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...   342   e-110
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...   328   e-105
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...   208   5e-59
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...   197   4e-55
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...   194   7e-54
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...   183   5e-50
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...   182   1e-49
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...   182   2e-49
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...   183   8e-49
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}        180   1e-48
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...   175   5e-47
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...   170   3e-45
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...   171   9e-45
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...   168   1e-44
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...   171   1e-44
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...   167   2e-44
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...   167   3e-44
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...   167   3e-44
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...   166   7e-44
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...   167   2e-43
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...   162   1e-42
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...   162   3e-42
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...   161   5e-42
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...   159   4e-41
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...   155   7e-40
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...   154   1e-39
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...   151   1e-38
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...   144   2e-37
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...   145   6e-37
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...   145   3e-36
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...   142   4e-36
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...   144   4e-36
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...   140   7e-35
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...   130   3e-31
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...   128   1e-30
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...   119   9e-28
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...   119   1e-27
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...   117   4e-27
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...   112   3e-25
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....   106   2e-23
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...   103   2e-22
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...   102   4e-22
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...   100   1e-21
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    97   2e-20
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    96   7e-20
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    94   2e-19
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    94   2e-19
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    93   3e-19
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    93   3e-19
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    91   2e-18
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               90   3e-18
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    90   3e-18
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    89   8e-18
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    88   2e-17
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    88   2e-17
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    86   6e-17
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    86   8e-17
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    85   1e-16
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    85   1e-16
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    84   2e-16
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    84   2e-16
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    82   7e-16
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    81   3e-15
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    81   3e-15
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    80   5e-15
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    76   1e-13
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    75   2e-13
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    73   8e-13
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    71   3e-12
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        70   5e-12
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    70   1e-11
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    69   1e-11
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    69   1e-11
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               69   1e-11
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    69   2e-11
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     69   2e-11
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    68   3e-11
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    67   5e-11
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              67   6e-11
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    67   9e-11
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...    66   2e-10
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               65   4e-10
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    65   4e-10
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    64   4e-10
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    64   5e-10
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    64   8e-10
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    62   2e-09
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    62   2e-09
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    62   2e-09
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      61   5e-09
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...    60   8e-09
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    60   9e-09
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    60   1e-08
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    60   1e-08
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       59   2e-08
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    59   2e-08
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    59   2e-08
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    59   3e-08
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    59   3e-08
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...    58   4e-08
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...    58   4e-08
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...    57   8e-08
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...    57   9e-08
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    56   1e-07
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    56   1e-07
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...    55   2e-07
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    55   2e-07
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...    55   3e-07
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    55   3e-07
CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly...    55   3e-07
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       55   3e-07
TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa] ...    55   5e-07
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    54   5e-07
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       54   6e-07
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}       54   7e-07
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    54   8e-07
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...    54   9e-07
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    54   1e-06
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    53   1e-06
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...    53   1e-06
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    53   1e-06
CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} simil...    53   1e-06
NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa] ...    52   2e-06
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...    52   2e-06
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...    52   3e-06
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    52   3e-06
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...    52   3e-06
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    52   3e-06
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               52   3e-06
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    51   5e-06
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    51   5e-06
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    51   5e-06
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    51   5e-06
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    51   6e-06
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    51   8e-06
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    51   8e-06
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...    50   1e-05
NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84      50   1e-05
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    50   1e-05
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    50   1e-05
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    50   1e-05
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    50   1e-05
ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conser...    50   2e-05
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...    49   2e-05
TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.2...    49   2e-05
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    49   2e-05
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    49   2e-05
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    49   2e-05
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    49   2e-05
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}              49   4e-05
KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3....    48   5e-05
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    48   5e-05
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...    48   5e-05
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    48   6e-05
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...    48   6e-05
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}               48   6e-05
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...    48   7e-05
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}               47   9e-05
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...    47   9e-05
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...    47   1e-04
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    47   1e-04
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...    47   1e-04
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    47   1e-04
KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} simila...    47   1e-04
KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON}               47   2e-04
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    47   2e-04
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    47   2e-04
Kpol_534.27 s534 (61814..63322) [1509 bp, 502 aa] {ON} (61814..6...    46   2e-04
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...    46   2e-04
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    46   2e-04
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    46   2e-04
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...    46   2e-04
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...    46   2e-04
Suva_14.21 Chr14 complement(34919..36544) [1626 bp, 541 aa] {ON}...    46   2e-04
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    46   2e-04
YNL318C Chr14 complement(38707..40329) [1623 bp, 540 aa] {ON}  H...    46   2e-04
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    46   2e-04
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...    46   2e-04
YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}  ITR2Myo-i...    46   2e-04
TBLA0H00750 Chr8 (171288..172742) [1455 bp, 484 aa] {ON} Anc_2.2...    45   3e-04
KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]...    45   3e-04
KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {...    45   3e-04
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    45   3e-04
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    45   4e-04
TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON}                44   4e-04
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...    45   4e-04
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                45   4e-04
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    45   4e-04
KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {O...    45   4e-04
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    45   5e-04
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    45   5e-04
Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W (...    45   5e-04
Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {...    45   5e-04
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...    44   7e-04
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       44   7e-04
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    44   7e-04
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...    44   7e-04
KLLA0A03223g Chr1 (290002..292035) [2034 bp, 677 aa] {ON} simila...    44   7e-04
TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432     44   7e-04
Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W (...    44   8e-04
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    44   0.001
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    44   0.001
ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {...    44   0.001
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    44   0.001
SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]...    44   0.001
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    44   0.001
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    44   0.001
KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly...    44   0.001
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...    44   0.001
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     44   0.001
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    44   0.001
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...    44   0.001
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    44   0.001
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    44   0.001
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         43   0.002
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    43   0.002
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    43   0.002
KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {O...    43   0.002
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    43   0.002
Ecym_2317 Chr2 (621407..623080) [1674 bp, 557 aa] {ON} similar t...    43   0.002
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    43   0.002
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    43   0.002
SAKL0G03432g Chr7 complement(282042..283655) [1614 bp, 537 aa] {...    43   0.002
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    43   0.003
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    42   0.003
Ecym_2054 Chr2 complement(87646..89100) [1455 bp, 484 aa] {ON} s...    42   0.003
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    42   0.003
AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-synte...    42   0.003
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                 42   0.003
Skud_14.21 Chr14 complement(32206..33831) [1626 bp, 541 aa] {ON}...    42   0.003
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    42   0.003
KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON}               42   0.004
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 42   0.004
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    42   0.004
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             42   0.004
NDAI0F02060 Chr6 complement(505217..506725) [1509 bp, 502 aa] {O...    42   0.004
TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {O...    42   0.005
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    42   0.005
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...    42   0.005
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    42   0.005
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    42   0.005
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    42   0.005
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570     42   0.005
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               42   0.005
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               42   0.005
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    42   0.005
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    42   0.006
KNAG0B06940 Chr2 (1377486..1379168) [1683 bp, 560 aa] {ON}             42   0.006
Kwal_56.24841 s56 complement(1167890..1169425) [1536 bp, 511 aa]...    42   0.006
Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {...    42   0.006
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...    41   0.006
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    41   0.006
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    41   0.007
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...    41   0.007
NCAS0A08630 Chr1 complement(1704322..1706103) [1782 bp, 593 aa] ...    41   0.007
YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putativ...    41   0.007
ABR223C Chr2 complement(820634..822508) [1875 bp, 624 aa] {ON} S...    41   0.008
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    41   0.008
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    41   0.008
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    41   0.009
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    41   0.009
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    41   0.010
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    41   0.010
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    41   0.011
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    40   0.011
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    40   0.011
TBLA0A03420 Chr1 (824716..826449) [1734 bp, 577 aa] {ON}               40   0.012
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    40   0.012
TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4...    40   0.012
Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W (...    40   0.012
Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W (...    40   0.012
TDEL0B03990 Chr2 (713794..715239) [1446 bp, 481 aa] {ON} Anc_6.1...    40   0.012
Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {...    40   0.013
TDEL0E02280 Chr5 (438756..440519) [1764 bp, 587 aa] {ON} Anc_5.3...    40   0.013
Smik_14.13 Chr14 complement(23204..24826) [1623 bp, 540 aa] {ON}...    40   0.013
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    40   0.014
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...    40   0.015
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    40   0.015
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    40   0.015
TDEL0D06500 Chr4 (1166063..1167691) [1629 bp, 542 aa] {ON}             40   0.017
Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W (...    40   0.017
Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)      40   0.017
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    40   0.018
SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} simila...    40   0.018
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    40   0.019
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    40   0.019
NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON}               40   0.021
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    40   0.022
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...    40   0.022
NDAI0G06310 Chr7 (1563437..1565134) [1698 bp, 565 aa] {ON} Anc_8...    40   0.024
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    39   0.025
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    39   0.026
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...    39   0.027
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    39   0.028
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    39   0.028
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    39   0.030
NCAS0E01350 Chr5 complement(261125..262696) [1572 bp, 523 aa] {O...    39   0.032
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...    39   0.032
Suva_8.358 Chr8 complement(630597..632165) [1569 bp, 522 aa] {ON...    39   0.033
NCAS0H03600 Chr8 complement(683969..685651) [1683 bp, 560 aa] {O...    39   0.034
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    39   0.034
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    39   0.037
TBLA0C07220 Chr3 (1750032..1751870) [1839 bp, 612 aa] {ON}             39   0.040
TDEL0C00450 Chr3 (65197..66762) [1566 bp, 521 aa] {ON} Anc_8.22 ...    39   0.043
KAFR0J00480 Chr10 (84206..85708) [1503 bp, 500 aa] {ON} Anc_5.28...    39   0.045
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    39   0.045
AFR602W Chr6 (1523461..1525137) [1677 bp, 558 aa] {ON} Non-synte...    39   0.047
Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON...    39   0.049
KLLA0A11110g Chr1 (964084..965739) [1656 bp, 551 aa] {ON} unipro...    39   0.049
Ecym_1521 Chr1 complement(1074197..1075954) [1758 bp, 585 aa] {O...    39   0.053
ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON...    38   0.053
NCAS0I03210 Chr9 (600725..602431) [1707 bp, 568 aa] {ON}               39   0.054
KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} simila...    38   0.054
KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {O...    38   0.055
NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {O...    38   0.056
KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {...    38   0.058
Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON} (29969....    38   0.060
TBLA0A03410 Chr1 complement(815181..816950) [1770 bp, 589 aa] {O...    38   0.060
YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putati...    38   0.062
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...    38   0.062
AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON} N...    38   0.066
NCAS0H01230 Chr8 (233917..235386) [1470 bp, 489 aa] {ON} Anc_6.155     38   0.066
Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)    38   0.069
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    38   0.072
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...    38   0.074
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               38   0.079
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    38   0.080
Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)    38   0.083
KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {O...    38   0.087
NCAS0G03970 Chr7 (735897..737729) [1833 bp, 610 aa] {ON} Anc_1.4...    38   0.089
Skud_96.1 Chr96 (1..624) [624 bp, 208 aa] {ON} YOL156W (REAL)          37   0.092
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    37   0.098
Ecym_3420 Chr3 (792244..793902) [1659 bp, 552 aa] {ON} similar t...    37   0.10 
Smik_113.1 Chr113 complement(3..554) [552 bp, 184 aa] {ON} YOL15...    36   0.10 
KLLA0B14861g Chr2 complement(1305927..1307690) [1764 bp, 587 aa]...    37   0.10 
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    37   0.11 
NCAS0F04060 Chr6 (809459..811291) [1833 bp, 610 aa] {ON}               37   0.11 
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    37   0.11 
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...    37   0.11 
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...    37   0.11 
NCAS0A03030 Chr1 complement(593557..595281) [1725 bp, 574 aa] {O...    37   0.11 
AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON} Unc...    37   0.12 
CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highl...    37   0.12 
TDEL0E00120 Chr5 (7519..9231) [1713 bp, 570 aa] {ON}                   37   0.12 
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    37   0.12 
Kwal_27.9678 s27 complement(14940..16481) [1542 bp, 513 aa] {ON}...    37   0.12 
YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multid...    37   0.12 
KNAG0C03990 Chr3 (786172..788541) [2370 bp, 789 aa] {ON} Anc_7.3...    37   0.14 
KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly s...    37   0.14 
TBLA0A10350 Chr1 (2550231..2551796) [1566 bp, 521 aa] {ON} Anc_5...    37   0.16 
NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa] ...    37   0.16 
SAKL0G18810g Chr7 complement(1624866..1626581) [1716 bp, 571 aa]...    37   0.17 
KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON}               37   0.17 
TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.3...    37   0.17 
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    37   0.18 
TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {O...    37   0.19 
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...    37   0.20 
Kpol_281.3 s281 complement(9070..10740) [1671 bp, 556 aa] {ON} c...    37   0.20 
ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} simi...    37   0.20 
KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {O...    37   0.21 
TDEL0E02300 Chr5 (447834..449537) [1704 bp, 567 aa] {ON}  YIL170W      37   0.21 
Skud_8.155 Chr8 complement(264872..264913,264917..265015,265033....    36   0.23 
Skud_4.64 Chr4 (108965..111619) [2655 bp, 884 aa] {ON} YDL194W (...    37   0.24 
NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON} Anc_5...    36   0.25 
Suva_4.501 Chr4 complement(873617..875086) [1470 bp, 489 aa] {ON...    36   0.25 
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...    36   0.25 
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               36   0.25 
TDEL0C02370 Chr3 (416622..418817) [2196 bp, 731 aa] {ON} Anc_7.3...    36   0.25 
TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {O...    36   0.25 
TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON} Anc_5...    36   0.25 
Kpol_543.5 s543 complement(10929..12629) [1701 bp, 566 aa] {ON} ...    36   0.26 
TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON}               36   0.26 
ZYRO0D11088g Chr4 complement(937064..938680) [1617 bp, 538 aa] {...    36   0.26 
KAFR0K00100 Chr11 complement(10324..11913) [1590 bp, 529 aa] {ON}      36   0.27 
TDEL0B07220 Chr2 complement(1271585..1273306) [1722 bp, 573 aa] ...    36   0.27 
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             36   0.28 
SAKL0F10362g Chr6 complement(796504..798711) [2208 bp, 735 aa] {...    36   0.28 
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    36   0.28 
Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)    36   0.28 
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               36   0.28 
KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weak...    36   0.28 
Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to ...    36   0.29 
KLTH0D00484g Chr4 complement(44278..45819) [1542 bp, 513 aa] {ON...    36   0.30 
ZYRO0E09900g Chr5 (786545..788164) [1620 bp, 539 aa] {ON} simila...    36   0.31 
Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048...    36   0.32 
TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {O...    36   0.33 
TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa] ...    36   0.34 
TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON}        36   0.34 
KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {...    36   0.35 
Smik_12.140 Chr12 (270030..271751) [1722 bp, 573 aa] {ON} YLR081...    36   0.36 
TDEL0A00150 Chr1 (24714..26414) [1701 bp, 566 aa] {ON}                 36   0.37 
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...    34   0.37 
SAKL0A06050g Chr1 (548837..550408) [1572 bp, 523 aa] {ON} simila...    35   0.37 
CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {...    35   0.39 
Kwal_14.1625 s14 (395421..396941) [1521 bp, 506 aa] {ON} YBR241C...    35   0.39 
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                35   0.39 
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}             35   0.39 
YDL194W Chr4 (111580..114234) [2655 bp, 884 aa] {ON}  SNF3Plasma...    36   0.39 
NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa] ...    35   0.40 
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               35   0.40 
NCAS0B00490 Chr2 complement(71160..73154) [1995 bp, 664 aa] {ON}...    35   0.43 
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}             35   0.43 
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               35   0.44 
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...    35   0.45 
Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C...    35   0.46 
NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {O...    35   0.47 
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    35   0.49 
KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {O...    35   0.50 
TBLA0A07710 Chr1 complement(1905062..1906672) [1611 bp, 536 aa] ...    35   0.51 
KNAG0D05370 Chr4 (984855..986225) [1371 bp, 456 aa] {ON}               35   0.51 
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    35   0.52 
KAFR0E00140 Chr5 complement(25875..27191) [1317 bp, 438 aa] {ON}       35   0.52 
TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30 ...    35   0.52 
Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1...    35   0.52 
KLTH0B00484g Chr2 complement(51712..53412) [1701 bp, 566 aa] {ON...    35   0.54 
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...    35   0.54 
YDR536W Chr4 (1508005..1509714) [1710 bp, 569 aa] {ON}  STL1Glyc...    35   0.55 
Kwal_27.12811 s27 (1383808..1384353) [546 bp, 181 aa] {ON} YDL13...    34   0.55 
YHR094C Chr8 complement(290913..292625) [1713 bp, 570 aa] {ON}  ...    35   0.55 
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     35   0.56 
Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON...    35   0.56 
Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072...    35   0.57 
KLTH0H00308g Chr8 (28695..30227) [1533 bp, 510 aa] {ON} weakly s...    35   0.57 
Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON} (34471....    35   0.59 
TBLA0C01090 Chr3 (223890..226874) [2985 bp, 994 aa] {ON}               35   0.60 
SAKL0B00946g Chr2 (87829..89412) [1584 bp, 527 aa] {ON} similar ...    35   0.62 
Ecym_2262 Chr2 (515606..517051) [1446 bp, 481 aa] {ON} similar t...    35   0.63 
TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON}                 35   0.64 
Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081...    35   0.65 
ZYRO0E03916g Chr5 complement(296502..298217) [1716 bp, 571 aa] {...    35   0.69 
Suva_2.730 Chr2 (1271371..1273059) [1689 bp, 562 aa] {ON} YDR536...    35   0.70 
CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {...    35   0.70 
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    35   0.70 
Suva_4.54 Chr4 (99974..102646) [2673 bp, 890 aa] {ON} YDL194W (R...    35   0.72 
TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa] ...    35   0.76 
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    35   0.76 
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    35   0.77 
SAKL0G15114g Chr7 (1297660..1303800) [6141 bp, 2046 aa] {ON} sim...    35   0.79 
Smik_2.384 Chr2 complement(688838..690304) [1467 bp, 488 aa] {ON...    35   0.79 
TPHA0N01090 Chr14 (227811..229274) [1464 bp, 487 aa] {ON} Anc_6....    35   0.81 
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     35   0.84 
CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {...    35   0.85 
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    34   0.88 
Ecym_1317 Chr1 complement(643844..645484) [1641 bp, 546 aa] {ON}...    34   0.92 
YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}  ...    34   0.94 
YLR081W Chr12 (290212..291936) [1725 bp, 574 aa] {ON}  GAL2Galac...    34   0.95 
KLLA0F06853g Chr6 (656373..657959) [1587 bp, 528 aa] {ON} simila...    34   0.96 
KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {O...    34   0.96 
KLLA0F26246g Chr6 (2432209..2433960) [1752 bp, 583 aa] {ON} high...    34   1.0  
YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein...    34   1.1  
KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]...    34   1.1  
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               34   1.1  
Ecym_1319 Chr1 complement(649182..650789) [1608 bp, 535 aa] {ON}...    34   1.1  
Kwal_34.16190 s34 complement(239113..240783) [1671 bp, 556 aa] {...    34   1.1  
ADL155C Chr4 complement(418382..419842) [1461 bp, 486 aa] {ON} S...    34   1.1  
YDR387C Chr4 complement(1248154..1249821) [1668 bp, 555 aa] {ON}...    34   1.2  
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    34   1.2  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...    34   1.2  
KAFR0K00150 Chr11 complement(37495..39087) [1593 bp, 530 aa] {ON}      34   1.2  
Suva_14.4 Chr14 (4495..6051) [1557 bp, 518 aa] {ON} YCR098C (REAL)     34   1.2  
KNAG0E04270 Chr5 (849856..851529) [1674 bp, 557 aa] {ON}               34   1.2  
KLTH0F15136g Chr6 (1240733..1242346) [1614 bp, 537 aa] {ON} simi...    34   1.2  
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    34   1.2  
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    34   1.3  
Skud_4.809 Chr4 (1427842..1429548) [1707 bp, 568 aa] {ON} YDR536...    34   1.3  
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...    34   1.3  
TPHA0O00950 Chr15 complement(176003..177682) [1680 bp, 559 aa] {...    34   1.3  
KAFR0A08520 Chr1 (1708192..1709877) [1686 bp, 561 aa] {ON} Anc_3...    34   1.3  
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...    34   1.3  
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...    34   1.3  
Kpol_281.2 s281 complement(3711..5390) [1680 bp, 559 aa] {ON} co...    34   1.3  
Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON} (2010...    34   1.4  
NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON}               34   1.4  
KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly...    34   1.4  
Skud_2.373 Chr2 complement(671237..672703) [1467 bp, 488 aa] {ON...    33   1.5  
KLTH0H13728g Chr8 (1199825..1201510) [1686 bp, 561 aa] {ON} simi...    33   1.5  
Smik_4.657 Chr4 complement(1168668..1170332) [1665 bp, 554 aa] {...    33   1.5  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...    33   1.5  
Ecym_1345 Chr1 (711048..712715) [1668 bp, 555 aa] {ON} similar t...    33   1.6  
TBLA0C00430 Chr3 (79303..81042) [1740 bp, 579 aa] {ON} Anc_8.22 ...    33   1.6  
KNAG0I00110 Chr9 complement(5329..7020) [1692 bp, 563 aa] {ON}         33   1.7  
NDAI0A04360 Chr1 (981092..982726) [1635 bp, 544 aa] {ON} Anc_5.469     33   1.7  
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...    33   1.7  
TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa] ...    33   1.7  
KLLA0B07227g Chr2 complement(627833..629695) [1863 bp, 620 aa] {...    33   1.7  
Kpol_1023.17 s1023 (34188..35789) [1602 bp, 533 aa] {ON} (34188....    33   1.8  
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    33   1.8  
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    33   1.8  
Suva_15.41 Chr15 complement(72539..74044) [1506 bp, 501 aa] {ON}...    33   1.8  
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               33   1.9  
Kpol_1010.54 s1010 (122414..124918,125403..125411,126015..129002...    33   1.9  
TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON}       33   1.9  
Kpol_1049.20 s1049 (47753..49456) [1704 bp, 567 aa] {ON} (47753....    33   2.0  
KAFR0B01080 Chr2 (204541..206721) [2181 bp, 726 aa] {ON} Anc_7.3...    33   2.1  
Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {...    33   2.2  
SAKL0B00264g Chr2 (22039..23598) [1560 bp, 519 aa] {ON} similar ...    33   2.3  
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    33   2.3  
NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {O...    33   2.3  
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    33   2.3  
SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON} ...    33   2.4  
Kwal_47.18976 s47 (1049766..1051370) [1605 bp, 534 aa] {ON} YKL2...    33   2.4  
TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {O...    33   2.4  
KLTH0B04510g Chr2 complement(364062..365768) [1707 bp, 568 aa] {...    33   2.6  
TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.3...    33   2.6  
ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON...    33   2.6  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843       33   2.7  
NDAI0G01750 Chr7 (382453..384033) [1581 bp, 526 aa] {ON} Anc_8.22      33   2.7  
Smik_8.172 Chr8 complement(267609..269321) [1713 bp, 570 aa] {ON...    33   2.7  
ZYRO0E09966g Chr5 (793128..794813) [1686 bp, 561 aa] {ON} simila...    33   2.7  
Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W (...    33   2.8  
YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}  HXT2High-...    33   2.9  
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...    33   2.9  
CAGL0A02321g Chr1 complement(252192..253862) [1671 bp, 556 aa] {...    33   2.9  
SAKL0D10450g Chr4 (875475..877151) [1677 bp, 558 aa] {ON} highly...    33   3.1  
TPHA0H01000 Chr8 (207941..213319) [5379 bp, 1792 aa] {ON} Anc_5....    33   3.1  
KAFR0L01310 Chr12 complement(241337..243691) [2355 bp, 784 aa] {...    33   3.2  
ADL095W Chr4 (515206..516693) [1488 bp, 495 aa] {ON} Non-synteni...    33   3.2  
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    33   3.3  
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    33   3.3  
SAKL0G19844g Chr7 (1708176..1709894) [1719 bp, 572 aa] {ON} high...    33   3.4  
Kwal_33.14911 s33 (868216..869928) [1713 bp, 570 aa] {ON} YDR536...    32   3.7  
TPHA0J02740 Chr10 complement(608490..610214) [1725 bp, 574 aa] {...    32   3.7  
Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}...    32   3.9  
KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON}             32   4.2  
Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345...    32   4.3  
Suva_10.43 Chr10 (89159..90922) [1764 bp, 587 aa] {ON} YLL028W (...    32   4.3  
Kwal_14.1105 s14 (197347..198915) [1569 bp, 522 aa] {ON} YFL040W...    32   4.3  
Kwal_33.13849 s33 complement(421362..423203) [1842 bp, 613 aa] {...    32   4.4  
Skud_4.660 Chr4 complement(1168794..1170461) [1668 bp, 555 aa] {...    32   4.4  
KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.3...    32   4.5  
ZYRO0B16808g Chr2 (1368857..1370446) [1590 bp, 529 aa] {ON} simi...    32   4.5  
Smik_3.200 Chr3 complement(296300..297856) [1557 bp, 518 aa] {ON...    32   4.6  
TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {O...    32   4.8  
ADR139C Chr4 complement(950169..951845) [1677 bp, 558 aa] {ON} N...    32   4.9  
Ecym_2797 Chr2 complement(1548238..1549803) [1566 bp, 521 aa] {O...    32   4.9  
Smik_6.68 Chr6 (125842..127482) [1641 bp, 546 aa] {ON} YFL011W (...    32   4.9  
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    32   4.9  
Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON} co...    32   4.9  
YHR092C Chr8 complement(287081..288811) [1731 bp, 576 aa] {ON}  ...    32   5.1  
YBR241C Chr2 complement(702589..704055) [1467 bp, 488 aa] {ON} P...    32   5.1  
YDL199C Chr4 complement(101290..103353) [2064 bp, 687 aa] {ON} P...    32   5.1  
Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W ...    32   5.2  
KLTH0E00132g Chr5 (3262..5010) [1749 bp, 582 aa] {ON} weakly sim...    32   5.3  
KLTH0A00440g Chr1 (37100..38848) [1749 bp, 582 aa] {ON} weakly s...    32   5.3  
SAKL0C07920g Chr3 complement(735512..737317) [1806 bp, 601 aa] {...    32   5.4  
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    32   5.7  
Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON...    32   5.8  
ZYRO0F05786g Chr6 complement(476413..478560) [2148 bp, 715 aa] {...    32   5.8  
NDAI0G00490 Chr7 complement(102674..104494) [1821 bp, 606 aa] {O...    32   6.1  
KNAG0E01100 Chr5 complement(211008..212672) [1665 bp, 554 aa] {O...    32   6.3  
SAKL0B12540g Chr2 complement(1075772..1077490) [1719 bp, 572 aa]...    32   6.5  
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    32   6.5  
ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]...    32   6.7  
TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa] ...    32   6.8  
TPHA0N01930 Chr14 (410871..412556) [1686 bp, 561 aa] {ON}              32   6.8  
Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON} ...    32   7.3  
Smik_15.455 Chr15 complement(784048..786027) [1980 bp, 659 aa] {...    32   7.3  
ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} simila...    32   7.4  
KLTH0G06754g Chr7 (541019..542461) [1443 bp, 480 aa] {ON} simila...    31   7.4  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...    32   7.4  
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}             32   7.5  
KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {...    32   7.6  
ZYRO0G16302g Chr7 complement(1336890..1338533) [1644 bp, 547 aa]...    32   7.6  
KLLA0B00264g Chr2 (12844..14574) [1731 bp, 576 aa] {ON} uniprot|...    32   7.6  
KLLA0D00253g Chr4 (12804..14534) [1731 bp, 576 aa] {ON} highly s...    32   7.6  
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    32   7.9  
TPHA0H01570 Chr8 complement(354813..356744) [1932 bp, 643 aa] {O...    31   8.1  
Smik_7.170 Chr7 complement(303998..305392) [1395 bp, 464 aa] {ON...    31   8.1  
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    31   8.2  
YOR273C Chr15 complement(834452..836431) [1980 bp, 659 aa] {ON} ...    31   8.2  
Skud_8.156 Chr8 complement(264872..264913,264917..265015,265033....    31   8.2  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843       31   8.3  
SAKL0H25498g Chr8 complement(2229233..2231041) [1809 bp, 602 aa]...    31   8.3  
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    31   8.9  
TPHA0A03110 Chr1 (684324..686762) [2439 bp, 812 aa] {ON} Anc_7.3...    31   8.9  
ADR091W Chr4 (872923..874917) [1995 bp, 664 aa] {ON} Syntenic ho...    31   8.9  
KNAG0E03090 Chr5 (616710..618212) [1503 bp, 500 aa] {ON} Anc_8.2...    31   9.0  
ZYRO0E09922g Chr5 (788952..790643) [1692 bp, 563 aa] {ON} simila...    31   9.0  
Smik_4.97 Chr4 (189933..192236) [2304 bp, 767 aa] {ON} YDL138W (...    31   9.4  
AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}...    31   9.5  
CAGL0A01782g Chr1 complement(175018..176724) [1707 bp, 568 aa] {...    31   9.6  
CAGL0C01771g Chr3 (187030..188487) [1458 bp, 485 aa] {ON} simila...    31   9.7  

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 1203 bits (3113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/593 (100%), Positives = 593/593 (100%)

Query: 1   MVQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSEN 60
           MVQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSEN
Sbjct: 1   MVQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSEN 60

Query: 61  EREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSL 120
           EREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSL
Sbjct: 61  EREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSL 120

Query: 121 DKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAG 180
           DKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAG
Sbjct: 121 DKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAG 180

Query: 181 RFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRDWRLAF 240
           RFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRDWRLAF
Sbjct: 181 RFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRDWRLAF 240

Query: 241 ILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSM 300
           ILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSM
Sbjct: 241 ILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSM 300

Query: 301 GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCM 360
           GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCM
Sbjct: 301 GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCM 360

Query: 361 MSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAF 420
           MSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAF
Sbjct: 361 MSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAF 420

Query: 421 CVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSI 480
           CVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSI
Sbjct: 421 CVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSI 480

Query: 481 SYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVH 540
           SYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVH
Sbjct: 481 SYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVH 540

Query: 541 RSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKRGS 593
           RSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKRGS
Sbjct: 541 RSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKRGS 593

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/592 (70%), Positives = 487/592 (82%), Gaps = 6/592 (1%)

Query: 1   MVQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGR-AYGSTTKSSISSE 59
           M   E +  L P+D+D +QDPST L GFVAN++EQQD+  +   G  +YG+T     ++ 
Sbjct: 1   MSPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDY--NSRTGHDSYGATAVDDRTAT 58

Query: 60  NEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNS 119
           + R D    T     + EF L SSRI IIM SMFLGIFLAALDGTIVSTLLT IGSEFNS
Sbjct: 59  SARCDL---TFPPSETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFNS 115

Query: 120 LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVA 179
           LDK SWIATSYLLSSSTCQPLYGKLSD+LGRKPLLVFSN VF+IGCLICG+S SIW VV 
Sbjct: 116 LDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVV 175

Query: 180 GRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRDWRLA 239
           GRF+SGIGGCGLT LA+M++SDLVPLR+RAVYQGLCNF+FGLGTASGGLVGA F+DWR+A
Sbjct: 176 GRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMA 235

Query: 240 FILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSS 299
           F +QCPIS+ S  LIV YLELPPR        W+++LR LDWAG  +L+ FLFLFML SS
Sbjct: 236 FTIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSS 295

Query: 300 MGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFC 359
           +GG  +AY S LFA +C  TLV G++F YVEL VA DPVLP+ FL+ RSVLGSSLANWF 
Sbjct: 296 LGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFA 355

Query: 360 MMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLA 419
           MMSM+TTN+YLPVYW+SVL MK TD+GKR++PSFFSVAFGSLGAG+YMKRTGKYY+FLLA
Sbjct: 356 MMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLA 415

Query: 420 FCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTS 479
           FC + I GQ++I L+TP  PVW+QYLL VVP FG+SVLITVTLLAMI+AVPHEHHAATTS
Sbjct: 416 FCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTS 475

Query: 480 ISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWV 539
           ISYAFRSTGATLGVS+GAA+FRS+L +LL  KV++FASD H   EL  II +AA S++WV
Sbjct: 476 ISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWV 535

Query: 540 HRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591
           H+ AP FVRATL+ECYH+AS++TFKFCL TM+LAG SCSII+EH LHT++KR
Sbjct: 536 HKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKR 587

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/599 (59%), Positives = 445/599 (74%), Gaps = 14/599 (2%)

Query: 4   SEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRA--YGSTTKSSISSENE 61
           +E +P L P+ R+ + DP++DLPGFVA ++E+Q+     EQ  A  Y S  K+++++   
Sbjct: 48  TETTPFLQPIRRELVLDPTSDLPGFVAGELEEQEERCAEEQTNASGYDSIKKNTVATAKT 107

Query: 62  REDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLD 121
            +    +  A   +    L  +RI IIM SM+LGIFLA+LD TIVSTLL HI SEFN + 
Sbjct: 108 IDLETSSIEAKNNTG---LSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMP 164

Query: 122 KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGR 181
             SWIAT+YLLSS+T QPLYGK+SD  GRKPLL+FSN +FA+GCLICGLS  +W +VAGR
Sbjct: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224

Query: 182 FISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----WR 237
           FI+GIGG GLTS++++  SD+VPLR+RA+YQG+CNF FGLGTA GGLVG +F +    WR
Sbjct: 225 FIAGIGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHGGGWR 284

Query: 238 LAFILQCPISVLSGILIVVYLELPPRASAS-----NKDCWSARLRRLDWAGATSLIAFLF 292
           +AF++Q P+  +S  LIV YLELP     S       +  S +LRR+DW GA SL+ FL 
Sbjct: 285 VAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWFGALSLVVFLL 344

Query: 293 LFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS 352
           LFML SS+GG  + + S  F A+C A +V GA FVYVE  V+ DP+LPV FL++R++LGS
Sbjct: 345 LFMLASSLGGKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGS 404

Query: 353 SLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGK 412
           SLANWF MM MMTT+++LPVYW+ VL MK TD+GKR +PSFFS A GSLGAG YMK+TGK
Sbjct: 405 SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK 464

Query: 413 YYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHE 472
           Y + L+AFC LA+ GQ+QI LI P + VWRQY+L V+PGFG+SVLITVTLLAMIAAVPHE
Sbjct: 465 YKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHE 524

Query: 473 HHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASA 532
           H AATTSISYAFRSTG TLGVS+G A+FR SL SLL+  VM+ ASD H   EL  II SA
Sbjct: 525 HQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSA 584

Query: 533 ARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591
           A SSD++H SAP FVR  L+E YHFA R T+KFCL ++  A +SC  +KE+KLHTS+ R
Sbjct: 585 AHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSMDR 643

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/592 (57%), Positives = 436/592 (73%), Gaps = 21/592 (3%)

Query: 6   HSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSI-SSENERED 64
            + LL P+  + +QDPSTDLPGFVA +I QQ+     E    YGS T      +++ER  
Sbjct: 45  EASLLLPIKPEILQDPSTDLPGFVAEEIGQQE-----EVANGYGSITDPHDGDNKSERPV 99

Query: 65  AGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKAS 124
           +    ++G          +R+ +IM SM+LGIFLAA+D TIVST   H+ SEFN L K S
Sbjct: 100 STAEEISG----------ARLRVIMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVS 149

Query: 125 WIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFIS 184
           WIATSYLLSS+T QPLYGK+SD  GRK LLVF+N  F IGCL+CGLS S W +V  RF++
Sbjct: 150 WIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVA 209

Query: 185 GIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----WRLAF 240
           G+GG GLTS++++ ++DLVPLR+RA+YQG+CN  +GLGTA GG+VG +F D    WR+AF
Sbjct: 210 GVGGGGLTSMSSITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDNKGGWRMAF 269

Query: 241 ILQCPISVLSGILIVVYLELPPRASASNKDCWSAR-LRRLDWAGATSLIAFLFLFMLTSS 299
           ++Q P+S +S ++I+++L+LP + +  N+D    R L  +DW GA++L+ FL LF+LT+S
Sbjct: 270 LIQVPLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLAIDWLGASTLVIFLVLFLLTAS 329

Query: 300 MGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFC 359
           +GG  +AYGSR FA M  ++L+   VF+YVELRVAADP+LP+ FL  RSVLGSSL+NWFC
Sbjct: 330 LGGKEIAYGSRTFALMLISSLLSCLVFIYVELRVAADPILPLRFLAIRSVLGSSLSNWFC 389

Query: 360 MMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLA 419
           MM+ MTT++YLP+Y+S VL M  TDVGKR MP+FFSVAFGSLGAG YMK+T KYY+F L 
Sbjct: 390 MMATMTTSYYLPIYFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKTRKYYWFSLI 449

Query: 420 FCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTS 479
           FC +A+ GQ+QI+LI P++P WRQY+L +VPG G SVLITV LLAMIAAVPHEH AATTS
Sbjct: 450 FCAVAVLGQLQILLIDPKIPTWRQYILLLVPGVGTSVLITVALLAMIAAVPHEHQAATTS 509

Query: 480 ISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWV 539
           ISYAFRS G TLGVS+G A+FR SL+ L    V+R+ S  H + EL  II  A+ SS+WV
Sbjct: 510 ISYAFRSAGCTLGVSIGGAIFRESLSKLTTRYVLRYISKEHPKEELLKIIDKASESSEWV 569

Query: 540 HRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591
           H SAP F+R TLLECYH A + TF FC    +L  VS SIIKE KLH+S+ R
Sbjct: 570 HHSAPDFIRQTLLECYHKACKNTFLFCFICSILTLVSFSIIKEKKLHSSLDR 621

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/593 (55%), Positives = 432/593 (72%), Gaps = 20/593 (3%)

Query: 4   SEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENERE 63
           +  +  L PV  D +QD STD+PGFVA ++E+++ L    QG  YGS     I +E++  
Sbjct: 11  TSRTNFLNPVRDDILQDASTDIPGFVAEELEEREELYRECQGTDYGS-----IDNEDDSR 65

Query: 64  DAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKA 123
           D         G A   +P  ++L+I  SM+LGIFLAA DGT+VST++ HI SEFN L + 
Sbjct: 66  D---------GVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRI 116

Query: 124 SWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFI 183
           SWIAT+YLLSS+T QPLYGKLSD  GRKPLL+ +N VF +GCL+CGL+ S W +V  RFI
Sbjct: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFI 176

Query: 184 SGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----WRLA 239
           SGIGG G+TS+ ++ +SD+VPLRDRA+YQG+CNF FGLGTA GG+VG +F D    WR+A
Sbjct: 177 SGIGGGGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWRMA 236

Query: 240 FILQCPISVLSGILIVVYLELPPRASASNKDC-WSARLRRLDWAGATSLIAFLFLFMLTS 298
           F++Q P+S LS +LI V+++LPPR+   N       +L  +DW GA++L+ FL LF++T+
Sbjct: 237 FLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVVFLSLFLVTA 296

Query: 299 SMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWF 358
           S+GG  +A+ S+ F A+C  + +  A F+ VEL  A DP+LP++FLR+RSVLGSS +NWF
Sbjct: 297 SLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWF 356

Query: 359 CMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLL 418
           CMM+MMTT++YLP+Y+S VL M  T VGKR MP+FFS A GSLGAG YMKRTGKYY+  +
Sbjct: 357 CMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTV 416

Query: 419 AFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATT 478
            FC L++ G +QI L+ P +  WRQ++L V+PGFG SVLITV LLAMIAAVPH HHAATT
Sbjct: 417 GFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATT 476

Query: 479 SISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDW 538
           SISYAFRSTG+TLGVS+G A+FR SL  LL  KV++FA D H  +EL  II  A++SS+W
Sbjct: 477 SISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFA-DKHPRKELLEIIEKASKSSEW 535

Query: 539 VHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591
           VH SAP F+R TL+ CYHFA + TF FC    +    S SIIKE+KLH S+ R
Sbjct: 536 VHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDR 588

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/602 (52%), Positives = 431/602 (71%), Gaps = 28/602 (4%)

Query: 3   QSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENER 62
           + + + +L P+  + +QDPST+LPGF+A +IE+ +   +  +   YG+     ISS+   
Sbjct: 55  EDDENSVLLPIRDELLQDPSTELPGFIAAEIEEGEQEYEETRSGHYGAIESRRISSKGTE 114

Query: 63  EDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDK 122
                            L ++R+ IIM SM+LGIFLAALD TIVSTLL HI SEFN L +
Sbjct: 115 -----------------LSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPR 157

Query: 123 ASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRF 182
            SW+AT+YLLSS+T QP+YGK+SD  GRK +L+F N  F +G LICGLS S   +VAGRF
Sbjct: 158 ISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRF 217

Query: 183 ISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----WRL 238
           I+GIGG G+TS++++  SD+VPLR+RA+YQG+CNF FGLGTA GG+VG +F D    WR+
Sbjct: 218 IAGIGGGGITSMSSITTSDIVPLRNRALYQGICNFYFGLGTALGGVVGGWFSDRSVGWRM 277

Query: 239 AFILQCPISVLSGILIVVYLELPPRASAS----NKDCWSA---RLRRLDWAGATSLIAFL 291
           +F++Q PI+  S ILI+++L LP  +       + + +S    RL  +DW GAT+L+ FL
Sbjct: 278 SFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFL 337

Query: 292 FLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLG 351
           F FM+T+S+GG  + Y S  F  +C  T++   +F Y EL++A DP+LP+ FL+DRSVLG
Sbjct: 338 FSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLG 397

Query: 352 SSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTG 411
           SSL+NWFCMM++MT ++YLP+Y++ VL MK TD+GKR +P+FFS AFGSLGAG YMK+TG
Sbjct: 398 SSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTG 457

Query: 412 KYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPH 471
           KYY+F+++FCVLA  G +QIV I P + V++QY L  +PG G SVLITV LLAMIAAVPH
Sbjct: 458 KYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPH 517

Query: 472 EHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIAS 531
            H A TTSISYAFRSTG TLGVS+G A+FR SL +LL +KV++F S  HSE EL  II  
Sbjct: 518 NHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDK 577

Query: 532 AARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591
           A++S++WV  S+P F++ TL++CYHFA +  F FCL   + A  S +IIKEH+LH ++ R
Sbjct: 578 ASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDR 637

Query: 592 GS 593
            +
Sbjct: 638 DN 639

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/603 (52%), Positives = 423/603 (70%), Gaps = 37/603 (6%)

Query: 1   MVQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSEN 60
           MV+S+ + LL PV      + S  LP +V  ++ + +HLL                  E+
Sbjct: 1   MVESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLL------------------ES 42

Query: 61  EREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSL 120
           E E   G  V+    A       R+ II+ SM LG FLAALD TIV+TLL+HI SEFN L
Sbjct: 43  EDEAREGLQVSEMSRA-------RLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNEL 95

Query: 121 DKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAG 180
              SWIAT+YLLSS+T QPLYGK+SD  GR+PL++ SN  F +GCLICGLS ++W +VAG
Sbjct: 96  SHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAG 155

Query: 181 RFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----W 236
           RFI+GIGG G+TSL ++  SD+VPLR RA+YQG+ NF FGLG A GGL+G +F +    W
Sbjct: 156 RFIAGIGGGGVTSLGSITASDIVPLRSRALYQGIFNFFFGLGIAIGGLIGGWFSESKNGW 215

Query: 237 RLAFILQCPISVLSGILIVVYLELPPRAS-----ASNKDCW---SARLRRLDWAGATSLI 288
           R+AF++Q P+  +S +LI+++L+LPP        +++KD       +L+R+DW G+ SL+
Sbjct: 216 RMAFLVQVPLCAISLVLIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLKRIDWLGSLSLV 275

Query: 289 AFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRS 348
            FLF FML SS+GG  + Y S +F  +  AT++ G  F+YVEL ++ DP+LP+ FL +RS
Sbjct: 276 TFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRS 335

Query: 349 VLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMK 408
           +LG+S ANWFCMMS +T  FY+PVYWSSV  +K TD+GKR  P+FFS AFGS+GAG YMK
Sbjct: 336 ILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMK 395

Query: 409 RTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAA 468
           +TG+YY FLL F  L + GQ+Q++L+ P +  WRQY+L  +P FG SVLITVTLLAMIAA
Sbjct: 396 KTGRYYGFLLKFTGLMVLGQLQVLLMKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAA 455

Query: 469 VPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGI 528
           VPHEH AATTSISYAFRSTG+TLGVSVGAA+FR+ L+  L   VM+F SD +S+  L  I
Sbjct: 456 VPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSI 515

Query: 529 IASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTS 588
           I  A+ SS++VH +AP F++ATL++CY  A ++TF FC    + A +SC +IKE+KLHTS
Sbjct: 516 IKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTS 575

Query: 589 IKR 591
           ++R
Sbjct: 576 MER 578

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/615 (51%), Positives = 425/615 (69%), Gaps = 41/615 (6%)

Query: 2   VQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHL-----LDIEQGRAYGSTTKSSI 56
           VQ + SPLL  +  + +QD S  LPGFVA +IE+++ L     +   Q   YGS   +SI
Sbjct: 22  VQEDKSPLLHAIRGELLQDSSFSLPGFVAAEIEEREELYREASIASNQHHDYGSVA-NSI 80

Query: 57  SSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSE 116
             +N++ +               L  +R+ + M SM+LGIFL+ALD TIVSTLL  IGSE
Sbjct: 81  ILDNDKNN---------------LSPTRLRLAMSSMYLGIFLSALDNTIVSTLLARIGSE 125

Query: 117 FNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWA 176
           FN L + SWIAT+YLLSS+T QPLYGK+SD  GRK +L F N  F IGCLICG + S W 
Sbjct: 126 FNELPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWV 185

Query: 177 VVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD- 235
           +V GRFISG+GG G+TS++T+ +SD++PLR+RA+YQG+CNF +GLG A GG++G +F + 
Sbjct: 186 LVIGRFISGVGGGGITSMSTITVSDIIPLRNRALYQGVCNFYYGLGIALGGIIGGWFTEK 245

Query: 236 ---WRLAFILQCPISVLSGILIVVYLELPPRA-----------SASNKDCWS---ARLRR 278
              WR AF+ Q P+SV+S + ++V+L+LP  +           ++SN    S    +L+ 
Sbjct: 246 LGSWRGAFLFQVPLSVISTVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTESIIMKKLKT 305

Query: 279 LDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPV 338
           +DW GA SL+ FL  FM+ SS GGS ++  S  F  +   ++     F+Y+EL+ A DP+
Sbjct: 306 IDWYGAMSLVIFLLSFMILSSAGGSDISVKSNTFLYLTLISVTSFISFIYIELKFAKDPI 365

Query: 339 LPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAF 398
           LP+ FL+DRSVLGSSL+NWF MM +MT ++YLP+Y++SV+G+ A DVGKR +P+FFSVAF
Sbjct: 366 LPLVFLKDRSVLGSSLSNWFTMMLLMTISYYLPIYFTSVMGIGAYDVGKRTLPNFFSVAF 425

Query: 399 GSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLI 458
           GSLGAG YMK+TGKYY+F+  FC++ + G +QI LI   + VWRQYLL  VPG G +VLI
Sbjct: 426 GSLGAGYYMKKTGKYYWFVTFFCLVVVIGCLQIYLINDGISVWRQYLLSFVPGLGAAVLI 485

Query: 459 TVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASD 518
           T+ LL+MI AVPHE+ A TTSISYAFRSTG TLGVS+GAA+FR SL   L AK++   S 
Sbjct: 486 TIALLSMIVAVPHEYQAVTTSISYAFRSTGCTLGVSIGAALFRDSLNKYLRAKILELGSQ 545

Query: 519 --GHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVS 576
              +SE+EL  II  A++S DWVH  AP F + T+LECYH+A +  F FCL   VLA +S
Sbjct: 546 NGNYSEKELLQIIDHASKSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVLALLS 605

Query: 577 CSIIKEHKLHTSIKR 591
            S+IKEHKLH+S+ R
Sbjct: 606 ISMIKEHKLHSSLDR 620

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/614 (51%), Positives = 411/614 (66%), Gaps = 54/614 (8%)

Query: 5   EHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISS------ 58
           E S LL       + DPS+ L G VA+++E Q       Q     + T  S+++      
Sbjct: 54  EQSGLLEASRGTLVSDPSSGLSGLVASELEVQ------RQQEVCAAVTAESMATSGSGSS 107

Query: 59  -----------------ENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAAL 101
                            E  +EDAGG            L ++R  ++M SM LG+FLAAL
Sbjct: 108 YGSTQKPTEVYLTATAVEAAKEDAGG------------LGATRRRVVMASMCLGVFLAAL 155

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161
           DGTIV+TLL HI SEFN L + SWIAT+YLLSS+T QPLYGKLSD  GR+PLLVFSN VF
Sbjct: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215

Query: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221
            +G LICG+S ++W +V GRF++GIGG GLTS+ ++  +D+VPLR RA+YQG+CN  FGL
Sbjct: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFGL 275

Query: 222 GTASGGLVGAYFRD----WRLAFILQCPISVLSGILIVVYLELPP-----RASASNKDCW 272
           GTA GGLVG  F D    WR+AF++Q P+++LS   I ++L LP      + +      W
Sbjct: 276 GTACGGLVGGLFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPW 335

Query: 273 SARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELR 332
           + +LR +DW G  +L+ FLF F L  S+ G  + +   +F  +    L+ G+ F+Y EL 
Sbjct: 336 TTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVI----LLSGSYFIYHELY 391

Query: 333 VAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPS 392
           VA DP+LP+ FL +RSVL +SL+NWFCMM MMTT FY+PVY++SVL M  TD+GKR +PS
Sbjct: 392 VATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPS 451

Query: 393 FFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGF 452
           FFS AFGSLGAG YMKRTGKYY+FLLAFC++ + GQVQI  +TP +  WRQY L ++PGF
Sbjct: 452 FFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGF 511

Query: 453 GVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKV 512
           G +VL+TVTLLA+I AVP  H AATTSISYAFRSTG+TLGVS+G A+FR+ L++ L +K+
Sbjct: 512 GSAVLLTVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571

Query: 513 MRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVL 572
           M   S  H   EL  II  AA S++WVH+ AP F R  L++CYH+A R TF FCL  MVL
Sbjct: 572 MPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVL 631

Query: 573 AGVSCSIIKEHKLH 586
           A V+C  I E+KLH
Sbjct: 632 ATVACCFIVEYKLH 645

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/596 (48%), Positives = 388/596 (65%), Gaps = 25/596 (4%)

Query: 2   VQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQ-QDHLL---DIEQGRAYGSTTKSSIS 57
           + +E + LL     D + D         + +I+  Q H L   ++++ R  G+ + +  S
Sbjct: 10  IPNERTHLLDRTLEDGIGDSDMLNSDLKSTKIKHTQRHQLYHSNLDKARN-GNDSATDFS 68

Query: 58  SENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEF 117
           S N  +                L S RI +I  SMFLGIFLAALD TIVSTLL HIGSE 
Sbjct: 69  SNNLSD----------------LMSRRIFMISASMFLGIFLAALDNTIVSTLLPHIGSEL 112

Query: 118 NSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAV 177
           N +   S +ATSY+ S +  QPL+GK SD  GRKPLL+ SN +F  GCL CGLS +IW +
Sbjct: 113 NDMPNVSLVATSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWL 172

Query: 178 VAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD-- 235
           + GR ++GIGG GLTS+ T+I++D+VPLR+RAVYQG  N  + LGTA GGLVG  F +  
Sbjct: 173 ILGRLVTGIGGGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYG 232

Query: 236 --WRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFL 293
             WR+AF++Q P   LS I I+VYL+L        +     +LR +DW GA +L+ FL L
Sbjct: 233 NGWRMAFMIQLPFCFLSTISIIVYLDLSDDKQDLGRSSLYCKLRLIDWLGALTLVTFLLL 292

Query: 294 FMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSS 353
           F++T ++GG  V YGS  F  +C A    G    YVE+ +A DP+LP++FLR+++VLGSS
Sbjct: 293 FLVTMTIGGQHVPYGSLRFFLLCVAVCASGLALAYVEIFLANDPILPISFLRNKNVLGSS 352

Query: 354 LANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKY 413
           LANWFCMM MMT  +YLP+YWSSV       VGK+++PSFFS+A GS G   Y+++ G Y
Sbjct: 353 LANWFCMMGMMTITYYLPIYWSSVSNQGPIQVGKKSIPSFFSMALGSFGTAYYVQKNGTY 412

Query: 414 YYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEH 473
           Y  L+  C++ I GQ+QIV ITP+MP WRQY+L  VPGFGVS+LITVTLLAMIAAVPH+H
Sbjct: 413 YRLLMTSCLIIIFGQLQIVYITPEMPQWRQYILLAVPGFGVSILITVTLLAMIAAVPHKH 472

Query: 474 HAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAA 533
            AATTS+SYAFR+TG  +G S+  A+F+++L   +   VM+F  D HS++EL  +I  A 
Sbjct: 473 QAATTSLSYAFRTTGCIIGASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKELNLVIEKAL 532

Query: 534 RSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSI 589
           RSSDWV+  +P FV   LL+CY  A   TF+FCL   +L  +SCS I E  L T++
Sbjct: 533 RSSDWVNNGSPEFVHEALLKCYENACGQTFRFCLLCFLLTVISCSFITEINLPTTL 588

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score =  517 bits (1331), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 287/592 (48%), Positives = 392/592 (66%), Gaps = 19/592 (3%)

Query: 5   EHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENERED 64
           + S +L P+  + +QD STD+ GFVA ++E+ +      +    G    +S +S      
Sbjct: 326 DSSQILKPIRDEFIQDASTDIAGFVAGELEEIEEEAREAREGEEGEALITSTASY----- 380

Query: 65  AGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKAS 124
               T+    S E  + + ++ IIM SM+LG+FLAALD T+VSTL+ HIGSEFN + K  
Sbjct: 381 ---GTLPIEPSVE--MSNMKMNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVP 435

Query: 125 WIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFIS 184
           W+ATSYLLSS+  QPLYGKLSD  GRK LL+FSN +F  GC+ICG+SNS+  +V GRF++
Sbjct: 436 WVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVA 495

Query: 185 GIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----WRLAF 240
           GIGG G+TS+ T+ +SD+VPLR RAVYQG+CNF FGLGTA GG++G  F D    WR+ F
Sbjct: 496 GIGGGGITSMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMVF 555

Query: 241 ILQCPISVLSGILIVVYLELPPRASASNKDCWSAR-LRRLDWAGATSLIAFLFLFML-TS 298
             Q P+S LS +LI  +L +P      N +    R L R+DW G+ S+I +L  F+L T+
Sbjct: 556 WSQVPVSGLSTLLICSFLVVP---RIKNYEVSLGRKLMRVDWLGSISMILWLTSFLLITT 612

Query: 299 SMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWF 358
            MGG S+   S  F  +   + V   +FV  EL VA+DPVLP+ FL +RSVLG+SL N+F
Sbjct: 613 MMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASLGNFF 672

Query: 359 CMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLL 418
           C+M  MT  FYLP+Y++SVL +  T +GKR  P+F   A GSLGAG+YMK+TGKYY+F++
Sbjct: 673 CVMGFMTICFYLPIYFASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGKYYWFVV 732

Query: 419 AFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATT 478
            F +++  G   + LI   + +  QYLL V+PG G S++I V LLAMIAAVPH+H AATT
Sbjct: 733 LFALVSTLGHYYLTLIPLTVSITVQYLLVVLPGVGSSIIIVVALLAMIAAVPHKHQAATT 792

Query: 479 SISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDW 538
           SISYAFRSTG TLGV++G++VF  +L   L   V+ + S  H  +EL  II  A+ S++W
Sbjct: 793 SISYAFRSTGGTLGVALGSSVFHRTLIKRLHTDVLEYVSPEHPRKELLRIIKKASHSTEW 852

Query: 539 VHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIK 590
           VHR AP F+R TL+ CY  A    F FC    +LA +S ++I+E +L T ++
Sbjct: 853 VHRKAPTFIRDTLITCYDVACHDVFVFCTACALLAAISLALIREERLATGLR 904

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score =  466 bits (1198), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 254/605 (41%), Positives = 365/605 (60%), Gaps = 24/605 (3%)

Query: 3   QSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRA-------YGSTTKSS 55
           Q E  P LT +D++ +QD S+  PGFV N++E Q+  L     ++       YGST+ + 
Sbjct: 59  QGETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTV 118

Query: 56  ISSENERED----AGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLT 111
               N+  +    +    V   G ++  +   R   I+ S+ +G+FL +LDGTI+STLL 
Sbjct: 119 TPDSNKNGNVFIRSSSVEVGNIGDSQ-NISQIRFAAIVSSLVVGVFLGSLDGTILSTLLD 177

Query: 112 HIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLS 171
           +I SEF +L   SWIA SYLLS+   QPLYGKLSD  GRK +L+FSN +F +GCL+CG +
Sbjct: 178 YIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTA 237

Query: 172 NSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGA 231
            ++W ++AGRF++GIGG GLTS+ ++I+SD+VPLR RA YQ L N  + LG   GG +G 
Sbjct: 238 PTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGG 297

Query: 232 YFRD---WRLAFILQCPISVLSGILIVVYLELPPRASAS-----NKDCWSARLRRLDWAG 283
           +  +   WRL F+LQ   +++SG  I  +L LP     +     NK+    +L  +DW G
Sbjct: 298 WLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLG 357

Query: 284 ATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTF 343
              L+ FL    LT S+    V         +     V G  FVY EL +AADP+L V  
Sbjct: 358 TFCLVIFLASLTLTCSL----VDLNFNFLLLLILLMFVSGYYFVYHELNIAADPILSVHL 413

Query: 344 LRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGA 403
           L DR+VL SSLAN+FCM++ + T FY+P+Y++SVL M   ++GKR + SF   + GS G 
Sbjct: 414 LTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGT 473

Query: 404 GLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLL 463
           G Y+KR GKY  F+   C++ I GQ+QI LI P +  WRQYLL ++P    + + T  L+
Sbjct: 474 GYYIKRRGKYRTFICLACIIGILGQLQIALIKPSISTWRQYLLLLIPILYTTTVRTSLLI 533

Query: 464 AMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSER 523
           ++IAAVP+++  A  SISY FRSTGA LG S+G  +FRSSL SLL+  +M   S+ H + 
Sbjct: 534 SLIAAVPYKNQTAAASISYTFRSTGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHPKS 593

Query: 524 ELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEH 583
           +L  II  A  S+DWVHR +P +    L+ CYH+  +  F F +  ++   +SC  +KE+
Sbjct: 594 QLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEY 653

Query: 584 KLHTS 588
            +H S
Sbjct: 654 PVHAS 658

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score =  359 bits (921), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 215/523 (41%), Positives = 315/523 (60%), Gaps = 23/523 (4%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+F++F+G +LAALD TIV+TLL  I SE ++ ++ SWIATSYLLS S  QPLYGKLSD 
Sbjct: 34  IVFALFVGSYLAALDTTIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDV 93

Query: 148 LGRKPLLVFSNAVFAIGCLICG--LSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
            GRKPLL++SN  F  GC++CG   + S+W +  GRFI+G+GG GL SL+T+  SD++PL
Sbjct: 94  FGRKPLLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITTSDIIPL 153

Query: 206 RDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPP 262
           R R VYQG+ N VF LG ASG L+GA+ +    WR AF+ Q P+S+LS  LI+ +L LP 
Sbjct: 154 RQRGVYQGMGNIVFALGCASGSLIGAFLQQRIGWRWAFLCQVPLSLLSCSLIMKFLNLPA 213

Query: 263 RA------SASNKDCWSARLRR-LDWAGATSLIAFLFLFMLTSSM--GGSSVAYGSRLFA 313
            +      + SNK   +A +R  +D+ G+ +LI  + L M+  S+    S + YG+  +A
Sbjct: 214 GSPGRGLINLSNKKITTADVREHVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGT--WA 271

Query: 314 AMCAATLVFGAVFVYVELRVAADPVLPVTFL-RDRSVLGSSLANWFCMMSMMTTNFYLPV 372
                  + G  FV  EL V  +P++P+  L  +R+VL SSL NWF  MS     +Y+PV
Sbjct: 272 LFIVGLALAGYTFVSTELSV-HNPMVPIRLLGSNRTVLASSLTNWFFTMSTFVLAYYVPV 330

Query: 373 YWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIV 432
           +W +V  +K  ++G R + +FF +A GS+  GLYMKRTGKY         + +AG + + 
Sbjct: 331 FWQTVYHLKPWNIGVRTVSNFFGIAIGSMMTGLYMKRTGKYKALSNTLNTVTVAGTLIVY 390

Query: 433 LIT--PQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGAT 490
           L T   +     +Y +  +PG G + ++T+TLL++IA+V   H A  TSI YAFR+ G+T
Sbjct: 391 LSTYNTEPKGLLEYFMLFLPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFRAIGST 450

Query: 491 LGVSVGAAVFRSSL-TSLLDAKV-MRFASDGHSERELRGIIASAARSSDWVHRSAPPFVR 548
           LGVS    +++S L TSLL   V  +  +D +S  +LR    +   ++ +   S  P + 
Sbjct: 451 LGVSFAGLIYQSKLQTSLLRNIVENKTLNDKYSTHQLRKWCQTLLENNSF-DVSFDPLLE 509

Query: 549 ATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591
           +     +   SR    F +   +L  +S   I+EH LHT I+R
Sbjct: 510 SLAKISFQGGSRLVLGFAVLASILGLLSSLFIREHVLHTDIQR 552

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score =  342 bits (877), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/541 (38%), Positives = 310/541 (57%), Gaps = 40/541 (7%)

Query: 80  LPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQP 139
           LP +++ I + ++ +G FL+ALD TIV+TLL  I S+ ++  + SWIAT+YLLS S  QP
Sbjct: 35  LPPTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDASSQMSWIATAYLLSCSAFQP 94

Query: 140 LYGKLSDRLGRKPLLVFSNAVFAIGCLICG--LSNSIWAVVAGRFISGIGGCGLTSLATM 197
           LYGKLSD  GRK LL+ SN  FA+GC ICG   +N++W +  GRF++GIGG G  +L+T+
Sbjct: 95  LYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVLSTGRFVAGIGGGGQATLSTI 154

Query: 198 IMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILI 254
             SD++PLR R VYQGL N  F LG ASG ++GA  +    WR AF++Q P++++  ++I
Sbjct: 155 TTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVLQQGIGWRWAFLVQVPMALVCALMI 214

Query: 255 VVYLELPPRASA----------SNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSS 304
            V L+LP  +              +  W      +D+ G+ +LIA + L M   S+    
Sbjct: 215 AVVLDLPADSPGRGLLWLELKRGKRLKWCTVTEMVDFVGSFTLIASMILLMTAISLLSDP 274

Query: 305 VAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFL-RDRSVLGSSLANWFCMMSM 363
               + L+  +          F Y E     +P++P+  L  +R+V  SS  NWF  M+ 
Sbjct: 275 TQLSTSLWLLLGVLLTASSLQFAYTEC-TTRNPMVPLRLLWENRTVCASSFTNWFMTMTT 333

Query: 364 MTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVL 423
            T  +Y+PV+W +V      D+G R+M +F  +A GS+ AG+YMKRTGKY+ F +A   L
Sbjct: 334 FTVMYYVPVFWHTVYKFTPWDIGVRSMSNFVGIASGSMLAGMYMKRTGKYWSFSVATNSL 393

Query: 424 AIAGQVQIVLI----TPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTS 479
              G + +       +PQ  V  +YLL  +PGFG + ++TVTLLA+IA+V  EH A  TS
Sbjct: 394 FAVGVLSLFAFSFKGSPQGVV--EYLLMFLPGFGYATMLTVTLLALIASVSVEHQAQVTS 451

Query: 480 ISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDG-----HSEREL----RGIIA 530
           I YAFR+TG+TLGV++ + +++S L S L   V+   +DG     +  R L    + I+ 
Sbjct: 452 IQYAFRATGSTLGVALASLIYQSCLQSRLYNNVL---TDGPLLAQYGSRRLMDWCQSILQ 508

Query: 531 SAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIK 590
             +    + HR A   VR    + + F+++    F     VL  +S   ++EH LHTS+ 
Sbjct: 509 DNSFDISFDHRLA-ELVR----QGFQFSNQCALGFAFVVCVLGVLSSCFMREHVLHTSVS 563

Query: 591 R 591
           R
Sbjct: 564 R 564

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score =  328 bits (842), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 213/537 (39%), Positives = 309/537 (57%), Gaps = 36/537 (6%)

Query: 80  LPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQP 139
           L  ++  II+ ++FLG FL+ALD TIVSTLL  I S+ ++  + SWIATSYLLS S  QP
Sbjct: 35  LTETKTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDASSQMSWIATSYLLSCSAFQP 94

Query: 140 LYGKLSDRLGRKPLLVFSNAVFAIGCLICG--LSNSIWAVVAGRFISGIGGCGLTSLATM 197
           LYGKLSD  GRK LLV+SN VFAIGC +CG   + +IW + AGRFI+GIGG GLT+L+T+
Sbjct: 95  LYGKLSDIFGRKILLVWSNLVFAIGCALCGSPWTTNIWILSAGRFIAGIGGGGLTTLSTI 154

Query: 198 IMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILI 254
             SD++PLR R VYQGL N  F LG ASG ++GA  +    WR AF++Q PI+++SG+LI
Sbjct: 155 TTSDIIPLRKRGVYQGLGNICFSLGCASGSVLGAVLQQGIGWRWAFLIQVPIALISGLLI 214

Query: 255 VVYLELPPRA----------SASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSS 304
           V  LELP  +          +  N   WS   + +D+ G+ +L+  + L M+T S     
Sbjct: 215 VFVLELPSDSPGRGLIWLEHARGNTFQWSKVTKMIDFVGSITLVMSMLLLMITISFLSDP 274

Query: 305 VAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFL-RDRSVLGSSLANWFCMMSM 363
                  +  +      F A FV+ E  +  +P++P+  L  +R+V  SS  NWF  MS 
Sbjct: 275 SQLSENSWVVLVLLVAGFCAKFVHTECTI-HNPMVPLRLLWENRTVFASSFTNWFMTMST 333

Query: 364 MTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVL 423
               +Y+PV+W +V      D+G R++ +F  +A GS+ AG+YMK TGKY+ F L   +L
Sbjct: 334 FAVMYYIPVFWQTVFKFTPYDIGFRSISNFVGIATGSMLAGVYMKCTGKYWNFSLVTNIL 393

Query: 424 AIAGQVQIVLI----TPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTS 479
              G + +       TPQ  +  +YLL  +PGFG + ++TVTLLA+IA+V  EH A  TS
Sbjct: 394 YFTGILSLFACTFRNTPQGVL--EYLLMFLPGFGYATMLTVTLLALIASVDFEHQAQVTS 451

Query: 480 ISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVM-------RFASDGHSERELRGIIASA 532
           I YAFR+TG+TLGVS+   ++++SL   L   ++       ++  D    +  + I+   
Sbjct: 452 IQYAFRATGSTLGVSLAGLIYQASLQYKLYRDILGDQTLLGKYGQD-QLRKWCKEILQDN 510

Query: 533 ARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSI 589
           +  + +  R A    R      + F+S     F L    L  V    ++EH L  ++
Sbjct: 511 SFDTSFDQRLAKEVHRG-----FQFSSECALGFALAACTLGVVLSCFMREHVLGKTV 562

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score =  208 bits (529), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 153/512 (29%), Positives = 262/512 (51%), Gaps = 32/512 (6%)

Query: 83  SRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYG 142
           +RIL+I  ++F  +FL+ LD TI +++   IG+EF  +  +SWI T+YL++ ++ QPLYG
Sbjct: 43  NRILLIETALFTNVFLSGLDSTITASIYQLIGNEFEDVKVSSWITTAYLVTCTSFQPLYG 102

Query: 143 KLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDL 202
             SD LGR+  L F+N +FA+GCL CGL+++I++++  R ++GIGG GL +L+T++ SD+
Sbjct: 103 SFSDTLGRRRCLFFANTIFALGCLGCGLTSTIYSLIIMRAVTGIGGGGLITLSTIVNSDI 162

Query: 203 VPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLE 259
           +P + R +YQ   N + G G   G   G        WR  F+LQ PIS+   ++  ++++
Sbjct: 163 IPAKKRGMYQSFQNILVGTGAVVGASCGGEIASSMGWRWCFLLQVPISIGGAVMAYLFVQ 222

Query: 260 ------LPPRASASNKDCWSARLRRLDWAGATSLIA-----FLFLFMLTSSMGGSSVAYG 308
                   PR+ A   +   ++++++D+ GA  LI+      +FL + +S+  G S    
Sbjct: 223 DQDVVDKNPRSGALPSNV--SKIKKIDFLGAFLLISGLVSQLIFLTINSSAQEGKSTWLS 280

Query: 309 SRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFL---RDRSVLGSSLANWFCMMSMMT 365
            R   A+   T V   +F YVE    A+P++P   L      +VL   +   F   + + 
Sbjct: 281 GRSL-ALGLVTAVSLILFAYVEKTTTANPIIPHDLLGQWYSTTVLIVGVLVGFVSYAYI- 338

Query: 366 TNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAI 425
             F LP+Y+  V+G  A + G R     F    G +  G+ MK   +    L+    L +
Sbjct: 339 --FTLPLYFQVVVGDTAAEAGLRLTVPSFCTPIGGVIMGISMKDPKRLPGLLIVGISLML 396

Query: 426 AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFR 485
            G +  +LI P  P W   LL V    G  +    TL + + A P    A  T+  Y FR
Sbjct: 397 FGNLCFLLIKPTTPYWLTSLLLVPANIGQGITFPSTLFSFLFAFPPYKQATATATLYLFR 456

Query: 486 STGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPP 545
           S G   GV+  +++ +S +      ++    +D     E++ ++   +  +  + +  P 
Sbjct: 457 SVGCVWGVAGTSSLIQSVVRKQATKRLQGILTD----EEIKSLLVKLSHKTSLIEK-LPD 511

Query: 546 FVRATLLECYHFASRATFKF----CLTTMVLA 573
            VRA +L  Y  + ++T+ F    CL  ++LA
Sbjct: 512 NVRAAVLTSYEISIKSTYFFSVILCLIAIILA 543

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score =  197 bits (501), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 158/523 (30%), Positives = 258/523 (49%), Gaps = 31/523 (5%)

Query: 84  RILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGK 143
           ++L+I  ++F  +FL+ LD TI ++    IG+EF  +  +SWI T+YL++ ++ QPLYG 
Sbjct: 41  KVLLIETALFTNVFLSGLDSTISASTYQLIGNEFGDVKLSSWITTAYLITCTSFQPLYGS 100

Query: 144 LSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV 203
            SD LGR+  L F+N +FA+GC  CG + +I++++  R ++GIGG GL +L+T+I SD++
Sbjct: 101 FSDTLGRRHCLFFANTIFALGCFGCGTTTTIYSLILMRALTGIGGGGLITLSTIINSDII 160

Query: 204 PLRDRAVYQGLCNFVFG----LGTASGGLVGAYFRDWRLAFILQCPISVLSGILIVVYLE 259
           P + R +YQ   N + G    +G + GGL+ A    WR  F+LQ PISV  G L+  +  
Sbjct: 161 PAKKRGIYQAFQNVLLGTGAVVGASCGGLI-ATTMGWRWCFLLQVPISV-GGTLVAFFFV 218

Query: 260 LPPR------ASASNKDCWSARLRRLDWAGATSLIAF----LFLFMLTSSMGGSSVAYGS 309
              R       SA     W  +L ++D++GA  L+      LF   L S+   S   + S
Sbjct: 219 HDQRPDINGGVSAVRTTGWE-KLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSESYWYS 277

Query: 310 RLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRD---RSVLGSSLANWFCMMSMMTT 366
                +  +T V   +F YVE    A+P++P   LR     +VL  S+   F   + +  
Sbjct: 278 PQSIVLTLSTGVSLILFAYVEHTTKANPIIPHDLLRQAHGATVLIISVLVGFVAYAYI-- 335

Query: 367 NFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIA 426
            F LP+Y+  V+G  A   G R     F    G L  GL MK        L++     + 
Sbjct: 336 -FTLPLYFQVVIGDTAAKAGLRLTVPSFCTPIGGLITGLSMKNPNHLPVLLISGITCMLL 394

Query: 427 GQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRS 486
           G +  + I P  P W+  LL V    G  +    TL   + A P    A  TS  Y FRS
Sbjct: 395 GNLCFLFIKPWTPYWQTSLLLVPANVGQGITFPSTLFTFLFAFPPYKQATATSTLYLFRS 454

Query: 487 TGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPF 546
            G   GV+  +++ + ++ +    +  +  +   +E+E+R ++   + ++  + +  PP 
Sbjct: 455 VGCVWGVAGTSSLIQYAVRN----QAKKSLNGLLTEKEIRKLLLQLSHTTSQI-KKLPPD 509

Query: 547 VRATLLECYHFASRATF---KFCLTTMVLAGVSCSIIKEHKLH 586
           VR+ ++  Y  A R  +    F  T  +L      + K+   H
Sbjct: 510 VRSAVISSYDNAIRQAYFLSVFLCTIAILLSFLKRVFKKRDEH 552

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score =  194 bits (493), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 161/505 (31%), Positives = 256/505 (50%), Gaps = 33/505 (6%)

Query: 84  RILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGK 143
           RI+ I  ++F  +FL+ LDGTI ++    IG+EF++ + ++WI T+YL+++++ QPLYG 
Sbjct: 43  RIVFIETALFANVFLSGLDGTITASTYQLIGNEFDNFEISNWITTAYLVATTSFQPLYGS 102

Query: 144 LSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV 203
            SD LGR+  L F+N VFA+GCL CGL+  I +++  R ++GIGG GL +L+T++ SD++
Sbjct: 103 FSDTLGRRHCLFFANTVFALGCLGCGLAPGILSLIFMRALTGIGGGGLITLSTIVNSDII 162

Query: 204 PLRDRAVYQGLCNFVFG----LGTASGGLVGAYFRDWRLAFILQCPISVLSGILIVVYLE 259
           P   R +YQ   N + G    +G ++GG V +Y   WR  F+LQ P+SV   I+  ++LE
Sbjct: 163 PPESRGIYQAFQNVLLGIGAVIGASTGGAVASYL-GWRWCFLLQVPVSVGGTIMAYMFLE 221

Query: 260 LPP---RASASNKDCWSARLRRLDWAGATSLI----AFLFLFMLTSSMGGSSVAYGSRLF 312
                   S S+      R  ++D  G+  LI    + L    + SSM  S   + S+  
Sbjct: 222 NQKGFVSESESSGQLLKNRFSKIDLKGSLLLIVGLASQLMYLTVNSSMASSGSQWLSKES 281

Query: 313 AAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRS---VLGSSLANWFCMMSMMTTNFY 369
             +   T++   +F++ E    A+P++P   L       VL  S+   F   + +   F 
Sbjct: 282 IGLILLTVLSLVMFIHTERTTQANPIIPTKLLSQSHSTMVLVISVLVGFVSYAYL---FT 338

Query: 370 LPVYWSSVLGMKATDVGKR-AMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAF-CVLAIAG 427
           LP+++  V+G  A   G R A+PS F    G L  GL M R  K   FLL+F  VL + G
Sbjct: 339 LPLFFQIVVGDSAARAGFRLAIPS-FCTPIGGLITGLSM-RIPKTLPFLLSFGMVLMMIG 396

Query: 428 QVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRST 487
               +L+    P W   LL      G  V    TL + + +   E+ A  TS  Y FRS 
Sbjct: 397 NAFFLLLKTTTPEWLVCLLLTPANVGQGVTFPATLFSFLFSFHPENQATATSTLYLFRSI 456

Query: 488 GATLGVSVGAAVFRSSLTSLLDAKVMRFASDG-HSERELRGIIASAARSSDWVHRSAPPF 546
           G+  GV+       S L  LL  + +R    G  S  E+  + +     + ++ +  P  
Sbjct: 457 GSLWGVAG-----TSGLIQLLVGRKIREKLHGILSPEEIARLRSKIGHKTSYIEK-LPSE 510

Query: 547 VRATLLECYH----FASRATFKFCL 567
           ++  ++E Y     FA   +  FC+
Sbjct: 511 IKEAVVESYESAIKFAHILSVSFCV 535

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score =  183 bits (465), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 156/520 (30%), Positives = 253/520 (48%), Gaps = 30/520 (5%)

Query: 80  LPSSRI---LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSST 136
           +P SRI    II  ++F  +FLA  DGTI ++    IG+EFN +  +SWI T+YL++S++
Sbjct: 49  IPLSRIPNLWIIEATLFSNVFLAGFDGTITASTYQTIGNEFNQMSISSWITTAYLITSTS 108

Query: 137 CQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLAT 196
            QPLYG  SD LGR+  L F+NAVF IGCL C  S +I+ +   R ++GIGG GL +L+T
Sbjct: 109 FQPLYGSFSDALGRRNCLFFANAVFTIGCLACSFSTNIYMLSFMRALAGIGGGGLITLST 168

Query: 197 MIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGIL 253
           ++ SD++P   R ++Q   N + G G   G   G        WR  F++Q PIS+++ +L
Sbjct: 169 IVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTITSTIGWRWCFLIQVPISMIASLL 228

Query: 254 IVVYLELPPRASASNKDC---WSAR--LRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYG 308
           +  Y  +P +    ++      S++  L+ +D  G+  +IA L    L     G+S ++ 
Sbjct: 229 MNYY--VPNQKEYDDQKINILLSSKKILKDIDITGSILIIAGL-TLQLLYLSLGASFSWT 285

Query: 309 SRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDR---SVLGSSLANWFCMMSMMT 365
           +     +  A++V   +F+  E +  A  ++P+  +       VL  S+   F   + + 
Sbjct: 286 NPPVLMLLLASIVIIILFILNERKTTARAIIPMELVNSSFSFVVLSISILVGFASYAYL- 344

Query: 366 TNFYLPVYWSSVLGMKATDVGKR-AMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLA 424
             F LP+++  VLG      G R  +PS F+   GSL  G+ M +       L     L 
Sbjct: 345 --FTLPLFFQIVLGDSTAKAGLRLTIPSLFT-PVGSLITGISMSKYDCLQSLLYIGIFLM 401

Query: 425 IAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAF 484
             G    + I    P W   +  +    G  +    TL   I A P    A  TS  Y F
Sbjct: 402 FLGNFLFLFIEKTSPNWLIGVFLIPANLGQGITFPTTLFTFIFAFPKRDQATATSTLYLF 461

Query: 485 RSTGATLGVSVGAAVFRSSLTSLLDAKVMRFA-SDGHSERELRGIIASAARSSDWVHRSA 543
           RS G+  GV++ A V +     L  A+ +RF   D   E  +  II     +S ++  S 
Sbjct: 462 RSIGSVWGVAISAGVIQ-----LYFARYLRFNLKDLLDEHTINKIITRINANSSYIG-SL 515

Query: 544 PPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEH 583
              V+ T+++ +  A++          +LA + C I+K++
Sbjct: 516 HGEVKNTVIKSFDSATKKAHLMSTLLSLLALIFC-IVKDN 554

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 139/484 (28%), Positives = 231/484 (47%), Gaps = 48/484 (9%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+ S++LG FL++LDGTIV+ ++  +  EF   DK  WIATSYLL+++  QPLYGKLSD 
Sbjct: 39  IVLSLWLGSFLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDL 98

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GRK  ++ ++  F +GCL+   +NS+      R I G+GG G+ +++++ +SD+   R+
Sbjct: 99  TGRKFAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRE 158

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILI--VVYLELPP 262
           R +YQG  N VFGLG   G  +G  F D   WR+ F LQ P  +L   L+   V ++L  
Sbjct: 159 RGIYQGYANIVFGLGQILGAPIGGLFIDTLGWRILFGLQVPTILLCSSLVHKNVNIKLSH 218

Query: 263 RASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVF 322
                 +  WS  L R+D  G+++L+     F ++  +   S      L +     + + 
Sbjct: 219 LLPVEERFKWS-NLSRIDILGSSTLV-----FTISGVLFLCSTELNKALLSIFTVISFI- 271

Query: 323 GAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKA 382
              F+ +EL  + + ++P   L+    L S+ A       +    F  P+Y   + G+  
Sbjct: 272 --AFILIELYYSKERIMPFELLKGSFGLASA-ATVISSFIIFGDIFRSPIYLQLIQGVSV 328

Query: 383 TDVGKRAMPSFFSVAFGSLGAGLYMKRTG------KYY----------------YFLLAF 420
           T  G   +    SVA GSL  G  ++ T        Y+                Y+L+  
Sbjct: 329 TKTGFFMLFPSISVAVGSLATGWILRHTKMKLSHCAYWIVTIGMSIQLLGLVVAYYLIQN 388

Query: 421 CVLAIAGQ------VQI-VLITPQMPVWRQY--LLQVVPGFGVSVLITVTLLAMIAAVPH 471
              +++G       VQI   I+ Q   W     L  ++  FG + L+  TL+ ++  +P 
Sbjct: 389 LEPSLSGSAIFGAFVQIGQNISSQSYTWVVIYALALILVSFGYACLLVATLVNIVFTIPK 448

Query: 472 EHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGH--SERELRGII 529
                 T I Y +RS G  LG S+    +   ++S L   +     D +  S++E R ++
Sbjct: 449 SQQGTVTGIFYLWRSIGNVLGASLTLVFYEKGVSSFLWNYMFNKQHDDYNFSKKEYRKLL 508

Query: 530 ASAA 533
           +  +
Sbjct: 509 SDTS 512

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score =  182 bits (461), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 143/483 (29%), Positives = 231/483 (47%), Gaps = 15/483 (3%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           II  ++F  +FL+  DGT+ ++    IG+EFN +  ++WI T+YL++S++ QPLYG  SD
Sbjct: 54  IIEATLFSNVFLSGFDGTVTASTYQTIGNEFNQMSISNWITTAYLITSTSFQPLYGSFSD 113

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
            LGR+  L F+NA F IGCL C LS +I+ +   R ++GIGG GL +L+T++ SD++P  
Sbjct: 114 ALGRRNCLFFANAAFTIGCLACSLSTNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSS 173

Query: 207 DRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPR 263
            R ++Q   N + G G   G   G        WR  F++Q PIS++S +L+  Y+     
Sbjct: 174 KRGIFQAFQNLLLGFGAICGASFGGTIASTIGWRWCFLIQVPISIISSVLMNYYVPNQKE 233

Query: 264 ASASNKDCW--SAR-LRRLDWAGATSLIAFLFLFMLTSSMG--GSSVAYGSRLFAAMCAA 318
            +  N + +  S R L  +D  G+  +I  L L +L  S+G  GS +++ S     +   
Sbjct: 234 YNHENSNIFRNSKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSVLLLLVG 293

Query: 319 TLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVL 378
           ++    +F+  E +  A  ++P+  +         L +     +     F LP+++  VL
Sbjct: 294 SIAILLLFISHEKKTTARAIIPMELVSSSYSFVVLLISILVGFASYAYLFTLPLFFQIVL 353

Query: 379 GMKATDVGKR-AMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQ 437
           G      G R A+PS F+   GSL  G  M +       L     L   G    + I   
Sbjct: 354 GDSTAKAGLRLAIPSLFT-PVGSLITGFSMSKYNCLRSLLYVGVSLMFLGNFLFLFIEKT 412

Query: 438 MPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGA 497
            P W   L  +    G  +    TL   I   P    A  TS  Y FRS G+  GV++ A
Sbjct: 413 SPNWLISLFLIPANLGQGITFPTTLFTFIFLFPKSDQATATSTLYLFRSIGSVWGVAISA 472

Query: 498 AVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHF 557
            V + S    L + +     D   E  +  +I     +S ++  S    V+ T++E +  
Sbjct: 473 GVIQLSFAKYLRSNL----KDMLDENTIAKLITKLNANSSYIE-SLHGEVKNTVIESFDA 527

Query: 558 ASR 560
           A++
Sbjct: 528 ATK 530

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score =  183 bits (464), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 136/547 (24%), Positives = 255/547 (46%), Gaps = 31/547 (5%)

Query: 41  DIEQGRA------YGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFL 94
           ++  GRA      YGS +++    E+    A    VA   S E     +R  I    M  
Sbjct: 207 EVPGGRAQMDPYGYGSISRTI---EDVESGANPTYVANSSSDELVHDLTRKRIFSSCMCT 263

Query: 95  GIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLL 154
            +F  A+D +I+  + + I SEF+ L + S + + YLL ++  Q ++ KLS   G K LL
Sbjct: 264 YLFFIAMDSSIILVIASKIASEFHELWRLSLVISVYLLGNAIGQLMFLKLSLVSGVKLLL 323

Query: 155 VFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGL 214
             +   F +G  +   S   W  +  R ++G G   L +L + IM+      +       
Sbjct: 324 CVAQFSFILGSYLSWSSIHFWTFILARSVTGFGSGSLIALKSTIMNRFSQKNENQYPLST 383

Query: 215 CNFVFGLGTASGGLVGAYFRD-----WRLAFILQCPISVLSGILIV--VYLELPPRASAS 267
              VF LG A G  + ++F       W+ AF++  P  +++  +++  +Y          
Sbjct: 384 SMTVFSLGVAVGPFLVSFFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKNTIHHEG 443

Query: 268 NKDCWSARLRRLDWA----GATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFG 323
                  R +++ W+       +L  FL  F+  +S+  + + + + +   + +  ++ G
Sbjct: 444 PTTTLQKRFKKVLWSPDLYEILTLALFLLCFVQATSLDSTRLEHSTMIQEIIFSVIIICG 503

Query: 324 AVFVYVEL-RVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKA 382
            +F  +E   V  + V  ++   D+ ++ + +  +FC  ++M    +   Y+  VL +  
Sbjct: 504 VLFFVIEKSDVRMNSVFSLSLQGDKHLIWTMMGIFFCFAALMCIIPFGTTYFMIVLNLDT 563

Query: 383 TDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWR 442
            ++ +R +P FFS+  G      +     + Y F      + +   V ++ +   + VW+
Sbjct: 564 LEIAERLLPFFFSIVVGYFSVCYFWNSERQNYLFKFVLSGVTLLLYVALMGMNLSLSVWK 623

Query: 443 QYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAA-----TTSISYAFRSTGATLGVSVGA 497
           QY    +P  G S+++T     +++ + HE+H       + SI+Y F + G T+GVS   
Sbjct: 624 QYTCLSLPLLGSSMILT-----LLSTLYHEYHVQRKSPISGSIAYCFAAMGGTIGVSSAG 678

Query: 498 AVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHF 557
            VF  +L   ++ +VM+F+  G+ +++L  II  A +SS+WVH+SAP F+  TL+ECY  
Sbjct: 679 YVFHKTLVRTMNEEVMKFSKQGYLKKDLFKIIKHATQSSNWVHKSAPKFIFRTLIECYLQ 738

Query: 558 ASRATFK 564
           A R  FK
Sbjct: 739 ACRNVFK 745

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 163/573 (28%), Positives = 266/573 (46%), Gaps = 47/573 (8%)

Query: 43  EQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSS--RILIIMFSMFLGIFLAA 100
           +   +YGS +++ I  EN  E+     + G    E    S    + II  ++F  +FL+ 
Sbjct: 13  KSATSYGSISETRIP-ENSLEEL--ENIHGADEDEDIKLSDIPNLWIIEAALFTNVFLSG 69

Query: 101 LDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAV 160
            DGT+ ++    IG+EFN ++ +SWI T+YL++S++ QPLYG  SD LGR+  L F+N  
Sbjct: 70  FDGTVTASTYQTIGNEFNHMNISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTS 129

Query: 161 FAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFG 220
           F IGCL CGLS +I  +   R ++GIGG GL +L+T++ SD++P   R ++Q   N + G
Sbjct: 130 FTIGCLACGLSPNIVVLSFMRALTGIGGGGLITLSTIVNSDMIPSSKRGIFQAFQNLLLG 189

Query: 221 LGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPRASASNKDCW----- 272
           LG   G   G        WR  F +Q PI + + +++  Y  +P +    +++       
Sbjct: 190 LGAICGASFGGSIASSIGWRWCFFVQVPICITNSLIMSSY--VPNQKEYEDREIGFLFHP 247

Query: 273 SARLRRLDWAGATSLIAFLFLFMLTSSMGGSS--VAYGSRLFAAMCAATLVFGAVFVYVE 330
              L+ +D  G+  +I  L L +L  S+G S   V++ S     +  A+ +   +FVY E
Sbjct: 248 KKILKDIDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPSVLPLLFASGIILVLFVYNE 307

Query: 331 LRVAADPVLPVTFLRDR---SVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGK 387
            + +A  ++P+  +R      VL  S+   F   + +   F LP+++  VLG      G 
Sbjct: 308 AKTSARAIIPLELMRSSFSFVVLTISILVGFASYAYL---FTLPLFFQIVLGDSTAKAGL 364

Query: 388 R-AMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLL 446
           R  +PS F+   G L  G+ M R       L A   L   G    + I    P W   L 
Sbjct: 365 RLTIPSLFT-PVGGLITGICMSRYNCLQILLYAGVFLMALGNFLFLFIEKGSPNWLVGLF 423

Query: 447 QVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV------- 499
            +    G  +    TL   I A P    A  TS  Y FRS G+  GV++   V       
Sbjct: 424 LIPANLGQGITFPATLFTFIFAFPKSRQATATSTLYLFRSIGSVWGVAMSTGVIQLYFGK 483

Query: 500 -FRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFA 558
             RS+L  LLD            E ++  ++     +S ++ +     ++  +++C+  +
Sbjct: 484 SLRSNLKDLLD------------EDKINELVTKITSNSSYIEKLHGE-LKDVVIDCFDSS 530

Query: 559 SRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591
           ++          +LA   C +IKE      IK 
Sbjct: 531 TKKAHLLSTILSLLALAFC-VIKEFLKKPKIKE 562

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score =  175 bits (443), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 150/502 (29%), Positives = 235/502 (46%), Gaps = 55/502 (10%)

Query: 49  GSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVST 108
           G +T  S     E ED            +F  P++    I+ S++L   + A+DGTI+ST
Sbjct: 21  GESTVPSFPDTGEEEDL---------EKDFRDPNT-FPYILLSLWLNTSICAVDGTIIST 70

Query: 109 LLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLIC 168
            +  I S F    K +W+AT+Y+L++   QPLYGK SD LGRK  L+F+  VF +G ++C
Sbjct: 71  TMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFIVGLVMC 130

Query: 169 GLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGL 228
           G + +I  ++  R I G+GG GL ++  +I+SDL PL  R++Y G  + ++G   + GG 
Sbjct: 131 GAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQRSIYWGWGSVIWGFSQSVGGP 190

Query: 229 VGAYFRDW---RLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGAT 285
           +G    +W   R  F++Q P  + S  L V Y+      S   +  W    R +D+AG+ 
Sbjct: 191 LGGLLLNWFGVRGLFVVQIPFCLFSLSLTVKYIH---DLSNQTQGTW----RDIDFAGSF 243

Query: 286 SLI----AFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAV-FVYVELRVAADPVLP 340
            LI    AF+F   L SS G  +      LF   C    V     F+YVE  VAA  +LP
Sbjct: 244 CLITGISAFIF---LCSSSGDVTDDSAVSLFKVGCFLITVLSVSGFIYVEKNVAAKSILP 300

Query: 341 VTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGS 400
              L+    + S +     M+S +   F +P+Y   V G+     G   M +  S + GS
Sbjct: 301 AEVLKGSLGVISFIYGLASMLSYVGL-FVVPLYLQLVWGVSVAGSGGYIMYAVISTSIGS 359

Query: 401 LGAGLYMKRTG----------------------KYYYFLLAFCVLAIAGQVQIVLI-TPQ 437
            G+G  +++ G                         +F++   +L I    + V   +P 
Sbjct: 360 FGSGWLLRKYGAPDKDATLLNSGMMLIGSTLINTLGFFVMFKNILEIKPAFEGVKSPSPD 419

Query: 438 MPVWRQYLLQ-VVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVG 496
              W  +LL   + G          +L  +A V  +  A++TS+++ FRS G  L VS+ 
Sbjct: 420 QKFW--FLLGFAIMGLSAGFQSVSVMLYTVAKVGRKGQASSTSVTFLFRSLGNVLSVSIS 477

Query: 497 AAVFRSSLTSLLDAKVMRFASD 518
            +VF +SL   L +      SD
Sbjct: 478 LSVFVASLKGKLKSYFQGQQSD 499

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score =  170 bits (430), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 144/465 (30%), Positives = 234/465 (50%), Gaps = 50/465 (10%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           L I+ S++LG F+++LDGTIV+ ++  +  EF+  DK  WIATS+LL+++  QPLYGKLS
Sbjct: 35  LPILTSLWLGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLS 94

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
           D  GRK  L+ +     IGCL+  L+ ++      R I GIGG G+ + +++ +SD+   
Sbjct: 95  DVTGRKFALLMAYFFLVIGCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTA 154

Query: 206 RDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGIL----IVVYL 258
           ++R +YQG  N VFG+G   G  +G  F D   WR  F +Q P+ ++S  L    + + L
Sbjct: 155 KERGIYQGYANIVFGMGQMLGAPLGGLFIDTIGWRAIFGIQVPVVMVSAFLAYRNVNIKL 214

Query: 259 -ELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCA 317
             +PP +    +      L R+D+ G+ +         L S++ G  V   + L   + +
Sbjct: 215 SHVPPISERFTRK----NLSRIDFLGSVT---------LASTICGVLVLCSTDLNKLVVS 261

Query: 318 -ATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSS 376
            AT     +F++VEL  AA+ +LP   L+    L SS+        +    F  P+Y   
Sbjct: 262 LATAASFVLFLWVELFYAAERILPFELLKGPFGL-SSVVTVCSSFVIFGDIFRSPIYLQL 320

Query: 377 VLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGK-----YYYFLLAFCVLAIAGQV-- 429
           +  +  T+ G   +    SVA GSL  G  ++RT K      Y F+LA   L + G V  
Sbjct: 321 IHDLSVTNTGLFMIFPSVSVAVGSLVTGAVLRRTSKSLELCSYLFVLAGIALQLTGLVIS 380

Query: 430 --QIVLITP----------------QMPVWRQYLL--QVVPGFGVSVLITVTLLAMIAAV 469
              + ++ P                Q  +W+   +   V+ GFG + L+  TL++++ ++
Sbjct: 381 YYLVGVVEPALSTQMASTLTFQFASQSTLWKLVFVFASVLVGFGYACLLVSTLVSIVFSI 440

Query: 470 PHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMR 514
                A  T I Y +RS G  LG S+   VF++SLT+ L   ++ 
Sbjct: 441 DKSQQATMTGIFYLWRSIGNVLGASLTLVVFQNSLTTSLRKYMLE 485

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score =  171 bits (434), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 149/557 (26%), Positives = 256/557 (45%), Gaps = 30/557 (5%)

Query: 48  YGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVS 107
           YGS  +S    EN         V    S E     +R  I    M   +F  A+D +I+ 
Sbjct: 214 YGSIPQSIGDVEN---GLNPPYVENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIIL 270

Query: 108 TLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLI 167
            + + I SEF+ L + S + ++YLLS++  Q ++ KLS     K LL  +   F +G  +
Sbjct: 271 VIASKIASEFHELWRLSLVISAYLLSNAIGQLVFLKLSLISSVKLLLCIAQFSFILGGYL 330

Query: 168 CGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGG 227
              S   W  +  R ++G GG  L +L + IM+      D           F +G   G 
Sbjct: 331 SWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGP 390

Query: 228 LVGAYFRD-----WRLAFILQCPISVLSGILIV-----VYLELPPRASASNKDCWSARLR 277
            +   F       WR AF++  P  +++  +++     V   L  R + +    +   L 
Sbjct: 391 FMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTLYGRPTPTLWKRFKNTLL 450

Query: 278 RLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVEL-RVAAD 336
             D     +L  FL  F+  +S+  + +   + + A + +  +V G +F  +E      +
Sbjct: 451 SPDLYEILTLTLFLLCFVQVTSLDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMN 510

Query: 337 PVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSV 396
            V+ ++   D+ ++ + +   FC  ++M    +   Y+  VL +    + +R  P FFS+
Sbjct: 511 SVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSI 570

Query: 397 AFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVL--ITPQMPVWRQYLLQVVPGFGV 454
             G      + K  G+   FLL F +      + + L  ++  +PVW+QY+   +P  G 
Sbjct: 571 VLGYFSVSYFWKSKGQN--FLLKFVLSGATLLLYVALMGVSLNLPVWKQYICLSLPFLGS 628

Query: 455 SVLITVTLLAMIAAVPHEHHAA-----TTSISYAFRSTGATLGVSVGAAVFRSSLTSLLD 509
           S+++T     +++ + HE+H       + SI Y F + G T+G+S+G  VF  +L  L+ 
Sbjct: 629 SMILT-----LLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVGISLGGYVFHKTLIKLMH 683

Query: 510 AKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTT 569
            KVM F+  G+ +++L  II  A  SSDWVH SAP FV  TL+ECY  A R  FK  L+T
Sbjct: 684 EKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECYLQACRNVFK--LST 741

Query: 570 MVLAGVSCSIIKEHKLH 586
           +       +I   +++H
Sbjct: 742 LFFTITVVAIFIFNRIH 758

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score =  168 bits (426), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 142/460 (30%), Positives = 224/460 (48%), Gaps = 55/460 (11%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+ S++LG FL++LD TIV+ ++  +  EF   DK  WIATS+LL+++  QPLYGKLSD 
Sbjct: 42  ILLSLWLGSFLSSLDSTIVANIMNKVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDI 101

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GRK  ++ S+  F +GC +   + +I      R I GIG  G+ +++++ +SD+   R+
Sbjct: 102 TGRKFAVLTSHFFFGLGCFLTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRE 161

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGIL----IVVYL-E 259
           R +YQG  N VFGLG   G  +G  F D   WR+ F +Q P+ +L   L    I V L  
Sbjct: 162 RGIYQGYANIVFGLGQLLGAPLGGLFIDSVGWRVIFGVQVPMLLLCSTLATRNINVKLAH 221

Query: 260 LPPRASASNKDCWSARLRRLDWAGATSLIAFL-FLFMLTSSMGGSSVAYGSRLFAAMCAA 318
           +PPR     +  W   L R+D  G+ +L+  +  L  LTS+     V     L  +M A+
Sbjct: 222 IPPR---KERFTWK-NLSRIDIFGSLALVGTISSLLFLTSTTLNKIV-----LTLSMIAS 272

Query: 319 TLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS--SLANWFCMMSMMTTNFYLPVYWSS 376
            +    +F+++EL  A + +LP   L+    L S  ++A+ F +   +   F  P+Y   
Sbjct: 273 FI----LFIWIELYYAKERILPFDLLKGSFGLCSLVTVASSFVVFGDI---FRSPIYLQL 325

Query: 377 VLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKY-----YYFLLA-----FCVLAIA 426
           V  +  T  G   +    +VA GSL  G  ++ T K      Y  +L       C L IA
Sbjct: 326 VQDISVTKTGLFLVFPSIAVAGGSLVTGWILRHTKKNLSHCAYGIILGGVCIQLCGLVIA 385

Query: 427 ---------GQVQI-------VLITPQMPVWR--QYLLQVVPGFGVSVLITVTLLAMIAA 468
                      V I          TP   +W+    L  ++  +G + L+  TL++++  
Sbjct: 386 YYLIKNLKPAMVHIDDSAMAFFTFTPNSIMWKIIYALALILVSYGYASLLVATLVSIVFT 445

Query: 469 VPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLL 508
           +        T I Y +RS G  LG S+   ++ +SL   L
Sbjct: 446 IEKSQQGTMTGIFYLWRSIGNVLGASLTLVIYENSLAKKL 485

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score =  171 bits (432), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 157/614 (25%), Positives = 280/614 (45%), Gaps = 56/614 (9%)

Query: 7   SPLLTPVDRDAMQDPSTDLPGFVANQIEQQD--HLLDIEQGRAYGSTTKSSISS------ 58
           SPL + +  D  Q    +LPG   N +E     H+   E  R    T  ++ S+      
Sbjct: 147 SPLQS-ITSDHTQMSERELPGSSTNSLEGNGDIHVAQSESERPTSKTLATATSAPAVPVS 205

Query: 59  ----------------ENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALD 102
                           E+  ++   + +A   S  F    +R  I    M   +F  A+D
Sbjct: 206 RAEISPYGYGSISQTIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMD 265

Query: 103 GTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFA 162
            +I+  +++ I SEF+ L + S I + YLLS++  Q L+ KLS     K LL  +   F 
Sbjct: 266 SSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQLLFLKLSIISSVKLLLCMAQFSFI 325

Query: 163 IGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLG 222
           +G  +   S+  W  +  RF++G G   L +L + IM+      +          +F LG
Sbjct: 326 LGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLG 385

Query: 223 TASGGLVGAYFRD-----WRLAFILQCPISVLSGILIV--VY-LELPPRASASNKDCWSA 274
            A G  V   F       W+ AF++  P  +++  +++  +Y ++       S    W  
Sbjct: 386 VAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLW-K 444

Query: 275 RLRRL----DWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVE 330
           R++++    D     +L  FL  F+  +++  + + + + +   + +  L+ G +F  +E
Sbjct: 445 RVKKILLSPDLYEILTLTLFLLCFVQVTTLDLTELEHRTMIQWVLFSVILICGVLFWLIE 504

Query: 331 LR-VAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRA 389
                 + V+ ++   D+ ++ +     FC  ++M    +   Y++ VL +    + +R 
Sbjct: 505 ANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERL 564

Query: 390 MPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVL--ITPQMPVWRQYLLQ 447
           +P FFS+  G      + K   + Y  LL F +  +   + I L  +   +PVW+QY+  
Sbjct: 565 LPFFFSIVIGYFSVCYFWKSKKQNY--LLKFVLSGVTLILYITLMGVGLSLPVWKQYVCL 622

Query: 448 VVPGFGVSVLITVTLLAMIAAVPHEHHAATTSIS-----YAFRSTGATLGVSVGAAVFRS 502
            +P      L +  LL +++++ HE+H    S++     Y F + G T+G+S+G  VF  
Sbjct: 623 SLP-----FLGSSMLLTLLSSLYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHK 677

Query: 503 SLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRAT 562
           +LT  L  +VM+F+  G+ +++L  II  A  SSDWVH SAP F+  TL+ECY  A R  
Sbjct: 678 TLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNV 737

Query: 563 FKFC---LTTMVLA 573
           FK      T MV++
Sbjct: 738 FKLSAVFFTIMVIS 751

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 135/457 (29%), Positives = 220/457 (48%), Gaps = 51/457 (11%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+FS++LG FL++LDGTIV+ ++  +  EF+   +  WIATS+LL+++  QPLYGKLSD 
Sbjct: 38  ILFSLWLGSFLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GRK  L+ ++  F IGCL+   + ++      R I GIG  GL ++ ++ +SD+   R+
Sbjct: 98  TGRKSALLTAHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGLNAIGSIAVSDICTARE 157

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPRA 264
           R VYQG  N VFGLG   G  +G  F +   WR  F +Q P+ +L  +L +  + +    
Sbjct: 158 RGVYQGYANIVFGLGQLLGAPLGGVFIETIGWRALFGVQVPVIMLCSVLAIKNINIKLFH 217

Query: 265 SASNKDCWSAR-LRRLDWAGATSLIAFL--FLFMLTSSMGGSSVAYGSRLFAAMCAATLV 321
               K+ ++ + L R+D  G+ SL+A +   LF+ +S +        ++L+  +   T+ 
Sbjct: 218 VPPMKERYTLKNLSRIDIFGSLSLVATISGVLFLCSSHL--------NKLYLTLF--TIG 267

Query: 322 FGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMK 381
              VF+ VE   A + +LP+  L  RS   SS         +    F  P+Y   +  + 
Sbjct: 268 SFIVFILVERYYATEKILPLELL-TRSFCLSSAVTVISSFVVFGEIFRSPIYLQLLQNIS 326

Query: 382 ATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAI--AGQVQ--------- 430
            T  G   +    SVA GSL  G  ++ T       LA C   I   G +          
Sbjct: 327 VTKTGLFLIFPSVSVAVGSLVTGWLLRNTK----INLAHCAYQIIFGGMITQLLGLGLGY 382

Query: 431 --IVLITPQMPV---------------WRQYLL--QVVPGFGVSVLITVTLLAMIAAVPH 471
             +  + P   +               W+   +   V+  FG + L+  TL++++  V  
Sbjct: 383 LLLAYLNPDYTIYDMLESITFESDSIWWKLIYVFASVLVSFGYACLLVATLVSIVFTVEK 442

Query: 472 EHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLL 508
                 T + Y +RS G  LG S+    + +SL+S+L
Sbjct: 443 SQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSML 479

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  167 bits (423), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 141/479 (29%), Positives = 229/479 (47%), Gaps = 70/479 (14%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+FS++LG FL++LD TIV+ ++  +  EF+   K  WIATS+LL+++  QPLYGKLSD 
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
           +GR+P L+ +   F +GCL+   + ++      R + GIG  GL +++++ +SD+   R+
Sbjct: 98  IGRRPALLTAQFFFGLGCLMTCFARNVTEFSIARAVCGIGAGGLNAISSIAVSDICTARE 157

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPRA 264
           R VYQG  N VFG G   G  +G  F +   WR  F +Q P+ ++  IL +  + +    
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGIFIETIGWRALFGVQVPMIIVCSILAIKNINIKLFH 217

Query: 265 SASNKDCWSAR-LRRLDWAGATSLIAFL--FLFMLTSSMGGSSVAYGSRLFAAMCAATLV 321
               K+ ++ + L R+D  G+ SL+A +   LF+ +S M        ++++ A+   T+ 
Sbjct: 218 VPPMKERYTLKNLSRIDIFGSLSLVATISGVLFLCSSHM--------NKIYLALF--TIG 267

Query: 322 FGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTT---------NFYLPV 372
              VFV VE   A + +LP   L      GS     FC+ S +T           F  P+
Sbjct: 268 SFIVFVLVERYYATERILPFELLT-----GS-----FCLSSAVTVISSFVVFGEIFRSPI 317

Query: 373 YWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAI--AGQVQ 430
           Y   +  +  T  G   +    SVA GSL  G  ++ T       LA C   I   G V 
Sbjct: 318 YLQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTKMN----LAHCAYQIIFGGMVT 373

Query: 431 -----------IVLITPQMPV---------------WRQYLL--QVVPGFGVSVLITVTL 462
                      +  + P   V               W+   +   V+  FG + L+  TL
Sbjct: 374 QLLGLGMGYLLLGHLYPDYTVYDMLESITFKSHSIWWKLIYVFASVLVSFGYACLLVATL 433

Query: 463 LAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVM-RFASDGH 520
           ++++  V        T + Y +RS G  LG S+    + +SL+S+L + +  R   DG+
Sbjct: 434 VSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWSYMFERKRDDGY 492

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  167 bits (423), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 148/513 (28%), Positives = 243/513 (47%), Gaps = 30/513 (5%)

Query: 81  PSSRI---LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTC 137
           P SRI    +I  +++  +FL+  D T+ ++    IG+EFN +D +SWI  SYL++S++ 
Sbjct: 59  PLSRIPHLWLIEAALYTNVFLSGFDSTVTASTYQTIGNEFNHMDLSSWITASYLITSTSF 118

Query: 138 QPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATM 197
           QPLYG  SD LGR+  L F++ +F+IGCL CG+S +I  +   R  +GIGG GL +L+T+
Sbjct: 119 QPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGISINILWLSFMRAFTGIGGGGLITLSTI 178

Query: 198 IMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISV---LSG 251
           + SD++P   R ++Q   N + GLG   G   G        WR  F+LQ PIS+   L G
Sbjct: 179 VNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVITSSIGWRWCFLLQVPISLAGALIG 238

Query: 252 ILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRL 311
            L V   +   R  +         L+ +D++GA  +I  L L ++  S+G ++   G+  
Sbjct: 239 HLYVRNQDEYERRKSKESSQTKEMLKHIDFSGAFLIIIGLTLQLVYLSLGSAADESGNTW 298

Query: 312 ----FAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRS---VLGSSLANWFCMMSMM 364
                +A+  A+ +   +FV  E R +A  ++P   +R      VL  S+   F   + +
Sbjct: 299 SSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKLVRSLFSFLVLTISVLVGFASYAYL 358

Query: 365 TTNFYLPVYWSSVLGMKATDVGKR-AMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVL 423
              F LP+++  +LG      G R A+PS F+   G L AG+ M +       L      
Sbjct: 359 ---FTLPLFFQVILGDSTAKAGLRLAIPSVFT-PVGGLIAGICMSKFNCLQTLLYVGIAF 414

Query: 424 AIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYA 483
              G    + I             +    G  +    +L   I A      A  TS  Y 
Sbjct: 415 MCLGNFLFLYIGADATDSLIGFFLIPANLGQGITFPSSLFTFIFAFSKIDQATATSTLYL 474

Query: 484 FRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSA 543
           FRS G+  GV+  A + +   +  L+ K +    D   ER++R +I     ++ ++    
Sbjct: 475 FRSIGSVWGVTGSAGIVQFCFSHHLE-KALEGLLD---ERKIRKLIKKITSNTSYIKELE 530

Query: 544 PPFVRATLLECYHFASRATF----KFCLTTMVL 572
            P V+  ++E +  A++        FCL  ++L
Sbjct: 531 GP-VKVAVIESFDTATKKVHLISTSFCLVALIL 562

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score =  166 bits (420), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 136/469 (28%), Positives = 222/469 (47%), Gaps = 51/469 (10%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+FS++LG FL++LD TIV+ ++  +  EF+   K  WIATS+LL+++  QPLYGKLSD 
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GRK  L+ +   F +GCL+   + ++      R I GIG  GL +++++ +SD+   R+
Sbjct: 98  TGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPRA 264
           R VYQG  N VFG G   G  +G  F +   WR  F +Q P+ +L  +L +  + +    
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIETIGWRALFGIQVPVIMLCSVLAIKNINIKLFH 217

Query: 265 SASNKDCWSAR-LRRLDWAGATSLIAFL--FLFMLTSSMGGSSVAYGSRLFAAMCAATLV 321
               K+ ++ + L R+D  G+ SL+A +   LF+ +S +        ++L+ A+   T+ 
Sbjct: 218 VPPMKERYTLKNLSRIDIFGSLSLVATISGVLFLCSSQL--------NKLYLALF--TIG 267

Query: 322 FGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMK 381
              VF+ VE   A + +LP   L  RS   SS         +    F  P+Y   +  + 
Sbjct: 268 SFIVFILVERYYATEKILPFELL-TRSFCLSSAVTVISSFVVFGEIFRSPIYLQLLQNIS 326

Query: 382 ATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAI--AGQVQIVL------ 433
            T  G   +    SVA GSL  G  ++ T       LA C   I   G +  +L      
Sbjct: 327 VTKTGLFLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGGMIMQLLGLGLGY 382

Query: 434 -----ITPQMPV---------------WRQYLL--QVVPGFGVSVLITVTLLAMIAAVPH 471
                + P   +               W+   +   V+  FG + L+  TL++++  V  
Sbjct: 383 FLLSHLNPDYTIYDMLESITFRSNSIWWKLIYVFASVLVSFGYACLLVATLVSIVFTVEK 442

Query: 472 EHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGH 520
                 T + Y +RS G  LG S+    + +SL+S+L   + +   D  
Sbjct: 443 SQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKTKRDDE 491

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score =  167 bits (424), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 148/577 (25%), Positives = 272/577 (47%), Gaps = 36/577 (6%)

Query: 21  PSTDLPGFVANQIEQQDHLLDIEQGRAY--GSTTKSSISSENEREDAGGATVAGCGSAEF 78
           P++DL    A    +   L+D  Q RAY  GS +++    EN    +  A VA   S +F
Sbjct: 203 PTSDLSPTSATSAPEV--LVDRPQMRAYEYGSISRTVKDVEN-GTTSSYARVAS--SDKF 257

Query: 79  YLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQ 138
               +R  I    M   +F  A+D TI+ ++++ I SEF+ L + S I + YLLS++  Q
Sbjct: 258 VHDLTRRRIFSSCMCTYLFFIAMDSTILMSIVSKIASEFHELWRLSLIISIYLLSNAIGQ 317

Query: 139 PLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMI 198
            ++ KLS     K LL  +   F +G  +   +   W  V  R I+G G   L +L + I
Sbjct: 318 LVFLKLSIVTSVKLLLCVAQFSFILGSYLSWSAFHFWTFVFARSITGFGSGALMALKSTI 377

Query: 199 MSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD-----WRLAFILQCPISVLSGIL 253
           M+     +           VF LG A G  +   F +     W+ AF++  P  +++  +
Sbjct: 378 MNRFSDKKKNGYSLSASVIVFSLGVAIGPFLVYLFDNSRGSGWKNAFLIPVPFCLVNASI 437

Query: 254 IV--VY-LELPPRASASNKDCWSARLRRL----DWAGATSLIAFLFLFMLTSSMGGSSVA 306
           ++  +Y ++       S    W  R++++    D     +L   L  F+  +S+  + + 
Sbjct: 438 MLADIYSIKDNLHHGGSAPISWK-RIKKILMSPDLYEILTLALLLLCFVQVTSLDITRLE 496

Query: 307 YGSRLFAAMCAATLVFGAVFVYVEL-RVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMT 365
           + + +   +    +  G +F ++E     A+ ++ ++   D+ ++ + +   FC  ++M 
Sbjct: 497 HSAVIQGVLFFVIITCGILFWWIETNETYANSIISMSLRGDKHLMWTIMGISFCFAALMC 556

Query: 366 TNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAI 425
              +   Y++ VL +    + +R +P   ++  G      + K   K Y   +    + +
Sbjct: 557 IIPFGTTYFTIVLNISTLQIAERLLPLSVAIVVGYFSVCYFWKPQMKNYLLEVVLGGVTL 616

Query: 426 AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTS-----I 480
              + ++  +  +PVW+QY+   +P  G ++++T     +++++ HE+H    S     I
Sbjct: 617 ILYIALMGASLSLPVWKQYVCLSLPLLGSAMILT-----LLSSLYHEYHQPKKSPISGSI 671

Query: 481 SYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVH 540
            Y F + G T+G+S+G  VF  +L   +   VM+F+  G+ E++L  II  A +SSDWVH
Sbjct: 672 VYCFSAMGGTIGISLGGYVFHKTLLKAVHDGVMKFSKHGYHEKDLLKIIEHATQSSDWVH 731

Query: 541 RSAPPFVRATLLECYHFASRATFK-----FCLTTMVL 572
            SAP F+  TL+ECY  A R  FK     F +T M +
Sbjct: 732 ESAPKFIFQTLIECYLQACRNVFKLSAILFTITVMTM 768

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score =  162 bits (411), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 143/516 (27%), Positives = 236/516 (45%), Gaps = 69/516 (13%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+FS++LG FL++LD TIV+ ++  +  +F+   +  WIATS+LL+++  QPLYGKLSD 
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GRK  L+ +   F +GCL+   + ++      R I GIG  GL +++++ +SD+   R+
Sbjct: 98  TGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPRA 264
           R VYQG  N VFG G   G  +G  F +   WR  F +Q P+ +L  IL +  + +    
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIETIGWRALFGVQVPMIMLCTILAIKNINIKLFH 217

Query: 265 SASNKDCWSAR-LRRLDWAGATSLIAFL--FLFMLTSSMGGSSVAYGSRLFAAMCAATLV 321
               K+ ++ + L R+D  G+ SL+A +   LF+ +S +        ++L+ ++   T+ 
Sbjct: 218 VPPMKERYTLKNLSRIDLFGSLSLVATISGVLFLCSSHL--------NKLYLSL--FTIG 267

Query: 322 FGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTT---------NFYLPV 372
              VFV VE   A + +LP   L             FC+ S +T           F  P+
Sbjct: 268 SFIVFVLVERYYATERILPFELLTPS----------FCLSSAVTVISSFVVFGEIFRSPI 317

Query: 373 YWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAI--AGQVQ 430
           Y   +  +  T  G   +    SVA GSL  G  ++ T       LA C   I   G V 
Sbjct: 318 YLQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGGMVT 373

Query: 431 IVL-----------ITPQMPV---------------WRQYLL--QVVPGFGVSVLITVTL 462
            +L           + P   V               W+   +   V+  FG + L+  TL
Sbjct: 374 QLLGLGLGYLLLAHLNPDYTVYDMLESITFKSNSIWWKLIYVFASVLVSFGYACLLVATL 433

Query: 463 LAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSE 522
           ++++  V        T + Y +RS G  LG S+    + +SL+S+L   + +   +    
Sbjct: 434 VSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKSKREDEYH 493

Query: 523 RELRGIIASAARSSDWVHRSAPPFVRATLLECYHFA 558
              +   +    SS     + P +V   +L+ Y  A
Sbjct: 494 FSKKQYYSLIDDSSYLRGNNFPKYVFVRILDVYKKA 529

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score =  162 bits (409), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 138/466 (29%), Positives = 226/466 (48%), Gaps = 63/466 (13%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+ S++LG F++ALDGT+V+ ++  I +EF   DK  WIATSYLL+++  QPLYGKLSD 
Sbjct: 44  ILLSLWLGSFVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDI 103

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GRK  ++ ++  FA+GCL+   + ++      R I GIGG G+ +++++ ++D+   R+
Sbjct: 104 TGRKVAVITAHFFFALGCLLTCFAQNVTQFSIARAICGIGGGGINAMSSITVTDICSARE 163

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILI-----VVYLE 259
           R VYQG  N VFG G   G  +G +  D   WR  F +Q P+ +L  +L      +  + 
Sbjct: 164 RGVYQGYANVVFGTGQLLGAPIGGFLLDSIGWRSIFGIQVPMLMLCSVLALKNVNIKLVH 223

Query: 260 LPPRASASNKDCWSARLRRLDWAGATSLIAFLF-LFMLTSSMGGSSVAYGSRLFAAMCAA 318
           +PPR   + +  W   L R+D  G+ SL+A +  +  LTSS    S+         +   
Sbjct: 224 IPPR---NERFTWK-NLSRIDIFGSISLVATISGILFLTSSNWNKSL---------LGIF 270

Query: 319 TLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVL 378
           T++  ++F+Y+EL VA + ++P   L+    L SS+A       +    F  P+Y   + 
Sbjct: 271 TVLSFSLFIYIELYVAKERIMPFELLKGSFGL-SSIATVITSFIIYGEIFRSPIYLQLIQ 329

Query: 379 GMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFC---------VLAIAG-- 427
            +  T  G   +    ++A GS+  G  ++ T       LA C         ++ +AG  
Sbjct: 330 NVSVTVTGLYLIFPSVAIALGSIVTGSILRNTK----MDLAHCAAAIIFGGMIMQLAGLA 385

Query: 428 -------QVQIVLITPQMP---------------VWRQYLL---QVVPGFGVSVLITVTL 462
                   V   L    +P               +W + +     V+   G + L+  TL
Sbjct: 386 LSYYLLSHVNPALDLADLPANLFSAATIYFVSDSIWWKIVYVGALVIGSSGYASLLVATL 445

Query: 463 LAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLL 508
           ++++  V        T I Y +RS G  LG S+   VF  SL  +L
Sbjct: 446 VSIVFTVDRSKQGTITGIFYLWRSIGNVLGASITLVVFERSLGRML 491

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score =  161 bits (407), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 131/444 (29%), Positives = 219/444 (49%), Gaps = 34/444 (7%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           +++ S++L   + A+DGTI+ST +  + S F      +W+AT+Y+L++ + QPLYGK SD
Sbjct: 52  LVLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSD 111

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
            LGRK  L+F+  VF IG ++CG++ ++  +   R I GIGG GL ++  +I+SDL PL 
Sbjct: 112 LLGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAPLS 171

Query: 207 DRAVYQGLCNFVFGLGTASGGLVGAYFRDW---RLAFILQCPISVLSGILIVVYLELPPR 263
            R++Y GL + ++G   + GG +G    +W      F++Q P  + S  L V Y+     
Sbjct: 172 QRSIYWGLGSLIWGFSQSIGGPLGGLLLNWFGVSGLFVIQVPFCLFSLFLTVRYIH---D 228

Query: 264 ASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMC-AATLVF 322
            +   +  W    R +D+AG+  LI  +  F+ + S G    +     F  +C   T+  
Sbjct: 229 LTDQRQGTW----RDIDFAGSFCLIIGISAFIFSCSAGDGVDSNDEGPFKVVCLIVTIAA 284

Query: 323 GAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKA 382
            A FV VE R+A   +LP   L+    +   +     M+S +   F +P+Y   V G   
Sbjct: 285 VAGFVVVEKRMATKSILPAHVLKGSLGVVGLIYGLSSMLSYVGL-FIVPLYLQVVWGTSV 343

Query: 383 TDVGKRAMPSFFSVAFGSLGAGLYMKRTG---------KYYYFLLAFCVLAIAGQV---- 429
              G   + +  S + GS  +G  ++R G              L++  ++ + G      
Sbjct: 344 AGSGGYIIYAVVSTSVGSFSSGWLLRRYGSPTRCTTLFNSGIMLVSSTLINVLGFAILFR 403

Query: 430 QIVLITPQM-----PVWRQ---YLLQ-VVPGFGVSVLITVTLLAMIAAVPHEHHAATTSI 480
            I+ I+P       P   Q   +LL  V+ G          +L  +A V  +  AA+TS+
Sbjct: 404 NILSISPNFENTGGPSGSQKFWFLLGFVIMGCSQGFQNVSVMLYTVAKVGRKGQAASTSV 463

Query: 481 SYAFRSTGATLGVSVGAAVFRSSL 504
           ++ FRS G  L VS+  +V+ +SL
Sbjct: 464 TFLFRSLGNVLSVSIALSVYVASL 487

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score =  159 bits (401), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 125/460 (27%), Positives = 219/460 (47%), Gaps = 54/460 (11%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+ S++LG F ++LD TIV+ ++  +  EF   DK  WIATS+LL+++  QPLYGKLSD 
Sbjct: 45  ILSSLWLGSFFSSLDSTIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDI 104

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GRK  ++ ++  F +GCL+   + ++      R I G+G  G+ +++++  SD+   R+
Sbjct: 105 TGRKFAVLTAHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRE 164

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVV-----YLE 259
           R ++QG  N VFG+G   G  +G  F D   WR  F +Q P+ +    L +       L 
Sbjct: 165 RGIFQGYANIVFGMGQVLGAPLGGLFLDHIGWRTLFGIQVPMIMFCSYLTITNVNIKLLH 224

Query: 260 LPPRASASNKDCWSARLRRLDWAGATSLIAFL--FLFMLTSSMGGSSVAYGSRLFAAMCA 317
           +PPR     +  W   L R+D  G+ SL+A +   LF+ ++ +         +L  ++  
Sbjct: 225 VPPR---KERFTWK-NLSRIDIFGSLSLVATISGILFLTSTQL--------DKLLLSLF- 271

Query: 318 ATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSV 377
            T +   +F+++EL  A + +LP   L     L  S+        +    F  P+Y   +
Sbjct: 272 -TFISFGLFMWIELYYAKERILPFDLLNGSFGL-CSVVTVISSYVVFGDIFRSPIYLQLI 329

Query: 378 LGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKY-----YYFLLAFCVLAIAGQVQIV 432
             +  T  G   +    ++A GSL  G  ++ T K      Y  +L+  ++ +AG V   
Sbjct: 330 QDISVTKTGLFLIIPSIAMAGGSLVTGWILRNTTKNLSHCAYGIILSGVIIQLAGLVIAY 389

Query: 433 LITPQM-PVWRQ----------------------YLLQVVPG-FGVSVLITVTLLAMIAA 468
           L+   + P   Q                      ++  ++ G +G S ++  TL++++  
Sbjct: 390 LLIGHLNPSLNQLGNVFNIAMENFTSGSRTWKVIFVFSLLLGSYGYSSILVATLVSIVFT 449

Query: 469 VPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLL 508
           +        T I Y +RS G  LG S+   ++R++L   L
Sbjct: 450 IEKSQQGTMTGIFYLWRSIGNVLGASLTLVLYRNTLAKRL 489

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score =  155 bits (391), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 134/488 (27%), Positives = 225/488 (46%), Gaps = 62/488 (12%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I++S+++G FL +LD TIV+ ++  +  EF   DK  WI TS+LL+++  QPLYGKLSD 
Sbjct: 42  ILYSLWMGSFLGSLDSTIVANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GRK  L+ +++ F +GCL   LS ++      R + G+G  G+++L+++ +SD+   ++
Sbjct: 102 AGRKTALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKE 161

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGIL-----IVVYLE 259
           R VYQG  N VFG G+  GG +G +  D   W++ F  Q P+ +    L      +  L 
Sbjct: 162 RGVYQGYANVVFGTGSMLGGPIGGWLMDSFGWKVIFAGQVPLIMTCMFLGYRNVNIKLLH 221

Query: 260 LPPRASASNKDCWSARLRRLDWAGATSLIAFL--FLFMLTSSMGGSSVAYGSRLFAAMCA 317
           +PPR     +  W   ++R+D  G+ SLI  +  FL + ++ +              +  
Sbjct: 222 VPPR---HERYRWE-NIKRIDLGGSISLIGTISGFLCLCSTDLNK----------PLLAT 267

Query: 318 ATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSV 377
            TL+   +F+  EL  A + ++P   L     + +SL   F         F  PVY   V
Sbjct: 268 LTLLSLVLFIMNELYWAPERIIPTDLLSGTFGI-TSLLTVFSSFIAFGDVFRNPVYLQLV 326

Query: 378 LGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTG------KYYYFLLAFCVLAIA---GQ 428
             +  T  G   + S  S A  SL  G  ++ T        Y    +A C+  I+   G 
Sbjct: 327 QNISPTSTGGFLLFSSISSALASLATGWILRNTSLGLATCSYLLITIAVCLHFISLSLGY 386

Query: 429 VQIVLITPQMPV---------------------WR--QYLLQVVPGFGVSVLITVTLLAM 465
             I  + P  P                      WR    +  ++  +G + L+  TL+++
Sbjct: 387 TTISHLEPN-PTSHVSALDTSGTNYWFTSNQFRWRVLYVIAMILNSWGYASLLVATLVSI 445

Query: 466 IAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSEREL 525
           +  +P    A  T   Y +RS G  LG S    +F SS T+    K+ ++    + ++E 
Sbjct: 446 VFTIPKSQQATITGCFYLWRSIGTVLGASSVLTIFESSATT----KLYQYLHPINMDKEY 501

Query: 526 RGIIASAA 533
             +I   +
Sbjct: 502 ESLIHDTS 509

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score =  154 bits (388), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 144/488 (29%), Positives = 229/488 (46%), Gaps = 53/488 (10%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           L I+ S++LG F+ +LDGTIV+ ++  +  EF   DK  WIATS+LL+++  QPLYGKLS
Sbjct: 33  LPILTSLWLGSFIGSLDGTIVANIMNRVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLS 92

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
           D  GR+  L+ ++  F +GCL+   + S+      R I GIGG G+ + +++ +SD+   
Sbjct: 93  DITGRRFALLTAHFFFGLGCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDICTA 152

Query: 206 RDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGIL----IVVYL 258
           ++R  YQG  N VFG G   GG +G    D   WR  F +Q PI +    L    I + L
Sbjct: 153 KERGSYQGYANIVFGTGQMLGGPIGGLLIDTIGWRAIFAVQVPIIMFCSFLTYKNITIKL 212

Query: 259 -ELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCA 317
             +PP    S +  W   L R+D  G++SL+  +   +   S   + V         +  
Sbjct: 213 SHIPP---VSERFTW-MNLSRIDIMGSSSLVVVICGILFICSTNWNKV--------ILST 260

Query: 318 ATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSV 377
            T+V    F+  E   A + +LP+  L+  S L  SL             F  P+Y+  V
Sbjct: 261 FTIVGFLFFIVTETYFAKECILPLKLLKGASGL-CSLVTVLSSFITFGEIFRAPIYYQVV 319

Query: 378 LGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRT----GKYYYFLLAFCVLA--IAGQVQI 431
             M  T  G   +    SVA GS+  G  ++ T    G Y Y ++   +    I   +  
Sbjct: 320 QDMSVTKTGLFVLFPAVSVAVGSVVTGTALRHTKLDLGHYCYLIILRSIFTQLIGLLLAY 379

Query: 432 VLITPQMPV-----------WRQY--------LLQVVPG----FGVSVLITVTLLAMIAA 468
           V+I    P            W Q+        +L V  G    +G S L+  TL++++ +
Sbjct: 380 VVINGTEPTIGASSSTFAVHWFQFSSDSIWWKILLVSAGCMVSYGYSGLLVATLVSIVCS 439

Query: 469 VPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDG---HSEREL 525
           V     A  T I Y +RS G+ LG S+   ++ +SLT  L   +    +D    ++++E 
Sbjct: 440 VEKSEQATLTGIFYLWRSIGSVLGTSLTLVIYENSLTKSLWGAMFGSRNDDSYHYTKKEY 499

Query: 526 RGIIASAA 533
             +I  ++
Sbjct: 500 YNLIGDSS 507

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score =  151 bits (382), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 144/539 (26%), Positives = 250/539 (46%), Gaps = 80/539 (14%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           L I+FS+++G FL ALDGTIV+ ++  +  EF   DK  WIATS+LL+++  QPLYGKLS
Sbjct: 51  LPIVFSLWMGSFLGALDGTIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLS 110

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
           D  GRK  L+ ++  F +GCL+   + ++      R I GIGG G+++++++ +SD+   
Sbjct: 111 DITGRKFALLVAHTFFCLGCLLTCFARNVTEFSIARAICGIGGGGISAMSSITVSDICTA 170

Query: 206 RDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIV--VYLEL 260
           R+R  YQG  N VF  G   G  +G +  D   WR  F LQ P+ ++  +L    V ++L
Sbjct: 171 RERGAYQGYANVVFSTGQLLGAPLGGFALDRIGWRAIFGLQVPMLLICMVLGYRNVNIKL 230

Query: 261 PPRASASNKDCWSARLRRLDWAGATSLIAFL--FLFMLTSSMGGSSVAYGSRLFAAMCAA 318
                   +  W   L R+D  G+ +L+  +   LF+ ++S+            A +   
Sbjct: 231 AHVPPLEERFTWK-NLSRIDIGGSITLVCTISGVLFLCSTSLNK----------AILSVF 279

Query: 319 TLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTN---------FY 369
           T +   +F+Y EL +A + +LP        +LG S    F + S++T           F 
Sbjct: 280 TGLSFMLFMYNELYLARERILPF------ELLGGS----FGLASILTVGSSFVIFGDVFR 329

Query: 370 LPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGK----------YYYFLLA 419
            P++   V  +  T  G   + S  + A  SL  G  ++ T            ++   L 
Sbjct: 330 SPIFLQLVQNISVTKTGGFLLFSSIATAAASLITGWILRNTKMNLAKCSYLIVFFSIFLQ 389

Query: 420 FCVLAIAGQV-------QIVLITPQMPVWRQYLLQ--------------VVPGFGVSVLI 458
            C L IA  +       Q  L+     + R YL +                 G+G + L+
Sbjct: 390 LCGLVIAVTLLSYLEPNQTSLMANNTRLKRDYLFKSDSLAWKCVYICASAFTGYGYASLL 449

Query: 459 TVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASD 518
             TL++++  +     A  T + Y +RS G  LG S+  +++ ++L+     K+  + S 
Sbjct: 450 VSTLVSIVFTIDKSQQATITGLFYLWRSIGNVLGASLTLSLYEATLSK----KLWSYLSA 505

Query: 519 GHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATF----KFCLTTMVLA 573
                +   +    +R S ++ ++    + + LL+ Y+ +   ++      CL  +VLA
Sbjct: 506 NDITEQYNNL----SRDSSYLRKNFSGELLSGLLDVYNSSFIVSYVPSVGICLCGIVLA 560

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score =  144 bits (363), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 109/348 (31%), Positives = 174/348 (50%), Gaps = 27/348 (7%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+ S++LG FL+++D TIV+ ++  +  EF    +  WIATS+LL+++  QPLYGKLSD 
Sbjct: 36  ILVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQWIATSFLLTNTAFQPLYGKLSDI 95

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GRK  L+ + + F +GC +  LS +I      R I GIGG G+ +++++ + D+   +D
Sbjct: 96  TGRKFALLTALSFFGLGCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKD 155

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYF---RDWRLAFILQCPISVLSGILIVVYLEL---- 260
           R +YQG  N VFG+G   G  VG  F     WR  F +Q P+ +++ IL  +Y+ +    
Sbjct: 156 RGIYQGYANIVFGMGQLLGAPVGGLFIATIGWRALFWIQVPLVIIAIILGEMYVNIKLVH 215

Query: 261 -PPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAAT 319
            PP    S +  W   + R+D+ G+ +L++ +  F++  S   + +        +  A  
Sbjct: 216 VPP---PSERFKWK-NISRIDFLGSFTLVSSITCFIILISTKSNVILLSLLSVLSFIA-- 269

Query: 320 LVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLG 379
                 F+YVEL V+ D +LP   L+  S   +S+A       +    F  P+Y   V  
Sbjct: 270 ------FIYVELYVSKDRILPFELLKG-SFGCNSIATVISSYVIFGEIFRSPIYLQLVQD 322

Query: 380 MKATDVGKRAMPSFFSVAFGSLGAGLYMKRTG------KYYYFLLAFC 421
                 G   +    + A GSL  G  +KRT        Y   LL  C
Sbjct: 323 FSVIKTGIFLIFPAITTAIGSLVTGAILKRTKLDLAYCSYKLVLLGLC 370

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score =  145 bits (365), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 135/481 (28%), Positives = 224/481 (46%), Gaps = 22/481 (4%)

Query: 123 ASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRF 182
           ++WI T+YL++S++ QPLYG  SD LGR+  L F+N  F IGCL CG S +I+ +   R 
Sbjct: 4   SNWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRA 63

Query: 183 ISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLA 239
           ++GIGG GL +L+T++ SD++P   R ++Q   N + G G   G   G        WR  
Sbjct: 64  LTGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIASSIGWRWC 123

Query: 240 FILQCPISVLSGILIVVYLELPPRASASNKDCWSAR---LRRLDWAGATSLIAFLFLFML 296
           F++Q PISV+S IL+  Y+      +  N   +      LR +D  G+  +I  L L +L
Sbjct: 124 FLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGSILIITGLTLQLL 183

Query: 297 TSSMGGSS--VAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRS---VLG 351
             S+G S+  +++ S     +   +++   +F+  E + +A  ++P+  +       VL 
Sbjct: 184 YLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYSVVVLS 243

Query: 352 SSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKR-AMPSFFSVAFGSLGAGLYMKRT 410
            S+   F   + +   F LP+++  VLG      G R  +PS F+   GSL  G  M + 
Sbjct: 244 ISILVGFASYAYL---FTLPLFFQIVLGDSTAKAGLRLTIPSLFT-PVGSLITGFSMSKY 299

Query: 411 GKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVP 470
                 L     L   G    + I    P W   L  +    G  +    TL   I    
Sbjct: 300 NCLRLLLYIGISLMFLGNFLFLFIEKTSPNWLIGLFLIPANLGQGITFPTTLFTFIFMFS 359

Query: 471 HEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIA 530
               A  TS  Y FRS G+  GV++ A V + S   LL + +         E +++ +I 
Sbjct: 360 KSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFAGLLRSNLKGLL----DENKIKKLIV 415

Query: 531 SAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIK 590
             + +S ++  S    V+ T+++ +  A++           LA + C I+K++      +
Sbjct: 416 QLSANSSYIG-SLHGEVKNTVIKSFDEATKRAHLMSTLLSSLALILC-ILKDNLAKPKTR 473

Query: 591 R 591
           R
Sbjct: 474 R 474

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score =  145 bits (365), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 151/603 (25%), Positives = 272/603 (45%), Gaps = 74/603 (12%)

Query: 12  PVDRDAMQDPSTDLPGFVANQIEQQDHLLDIE---QGRAYGSTTKSSISSENEREDAGGA 68
           P +    Q    ++     N +++Q+  L ++   +  +Y S  + S + E  +ED    
Sbjct: 32  PSNSKLGQMSEDEVATIELNSLDKQNVQLTVQSSSENDSYKSGREHSGALEGNKEDEEDL 91

Query: 69  TVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIAT 128
            +       F         ++ S++    L+ALDGTIVST +  + S F      +W+AT
Sbjct: 92  EIDLRDPKTFKW-------VLTSLWTNSALSALDGTIVSTTVNDVASRFQQASMVTWVAT 144

Query: 129 SYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGG 188
           +YLL+++  QPLYGK+SD +GR+  L+F   VFA+G  +C  S SI  +   R I GIGG
Sbjct: 145 AYLLTTTAAQPLYGKISDIIGRRKCLLFGEIVFAVGVGLCIFSKSIPQLAIARGICGIGG 204

Query: 189 CGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGA-----------YFRDWR 237
            G  ++  +I+SD+ PL +R  Y       +G G+  GG+  +           YF    
Sbjct: 205 SGTGAMTNIILSDMAPLSERGKY-------WGYGSMLGGVFQSLGGPLGGILLTYFGVSG 257

Query: 238 LAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLI----AFLFL 293
           L FI Q P  + +  L   Y++     +   K  W    +R+D+ G+  L+    +F+F 
Sbjct: 258 L-FIPQIPFCLATLYLSWKYVQ---DYNQDTKGSW----KRIDFGGSICLLVGISSFIFF 309

Query: 294 FMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSS 353
           F    +   S  +  S       A  ++F  +F+ VE  VA + ++P+  L+    L + 
Sbjct: 310 FSADENPSISEHSGWSPYKKWSFAIFVLFTILFLVVEKYVALENIIPMEVLKGTLGLLAF 369

Query: 354 LANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGK- 412
           +     M++  T  F +P++   V G+  +  G   +    S + GSL +G  +K+  K 
Sbjct: 370 IQGLVSMIN-YTELFIVPLFLQLVWGISVSTSGAYIVCIVISYSVGSLLSGALIKKVAKP 428

Query: 413 -----YYYFLLAFCVLAIAGQVQIVLITPQM----PVWRQYLLQVVPGFGVSVLITVTLL 463
                 YY  ++   +++   V    +   +    PV+     +V       ++  +TLL
Sbjct: 429 SRESTIYYSGVSIFYMSLISMVGYYFLDRAVRYTKPVYGD--TKVPESLNFQLIFGITLL 486

Query: 464 AM-------------IAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDA 510
            +             +A V  +  A++TS+ + FRS G  L VS+   VF ++L   L  
Sbjct: 487 GLCQGSQGVTIMLYNVAKVGRKGQASSTSVQFLFRSLGNVLSVSLAFNVFTNALRKTL-G 545

Query: 511 KVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTM 570
           KV+   +D     EL  ++     ++   ++  P     ++LE +H A  ++F  C+  +
Sbjct: 546 KVLAGKND-----ELFALLLK--DNAFLRNKDMPTDDLDSILEAFHKALVSSFVPCIWCL 598

Query: 571 VLA 573
           +L+
Sbjct: 599 ILS 601

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score =  142 bits (359), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 129/439 (29%), Positives = 206/439 (46%), Gaps = 29/439 (6%)

Query: 123 ASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRF 182
           ++WI T+YL++S++ QPLYG  SD LGR+  L F+NA F IGCL CG S++I+ +   R 
Sbjct: 4   SNWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFMRA 63

Query: 183 ISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLA 239
           ++GIGG GL +L+T++ SD++P   R ++Q   N + G G   G   G        WR  
Sbjct: 64  LTGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIASTIGWRWC 123

Query: 240 FILQCPISVLSGILIVVYLELPPRASASNKDCWS---ARLRRLDWAGATSLIAFLFLFML 296
           F++Q PIS++S IL+  Y+      +  N + ++     L  +D  G+  +I  L L +L
Sbjct: 124 FLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSILIITGLTLQLL 183

Query: 297 TSSMG--GSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRS---VLG 351
             S+G   S++++ S     +   +++   +F+  E +  A  ++P+  +       VL 
Sbjct: 184 YLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYSFVVLS 243

Query: 352 SSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKR-AMPSFFSVAFGSLGAGLYMKRT 410
            S+   F   + +   F LP+++  VLG      G R  +PS F+   GSL  G  M + 
Sbjct: 244 ISILVGFASYAYL---FTLPLFFQIVLGDSTAKAGLRLTIPSLFT-PVGSLITGFSMSKY 299

Query: 411 GKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVP 470
                 L     L   G    + I    P W   L  +    G  +    TL   I   P
Sbjct: 300 NCLRSLLYLGISLMFLGNFLFLFIEETSPNWLISLFLIPANLGQGITFPTTLFTFIFMFP 359

Query: 471 HEHHAATTSISYAFRSTGATLGVSVGAAVFR--------SSLTSLLDAK-----VMRFAS 517
               A  TS  Y FRS G+  GV++ A V +        ++L  LLD       V++ + 
Sbjct: 360 KSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFANFLCTNLKGLLDENTIKKLVIKLSD 419

Query: 518 DGHSERELRGIIASAARSS 536
           +      L G + SA   S
Sbjct: 420 NSSYIGSLHGEVKSAVIKS 438

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  144 bits (363), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 144/494 (29%), Positives = 226/494 (45%), Gaps = 61/494 (12%)

Query: 55  SISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIG 114
           SIS ENE  D G             LP   IL+   S++LG FL ALDGTIV+ ++  I 
Sbjct: 15  SISEENEC-DVG--LEREYHEHNLALPKIPILV---SLWLGSFLVALDGTIVANVMNRIA 68

Query: 115 SEFNSLDKASWIATSYLLSSSTCQPLYGKLSD-RLGRKPLLVFSNAVFAIGCLICGLSNS 173
            EF   DK  WIATS+LL+++  QPLYGKLSD   GRK   + +   F +G +I   + +
Sbjct: 69  EEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFLGLIISCFAQN 128

Query: 174 IWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYF 233
           +     GR + GIGG G+++++++ +SD+   ++R +YQG  N VFG G   G  +G   
Sbjct: 129 VTQFAIGRAVCGIGGGGVSAMSSIAVSDICTAKERGMYQGYANIVFGSGQLLGAPLGGLL 188

Query: 234 RD---WRLAFILQCPISV----LSGILIVVYL-ELPPRASASNKDCWSARLRRLDWAGAT 285
                WR  F +Q P+++    L+G  + + L  LP R    N+      L RLD  G+ 
Sbjct: 189 ITTIGWRAIFAIQVPMALFCMFLTGRNVNIKLAHLPSR----NERFTLKNLSRLDLLGSC 244

Query: 286 SLIAFL--FLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTF 343
           +L+  +   LF+ ++SM  + ++          A T+V  A+F+Y E   A + ++P   
Sbjct: 245 TLVLSISGLLFLFSTSMNRTWIS----------AFTIVTFAIFIYNERFWAKERIIPFDL 294

Query: 344 LRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGA 403
           L   S + +SL        M    F  P+Y   V  +     G   +    + A  S+  
Sbjct: 295 LCGTSGI-TSLLTVLSSFIMFGDVFRSPIYLQIVQNVSLAKSGIFILFGSVACAATSVLT 353

Query: 404 GLYMKRTGK-----YYYFLLAFCVLAIAGQV-QIVLITPQMP------------------ 439
           G  ++RT        Y  +L    L + G     +LI   +P                  
Sbjct: 354 GWIIRRTTMDLVKCTYLIVLVMIFLQLVGTASNAILIANLIPNNTTYADKDVAIKVALSA 413

Query: 440 ---VWRQYLL--QVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVS 494
               W+   +   V+  FG   ++   L++++  VP    A  T + Y +RS G  LG S
Sbjct: 414 KGFTWKVVYVFSTVLNSFGYGGVLVAVLVSIVFTVPKSQQATLTGVFYLWRSIGNVLGTS 473

Query: 495 VGAAVFRSSLTSLL 508
           +  A++   L S L
Sbjct: 474 ITLALYDLILKSKL 487

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score =  140 bits (353), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 152/559 (27%), Positives = 252/559 (45%), Gaps = 110/559 (19%)

Query: 2   VQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENE 61
           VQ E++ LL+PVD D            V + +E++ H    EQ                 
Sbjct: 5   VQDENTRLLSPVDED----------NNVHSILEKEYH----EQ----------------- 33

Query: 62  REDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLD 121
                             LP + IL+   S++LG FL ALDGTIV+ ++  I  EF   D
Sbjct: 34  ---------------NLNLPKTPILV---SLWLGSFLVALDGTIVANVMNRIAEEFQESD 75

Query: 122 KASWIATSYLLSSSTCQPLYGKLSD-RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAG 180
           K  WIATS+LL+++  QPLYGKLSD   GRK   + +   F +G +I   + ++     G
Sbjct: 76  KKQWIATSFLLTNTAFQPLYGKLSDVATGRKGAALVAQFFFCLGLVISCFAQNVTQFAVG 135

Query: 181 RFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYF---RDWR 237
           R + GIGG G+ +++++++SD+   ++R +YQG  N VFG G   G  +G        WR
Sbjct: 136 RAVCGIGGGGIAAMSSIVVSDICTAKERGMYQGYANIVFGSGQLLGAPLGGLLITTLGWR 195

Query: 238 LAFILQCPISVLSGILI-----VVYLELPPRASASNKDCWSAR-LRRLDWAGATSLIAFL 291
             F +Q P+++L  +L      +    LPP      K+C++ + L RLD  G+ +L+  +
Sbjct: 196 AIFAIQVPVTLLCMVLAFRNVNIKLAHLPPP-----KECFTLKNLSRLDLLGSCTLVMSI 250

Query: 292 --FLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSV 349
              LF+ ++++        ++L+ ++  A + FG +FVY E   A + ++P   LR  S 
Sbjct: 251 SGLLFLFSTTL--------NKLWISIFTA-VSFG-LFVYNEYYWATERIIPFELLRGESG 300

Query: 350 LGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKR 409
           + S+L        M    F  P+Y   V  +     G   +    + A  S+  G  ++R
Sbjct: 301 VTSALTV-LSSFVMFGDVFRSPIYLQVVQNVSLARSGLFILFGSIACAGSSMLTGWLIRR 359

Query: 410 TGK-----YYYFLLAFCVLAIAGQ-VQIVLI---------------------TPQMPVWR 442
           T        Y  +L   +  +AG  +  VLI                      P+  +W+
Sbjct: 360 TNMGLVKCAYLIVLGMIISQLAGTAINAVLIAKLKPNQTSHALTDSITQQTLQPEGLLWK 419

Query: 443 QYLLQ--VVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVF 500
              +   V+  FG   ++   L++++  VP    A  T + Y +RS G  LG SV   ++
Sbjct: 420 IIYVSATVLNTFGYGGVLVAVLVSIVFTVPKSQQATLTGVFYLWRSIGNVLGTSVTLTLY 479

Query: 501 RSSLTSLLDAKVMRFASDG 519
             +    L AK+ ++ S  
Sbjct: 480 DLT----LKAKLWKYMSSN 494

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score =  130 bits (326), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 121/492 (24%), Positives = 218/492 (44%), Gaps = 70/492 (14%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           L ++ S+++  FLA++D TI++ ++  +  EF    +  W+ATS+LL+S+  QP+YGKLS
Sbjct: 47  LPMLLSLWMANFLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKLS 106

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
           D  GR+ +LV + ++F +GCL+   + +IW    GR I GIG  G+ ++  + M D+  +
Sbjct: 107 DVTGRRFVLVLAYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSV 166

Query: 206 RDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLEL-- 260
           +++++YQ   + ++ +G   G  +G    +   WR  F+ Q P+     + I +YL L  
Sbjct: 167 KEQSIYQSYAHIIYTIGEVLGAPIGGIALETVGWRAIFLAQVPV-----LTICIYLTLCD 221

Query: 261 --------PPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLF 312
                   PP      +  W   + R+D +G+  LI  L   +L SS   + + Y   L 
Sbjct: 222 DDLAQQHIPPHG---ERLTWK-NISRMDLSGSILLIISLCGVILLSS--ATIIEYWMWLL 275

Query: 313 AAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFY-LP 371
               A       +F+  EL   ++ ++P  F + +  +G +         +  +  Y  P
Sbjct: 276 VIASA------GLFIINELYWVSECIIP--FRKLKGAIGLTSLLLLVSSFIEYSELYRTP 327

Query: 372 VYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKY-----YYFLLAFCVLAIA 426
           ++   V  M  +  G   + S  + A  +L +G  ++ T        +  +     L +A
Sbjct: 328 LFLQLVQNMSTSTTGVVLLFSSAASAVATLLSGWVLRTTRTNLGEASFNHMFGSMTLQVA 387

Query: 427 GQVQIVL-------------------ITPQM-----PVWRQYLLQVVPGF--GVSVLITV 460
           G   I++                   + P M      VW+   +  +     G + L+  
Sbjct: 388 GLTTILVLIHFLNPDQSSIQVTSEHRLAPFMMNSDSAVWKIIYVAALSTVSSGHAGLLVS 447

Query: 461 TLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLT----SLLDAKVMRFA 516
           TL ++         A  T   Y FR  G+ LG S   +V+ S L+    + LD   M+ +
Sbjct: 448 TLTSIFVHTETPDRAMFTGAFYLFRYIGSVLGASTALSVYESVLSKRLWNYLDLNNMKDS 507

Query: 517 SDG--HSERELR 526
            DG  H    LR
Sbjct: 508 YDGLMHDSSYLR 519

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score =  128 bits (322), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 121/461 (26%), Positives = 212/461 (45%), Gaps = 54/461 (11%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I+ S++LG FL+ALD TIV+ ++  +  +FN+ ++  WIATSYLL+++  QPLYG+LSD 
Sbjct: 68  ILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQPLYGRLSDI 127

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
           +GRK   +     F +G  +   S ++      R ++GIGG G+++++++ +SD+  +++
Sbjct: 128 IGRKYTQLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKE 187

Query: 208 RAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLE----- 259
           R +YQG  N  +G G   G  +G    D   WR  F  Q P+  ++  L   YL      
Sbjct: 188 RGMYQGYANIFYGAGQLIGAPIGGLLIDRIGWRALFAFQVPMVAVAMFLSFTYLNIKLAH 247

Query: 260 LPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAAT 319
           LPP+     +  W   L +LD  G+ +L+  + + ++  S  G        +  AM    
Sbjct: 248 LPPK---EERYKWK-HLSKLDIFGSITLVITIGICIVILSDNG----LNRMVLGAM--GL 297

Query: 320 LVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLG 379
           L FG +F+ +E       +LP+  L+  S   +SL        +    F  P+Y   +  
Sbjct: 298 LSFG-LFLIIEKYYTKHQILPLKCLQG-SFGYASLTIIISTYVIFGEYFRTPIYLQVIQN 355

Query: 380 MKATDVGKRAMPSFFSVAFGSLGAGLYMKRTG----KYYYFLLAFCV-LAIAGQVQIVLI 434
              +  G   +     VA GS+  G  +K++     K  Y L+ + V     G + + L+
Sbjct: 356 FTVSQSGIFLLFPTICVAGGSVLTGRVLKQSKMDLEKCSYQLIFYSVCTQFVGLLMLTLL 415

Query: 435 TPQMPVWRQYLLQVVPG---------------------------FGVSVLITVTLLAMIA 467
              + ++        PG                           FG + ++  TL++++ 
Sbjct: 416 INYLHIFNSN--NTKPGVGNIFHELTTVDFSWKIIFCIATSLVTFGYASILVATLVSIVH 473

Query: 468 AVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLL 508
            V      + T + Y +RS G  LG S+    + ++LTS L
Sbjct: 474 TVEKSQQGSITGLFYLWRSLGNVLGTSITLITYENNLTSKL 514

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score =  119 bits (298), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 136/503 (27%), Positives = 226/503 (44%), Gaps = 82/503 (16%)

Query: 48  YGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVS 107
           YG+ +  +++ E +R          C      LP + IL    S++LG FLA++D +IV+
Sbjct: 20  YGTNSDKTLT-ETQR----------CQEHNRSLPKAPILT---SLWLGSFLASIDASIVA 65

Query: 108 TLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLI 167
            ++  I  EF+  DK  W+ATS+LL+++  QPLYG+ SD +GRK  L+ + + F +G L+
Sbjct: 66  NIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTLL 125

Query: 168 CGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFG----LGT 223
              + ++      R I G+GG G+ +++++ +SD+   ++R +YQG  N +FG    LG 
Sbjct: 126 TCFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKERGMYQGYANVIFGAGQVLGA 185

Query: 224 ASGGLVGAYFRDWRLAF------ILQCPISVLSGILIVVYLELPPRASASNKDCWSARLR 277
             GGL+   F +WR+ F      I+ C I     I + + L +PP      +      L 
Sbjct: 186 PVGGLIMETF-NWRIIFAAQVVAIMICMILAYRNINLKL-LHIPPFHQRFTRK----NLS 239

Query: 278 RLDWAGAT----SLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRV 333
           R+D  G++    SL++FL LF   SS    S+ +           TLV   +F   E  +
Sbjct: 240 RIDLFGSSMLSCSLVSFLMLF---SSGVSRSLWF---------LLTLVSLTLFCINERYI 287

Query: 334 AADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSF 393
           A + +LP   LR    L + L      M M    + +PVY   +  +  +  G   + + 
Sbjct: 288 ATERLLPNGILRGHFGLSALLIVVSSFM-MFAELYRMPVYLQLIQDISVSRSGIFLLFAS 346

Query: 394 FSVAFGSLGAGLYMKRT----GKYYYFL-LAFCVLAIAGQVQIVLIT----PQMPV---- 440
            S +  SL  G  ++ T    GK  Y + LA   + + G +  +  T    P   V    
Sbjct: 347 VSSSGASLFTGWLLRTTKQDLGKLVYKIALASSFIQLVGMMLALFTTSVTEPSQAVHAGW 406

Query: 441 --------------------WRQYLLQVV--PGFGVSVLITVTLLAMIAAVPHEHHAATT 478
                               WR  L   +    F  + L+   L++++        A   
Sbjct: 407 AVFSPRSAGQMHYFKSDSIAWRVLLTVALMCSSFAYASLLVSILVSIVDTTEKSQQATMI 466

Query: 479 SISYAFRSTGATLGVSVGAAVFR 501
            + Y +RS G TLG SV  +V+ 
Sbjct: 467 GVFYLWRSIGNTLGASVPLSVYE 489

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score =  119 bits (298), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 117/447 (26%), Positives = 203/447 (45%), Gaps = 52/447 (11%)

Query: 98  LAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFS 157
           LAALDGTIVST +  I S+F      +W+AT+YLL+++  QPLYGK+SD +GR+  L+F 
Sbjct: 72  LAALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFG 131

Query: 158 NAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNF 217
             +FA+G L+C  +N+I  +   R I GIGG G +++  ++++D++PL  RA Y      
Sbjct: 132 EVIFALGVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSVRATYWSYGAI 191

Query: 218 VFGLGTASGGLVGAYFRDWRLA---FILQCPISVLSGILIVVYLELPPRASASNKDCWSA 274
           +  +  + GG +G     W      F  Q P  + S  L   Y+          K+   +
Sbjct: 192 LASIFQSLGGPIGGLLLKWFGVGGLFTPQIPFCIGSIYLSYKYIH-------DYKEHARS 244

Query: 275 RLRRLDWAGATS-LIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAV--FVYVEL 331
             +R+D+ G+   L+         S+   +++           +  L+  ++  F ++E 
Sbjct: 245 SWKRIDFGGSICLLVGISSFIFFFSASDNTTIEDDGWSTPKKWSVVLLIVSIIAFAFIEN 304

Query: 332 RVAADPVLPVTFLRDRSVLGSSLANWFCMMSMM-----TTNFYLPVYWSSVLGMKATDVG 386
            VA + ++P      R +L  +L    C+  ++     T  F +P++     G+  +  G
Sbjct: 305 FVAVECIIP------RVILEGTLGLMVCIHGLVAVINYTCLFMVPLFLQLNWGVSVSRSG 358

Query: 387 KRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFC---------VLAIAG----QVQIVL 433
              M      + GSL   + + R  K       FC         +L I G    Q  I  
Sbjct: 359 GYIMFIVIFSSAGSLFTSMILNRFSKPTRSSQLFCAASAIFYMSILTIVGYYYMQKAIYY 418

Query: 434 ITP------QMPVWRQYLLQVVPGFGV------SVLITVTLLAMIAAVPHEHHAATTSIS 481
             P      Q+P +  +   ++ G  +      S  +T+++   +A V  +  A++TS++
Sbjct: 419 SKPIYGSDTQIPKYDNW--SIILGIAILGFCQGSQNVTISIYN-VAKVGRKEQASSTSVN 475

Query: 482 YAFRSTGATLGVSVGAAVFRSSLTSLL 508
             FRS G  L VS+   +F + L   L
Sbjct: 476 LLFRSMGNVLSVSIALNIFTNVLKKKL 502

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score =  117 bits (293), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 113/447 (25%), Positives = 195/447 (43%), Gaps = 37/447 (8%)

Query: 96  IFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLV 155
           +F+ ALD  IV T++  +   F    K+ WI T Y L ++    L+ +LS  LG +  +V
Sbjct: 54  MFVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVV 113

Query: 156 FSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLC 215
               +F  G LI  L+NS+  ++AGR ++GIGG GL +L+ +I   LV  + R +   L 
Sbjct: 114 SCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 173

Query: 216 NFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGILIVVYLELPPRAS------- 265
           N  F + +  G  +G  F     WR  F +  PI  L+ I I V+   P   +       
Sbjct: 174 NCTFAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLA-IAIFVFFYNPEGVNLLEKFGN 232

Query: 266 ------------ASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFA 313
                        S K      L   D     S  A   LF+L  + GG + A+ S +  
Sbjct: 233 TFKKVSSFHPVKKSPKKVLQQLLFGFDILSFISFTAGWLLFLLALTFGGQTHAWNSGIVI 292

Query: 314 A-------MCAATLVFG-AVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMT 365
           +       + A +LV+   VF  ++ + +  P+L    + +RS+L S+   +F  ++   
Sbjct: 293 SFIIIGVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGFFSTVAYNV 352

Query: 366 TNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAI 425
              Y   ++  V G  A   G   +P   S    S+ +G+  K+TG     L+    + +
Sbjct: 353 QMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGHIKPLLVFGSAMGV 412

Query: 426 AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHA------ATTS 479
            G   + L+  +     Q  + ++PG  +  ++   L+A    +   + +       TTS
Sbjct: 413 LGGGLMTLLDNKSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKGNPSYGADLLETTS 472

Query: 480 ISYAFRSTGATLGVSVGAAVFRSSLTS 506
           ++   +S G TLG  +   VF +S+ +
Sbjct: 473 VNALLKSLGTTLGSILSTMVFSTSMNN 499

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score =  112 bits (279), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 108/460 (23%), Positives = 199/460 (43%), Gaps = 35/460 (7%)

Query: 96  IFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLV 155
           +F+ ALD  IV T++  + + F    K+ WI T Y L ++    L+G+LS  LG +  ++
Sbjct: 54  MFVTALDVLIVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVI 113

Query: 156 FSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLC 215
               +F  G LI  L+ S+  +++GR I+G+GG GL +L+ +I   LV  + R +   L 
Sbjct: 114 SCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLSLL 173

Query: 216 NFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLS-GILIVVY----LELPPRASAS 267
           N  F + +  G  +G  F     WR  F +  PI  L+  I I  Y     +L  + S +
Sbjct: 174 NCTFAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLAIAIFIFFYNPEGADLLEKGSQT 233

Query: 268 NKDCWSARLRRLDWAGATSLIAFLF-------------LFMLTSSMGGSSVAYGSRLFAA 314
            K   S R   L        + F F             LF+L  + GG +  + S +  +
Sbjct: 234 FKKLLSYRRANLSLKQLLDQLLFGFDIVSFVLFTAGWLLFLLALTFGGQTHPWKSGIVIS 293

Query: 315 -------MCAATLVFG-AVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTT 366
                  + A +L++   +F +++      P+L    +  R++L ++   +F  ++    
Sbjct: 294 FIIVGVLLIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQRAILNANFTGFFSTIAYNVQ 353

Query: 367 NFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIA 426
             Y   ++  V G  A   G   +P   S    S+ +G+ +K+TG     L+    + + 
Sbjct: 354 MIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGHIKPLLVFGSAMGVL 413

Query: 427 GQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHA------ATTSI 480
           G   ++L+        Q  + ++PG  +  ++   L+     +     +       TTS+
Sbjct: 414 GSGLMILLNNTSTKHTQIGVLILPGVALGFVLPAALITCHVQLDRTSPSYGADMLETTSV 473

Query: 481 SYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGH 520
           +   +S G T+G  +   VF +SL + +    + F   G 
Sbjct: 474 NALLKSLGTTVGSILSTMVFSTSLHNKMKNSNILFEVSGE 513

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 120/515 (23%), Positives = 212/515 (41%), Gaps = 32/515 (6%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           +I +FS+ L  F    D T+   L T  GS       +SWI  SYL++    Q L  ++S
Sbjct: 198 MIFLFSLLL--FTIIFDFTLAMMLSTTSGSHVKQSSNSSWIIASYLITMYISQLLTAQVS 255

Query: 146 DRLGR-KPLLVFSNAVFAIGCLICGLSN-SIWAVVAGRFISGIGGCGLTSLATMIMSDLV 203
            +    K L      +F IG  I  +   S W +V  RFI G+    L  +   I++  +
Sbjct: 256 GKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLASGSLIYVMLTIINKCI 315

Query: 204 PLRDRAVYQGLCNFVFGLGTASGGLVGAY-----FRDWRLAFILQCPISVLSGILIVVYL 258
            L  R     +  F   +    GGL  AY        W+  + L    S  +  LI+ Y 
Sbjct: 316 -LNKRFSRPSMKIFTIPI---VGGLSLAYATAIFITSWQNVYFLLAIFSFFTLFLIMFYF 371

Query: 259 ELPPRASASNKDCWS-ARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCA 317
                   +N +  S      +D  G T L  FL L  + ++   +  +  S   A +  
Sbjct: 372 PSNESYKTNNTNLSSIVATLDIDLIGCTILSVFLLLIAVITTGNSNGFSITSPYSATLVI 431

Query: 318 ATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSV 377
           + ++ G + +  E     +P++P+ F+ ++ +   SL  +F  MS++T   Y P Y    
Sbjct: 432 SIILVGILLLLSETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKT 491

Query: 378 LGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFC-VLAIAGQVQIVLI-- 434
           L +   D+ KR  P F ++ F  +     +       Y L+ F  ++ + GQ  ++    
Sbjct: 492 LNISLFDIYKRTSPMFLTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVY 551

Query: 435 --TPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLG 492
             T    +W+Q ++ ++P  G + L+  TL+ +      +     ++ S+A  + G+ LG
Sbjct: 552 NDTADYKLWKQCMIGILPILGSTFLVIATLMDV---TDDKKLPIISTSSFAVSTLGSILG 608

Query: 493 VSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLL 552
           + +   +F   L   L             E+ L  II     +S++   S+  +    +L
Sbjct: 609 ICISGFIFNQGLYDELWVH-------STEEKGLGKIIRKMINNSEY--ESSSRYYCYEIL 659

Query: 553 ECYHFASRATFKFCLTTMVLAGVS-CSIIKEHKLH 586
           E Y   S   F F    +++A +S C  IK  + H
Sbjct: 660 ESYFIVSGYVFLFSAICLLVAVISFCFTIKNKRHH 694

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score =  103 bits (257), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 124/564 (21%), Positives = 238/564 (42%), Gaps = 64/564 (11%)

Query: 53  KSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTH 112
           K+  +S+NE+  +  + +AG           R+ + +F++ L   + ALD  IV+T++  
Sbjct: 54  KNVFTSDNEKTQS--SIMAGM----------RLYVCLFALVLAQLIVALDVFIVNTVIDV 101

Query: 113 IGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSN 172
           +        K+ W+ T Y L +S    ++G+ +  LG +  ++ S  +F +G ++   + 
Sbjct: 102 VSKNLGGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLISIFIFEVGSIVSATAT 161

Query: 173 SIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAY 232
           S+  +V GR ++GIGG GL +++ +I   LV  R+R +   +    F + +  G  +G  
Sbjct: 162 SMNNLVVGRVVAGIGGSGLQTVSMIIGCSLVEERNRTIVIAVIMSAFAVSSLIGPFIGGA 221

Query: 233 FR---DWRLAFILQCPISVLSGILIVVYLELPPRASASNK-------------------D 270
           F     WR  F +  P+   S   +  +   P R S + +                   +
Sbjct: 222 FTTHATWRWCFWISLPVGG-SAAFLFFFTYNPERLSITARLVRCLKLVKAIPLKQFQYVE 280

Query: 271 CWSARLR----RLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVF 326
            +   +R    R D  G T     + LF+L  + G    ++      A     LV G + 
Sbjct: 281 TYKTIVRNLVFRFDLIGFTLNCTGICLFLLGLTFGSEDNSWKR----AFVVCFLVIGGLL 336

Query: 327 V--------YVELRVAADPV-LPVTFLRDRSVLGSS---LANWF-CMMSMMTTNF--YLP 371
           V        Y+  R+  +P       L  R+++G     LAN   C  +++   +  Y  
Sbjct: 337 VVCSVVYDFYIFDRINPEPANASYRPLMVRTLIGHKYFLLANTVTCAAAVVFAGYMVYSV 396

Query: 372 VYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQI 431
            ++  VLG  A + G   +P   +    ++  G + K+TG   Y ++A   L + G    
Sbjct: 397 QFFQLVLGYTAWNAGLHLIPLVIASLLSAIFCGGFTKKTGHVKYVMIANIALLLIGSGVC 456

Query: 432 VLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISY--AFRSTGA 489
            L+        Q  + ++PGFG+   +   L++    +      A T +    AF S   
Sbjct: 457 TLLDNYSNNSMQIGVWILPGFGLGATLQCALISSQLQIDKNSPDAKTELVEITAFNSFCK 516

Query: 490 TLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRA 549
           +LG S+GA +  ++  S L  K+ +   +G+  +++  ++    ++ D     A     A
Sbjct: 517 SLGSSIGAVLSTTTFISALWRKINKAKLEGYYGKKINELVKYRLQNFDGKSTEAAEIFSA 576

Query: 550 TLLE----CYHFASRATFKFCLTT 569
            +      CY F++ A F  CL++
Sbjct: 577 AVTYVFWMCYAFSALAFFCACLSS 600

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score =  102 bits (254), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 126/247 (51%), Gaps = 21/247 (8%)

Query: 17  AMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTT--KSSISSENEREDAGGATVAGCG 74
           AM +PS  L    A Q  +Q     ++Q  A+ S+   ++SI  +N +++          
Sbjct: 4   AMSNPS--LHSKEAKQQHEQKRQFAVDQKFAHTSSEHDETSIPEDNVKKNVE-------- 53

Query: 75  SAEFYLPSSRILII-MFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLS 133
                L    IL + + ++ L +FLAALD  IVST++  +  +  S  +  W+ T Y L 
Sbjct: 54  -----LSKGSILYVSLVAVALSLFLAALDVMIVSTIIEEVAKQLGSYSEIGWLFTGYSLP 108

Query: 134 SSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTS 193
           ++    ++G+++  +G K  ++F+  +F IG LI  L++S+  ++ GR I+GIGGCG+ S
Sbjct: 109 NALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQS 168

Query: 194 LATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLS 250
           L+ +I S LV    R +   + +  F + +  G  +G  F     WR  F +  PI  L+
Sbjct: 169 LSFVIGSTLVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSVTWRWCFYINLPIGGLA 228

Query: 251 GILIVVY 257
             L V++
Sbjct: 229 FFLFVLF 235

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 116/515 (22%), Positives = 222/515 (43%), Gaps = 54/515 (10%)

Query: 40  LDIEQGRAYG---STTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGI 96
           ++IE G       ST K S+  E E           C +++    ++R+L+ +FS+ L +
Sbjct: 4   IEIESGSNRTREMSTGKESLCPEQEE----------CETSKAKNNNTRLLLSLFSLGLSM 53

Query: 97  FLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVF 156
           F+ ALD  IV T++  +   F    K+ WI T Y L ++    L+G++S  LG +  +V 
Sbjct: 54  FVTALDVLIVGTIIDTVCKSFGDYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVA 113

Query: 157 SNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCN 216
              +F  G LI  L+ S+  ++AGR +SG+GG GL +L+ +I   LV  + R +   L N
Sbjct: 114 CIVLFEAGSLISALARSMNMLIAGRVVSGVGGSGLQTLSLVIGCQLVDEKSRPLVLSLLN 173

Query: 217 FVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWS 273
             F + +  G  +G  F     WR  F +  PI    G+ I+ +L      + +  +   
Sbjct: 174 CTFAIASIIGPFIGGAFTTHVTWRWCFYINLPIG---GVAILTFLCFYNPHNENLLEEGK 230

Query: 274 ARLRRLDWAGATSLIA------FLF---------------LFMLTSSMGGSSVAYGSRLF 312
              +R+     TSL +       LF               LF+L  + GG S ++ S + 
Sbjct: 231 KAFKRVLKFKPTSLFSSKAMHQLLFGFDIVSFALFTAGWVLFLLALTFGGQSYSWDSGVV 290

Query: 313 AAMCAATLVFGAVFVYVELRV--------AADPVLPVTFLRDRSVLGSSLANWFCMMSMM 364
            +     ++   + ++ + ++           P+L    +   +++ S+ + +F  ++  
Sbjct: 291 ISFLVVGILLILLSLFYDFKLFEAMKSQENIRPLLCWRLMSQPTIVLSNFSGFFSTVAYN 350

Query: 365 TTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLA 424
               Y   ++  V G  A   G   +P   S    S+ +G+  K+TG     L+    + 
Sbjct: 351 VQMIYSVQFFQLVYGFTAWKAGLHLIPILVSTVVFSIMSGVLTKKTGHIKPLLVFGSAMG 410

Query: 425 IAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHA------ATT 478
           + G   + L+        Q  + ++PG  +  ++   L+A    +   +          T
Sbjct: 411 VLGGGLMTLLNNTSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKSNSRYGADMLEVT 470

Query: 479 SISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVM 513
           S++   +S G TLG  +   +F +S+ + + ++ M
Sbjct: 471 SVNALLKSLGTTLGSILSTMIFSTSMYNKMKSRGM 505

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 96.7 bits (239), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 104/198 (52%), Gaps = 7/198 (3%)

Query: 91  SMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGR 150
           S+ L +FL+ALD  IVST++  +  +FN   K+ W+ T Y L ++    ++G+ +  +G 
Sbjct: 48  SLTLALFLSALDILIVSTIIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGF 107

Query: 151 KPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAV 210
           K  ++ S  +F +G L+  L+NS+  ++ GR ISG+GG GL +L  +I+S LV  R R +
Sbjct: 108 KSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERSRGM 167

Query: 211 YQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGILIVVYLELPPRASAS 267
              + +  F + +  G  +G  F     WR  F +  PI  L+   +V  L   P    S
Sbjct: 168 AISVLSCSFAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLA--FLVFVLSYNPNGGNS 225

Query: 268 NKDCWSA--RLRRLDWAG 283
            K+   A   +  +D+ G
Sbjct: 226 IKNFTKAVRSISHVDFGG 243

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 82/151 (54%), Gaps = 3/151 (1%)

Query: 99  AALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSN 158
           AALD  IV TL   IG +FN  +   W+ T Y LSS+    L+G+++  LG K  L+ S 
Sbjct: 56  AALDIVIVVTLYETIGEKFNDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSV 115

Query: 159 AVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFV 218
            +F IG LI  +SNS+  ++AGR ++G GG G+ SL  ++ + LV  R R +   +  F 
Sbjct: 116 LIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTSLVSERSRGMVIMVLTFA 175

Query: 219 FGLGTASGGLVGAYFRD---WRLAFILQCPI 246
           F    A G ++G    +   WR  F +  PI
Sbjct: 176 FVGSNAGGPILGGALNEHASWRWCFFINLPI 206

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 116/240 (48%), Gaps = 15/240 (6%)

Query: 35  QQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFL 94
            +D ++   +G A  S +  S+  E  R +A G         E + P       + S+ L
Sbjct: 2   DKDSVIADTRGDA-SSVSTGSVKEEPVRTNAFGQRFPT--GVELWAP-------LGSLVL 51

Query: 95  GIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLL 154
            +FLAALD   VST++  +  +F    K  W+ T Y L ++    ++G+++  +G K   
Sbjct: 52  CLFLAALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTST 111

Query: 155 VFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGL 214
           + +  +F +G L+  L+NS+  ++ GR I+GIGG G+ SL  +I S LV  R+R +   +
Sbjct: 112 LAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERNRGLIIAV 171

Query: 215 CNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGILIVVYLELPPRASASNKDC 271
            +  FG+ +  G  +G  F     WR  F +  P+  L+  L + +    P     NKD 
Sbjct: 172 MSSSFGIASVVGPFLGGAFTTHVTWRWCFYINLPVGGLAFFLFLTFYN--PEKWVVNKDT 229

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 90/165 (54%), Gaps = 3/165 (1%)

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161
           D  IVST++  +  +F S  +  W+ T Y L ++    ++G+++  +G K  ++F+  +F
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIF 151

Query: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221
            +G LI  L+NS+  ++ GR I+G+GGCG+ SL+ +I S+LV   +R V   + +  F +
Sbjct: 152 EVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAI 211

Query: 222 GTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPR 263
            +  G  +G  F     WR  F +  PI  L+  L +++    P 
Sbjct: 212 ASVVGPFLGGVFTSRVTWRWCFYINLPIGGLTFFLFLMFCNPDPH 256

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 93.2 bits (230), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 85/312 (27%), Positives = 137/312 (43%), Gaps = 43/312 (13%)

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161
           D  IV TL   IG +F    +  W+ T Y L ++    L+G+L+  LG K  L FS  +F
Sbjct: 23  DIVIVITLYETIGEKFKDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIF 82

Query: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221
            IG LI  +SNS+  ++ GR ++G GG G+ SL  ++ + LV  R+R +   +    F +
Sbjct: 83  EIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 222 GTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRR 278
             A G ++G  F +   WR  F +  PI    G+ + +          S ++  +   R+
Sbjct: 143 AFAVGPVIGGAFTENVSWRWCFYINLPI---GGVALTMLTFSYNTTEKSVQETLTYNCRQ 199

Query: 279 LD------------WAGATSLIAF-------------LFLFMLTSSMGGSSVAYGSRL-- 311
           L             W  A + + F               LFML  + GG++ A+ S    
Sbjct: 200 LQTYRYGQWVTASFWRRAYNFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTII 259

Query: 312 -FAAMCAATLVFGAVFVYVEL--------RVAADPVLPVTFLRDRSVLGSSLANWF-CMM 361
            F  + A  ++F  VF +V L        +  A P+L  +      +  SS+AN F C  
Sbjct: 260 SFLTVGAILVLFWLVFDFVLLYKWAAWCRKREATPLLRRSLCFRPGIFTSSIANLFTCFG 319

Query: 362 SMMTTNFYLPVY 373
             M T + + +Y
Sbjct: 320 FNMQTVYIVQLY 331

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 93.2 bits (230), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 81/328 (24%), Positives = 139/328 (42%), Gaps = 36/328 (10%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           ++ +FS+ L +FL ALD  I  TL   IG  FN      W+ T Y L ++ C  L+G+++
Sbjct: 7   VVCIFSLSLTLFLGALDIVICITLYDTIGKVFNDYANVGWLMTGYNLPNALCMLLWGRIA 66

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
             +G K  LV S  +F  G L+  L+ S+  ++ GR I+G GG G+ +L   + + +V  
Sbjct: 67  SLVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDE 126

Query: 206 RDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPP 262
           + RA    +    + L   +G  +G  F +   WR  F +  PI  ++  ++        
Sbjct: 127 KHRARVVTILGIAYMLAEGAGPFIGGAFAEHVSWRWCFFINIPIGGVALAILCWGYNPAG 186

Query: 263 RASASNKDCWSARLRRLDWAGA---TSLIAFLFLF-------------------MLTSSM 300
           R   +  + +    R+  W      TSL   + LF                   ML  + 
Sbjct: 187 RTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLSSGGFALIMLALTF 246

Query: 301 GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRV-----------AADPVLPVTFLRDRSV 349
           GG+  A+ S     M    +    +F+  +  V            A P++P +   +  +
Sbjct: 247 GGNKFAWNSASIICMFTIGIALLGIFMLYDFVVLPYIGRRLENGEAMPLVPWSLACNMPI 306

Query: 350 LGSSLANWFCMMSMMTTNFYLPVYWSSV 377
           L SS+A +F   +    + YL  Y+  V
Sbjct: 307 LTSSMAGFFNSFAFELQSIYLVQYYQLV 334

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 97/194 (50%), Gaps = 8/194 (4%)

Query: 91  SMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGR 150
           S+ L +FLAALD  I+S  +  I  +F    K+ WI + Y L+ +    L+G+ +  +G 
Sbjct: 123 SLTLVLFLAALDVLIISASIEVIAEQFKDYSKSGWIVSGYSLTEALLTLLWGRFATIIGF 182

Query: 151 KPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAV 210
           K  L+ S  +F  G LI  +SNS+  ++ GR ++GIGG G+ SL  +I S L P R R +
Sbjct: 183 KSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTLTPDRSRVI 242

Query: 211 YQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGILIVVYLELPPRASAS 267
              + +  + +    G  +G        WR  F +  PI  L+   +V+ +   P    S
Sbjct: 243 IISVLSCSYAVAAVVGPFLGGALTTHVTWRWCFYINLPIGGLA--FVVLAMVYNPSGRKS 300

Query: 268 NKDCWS---ARLRR 278
            KD +S   A  RR
Sbjct: 301 IKDVFSVTKANYRR 314

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 88/165 (53%), Gaps = 3/165 (1%)

Query: 89  MFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRL 148
           + S+ L IFLAALD  IVST++ ++  EF    K  WI   Y L S+    ++G+++   
Sbjct: 58  VISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAVC 117

Query: 149 GRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDR 208
           G K  ++ +  +F +G L+  L+NS+  ++ GR I+G+GG G+ +L  +I+S LV    R
Sbjct: 118 GFKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEESKR 177

Query: 209 AVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLS 250
            +        FG+ +  G  +G  F     WR  F +  PI  L+
Sbjct: 178 GLLIACMGSAFGIASVVGPFLGGAFTTHVTWRWCFWINLPIGGLA 222

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 110/534 (20%), Positives = 223/534 (41%), Gaps = 49/534 (9%)

Query: 53  KSSISSENEREDAGG--ATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLL 110
           ++  SS+ E E A G  A++   GS +  +  S  L +  S+ L +F+ ALD  IV T++
Sbjct: 3   ETKYSSQQEIEGACGSDASLNARGSNDSPMGLSLYLCLA-SLTLVLFITALDILIVGTII 61

Query: 111 THIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170
             +  +F +  K  W+ T Y L ++    ++G+ +  +G +  L+ +  +F  G LI  L
Sbjct: 62  DVVAEQFGNYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIAAL 121

Query: 171 SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVG 230
           ++S+  ++ GR ++G+GG GL +L  +I   +V  R R +   + +  F +    G ++G
Sbjct: 122 ASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIG 181

Query: 231 AYFR---DWRLAFILQCPISVLSGILIVVYLELPP----------------------RAS 265
             F     WR  F +  PI  L+ I+ ++  +                         R  
Sbjct: 182 GAFTTHVTWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQ 241

Query: 266 ASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGS-RLFAAMCAATLVFGA 324
            + K   +  + + D+ G     A L LF+L  + GG+  ++ S ++   +    L+F  
Sbjct: 242 VNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVITYLVLGVLLFIF 301

Query: 325 VFVYVEL----------RVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYW 374
             VY              ++  P+L    +   +++  ++  +           Y   ++
Sbjct: 302 SLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFF 361

Query: 375 SSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLI 434
             +    A   G   +P   +    ++ +G+  K+ G     L+   VL + G   + L+
Sbjct: 362 QLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLM 421

Query: 435 TPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAA------TTSISYAFRSTG 488
           T       Q  + ++PGF +   +  +L++    +  +   A       T+ +   +S G
Sbjct: 422 TNTSTKSTQIGVLLLPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFNTFMKSLG 481

Query: 489 ATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRS 542
            TLG  +   VF +S  +    KV R   + +  + +  +I    ++ D  H +
Sbjct: 482 TTLGGVLSTTVFSASFHN----KVSRAHLEPYEGKTVDDMILYRLQNYDGSHST 531

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 89.0 bits (219), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 123/535 (22%), Positives = 222/535 (41%), Gaps = 70/535 (13%)

Query: 33  IEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILII-MFS 91
           +E   H ++ E G      T + +S+  E++    +        E  LPS  +L    FS
Sbjct: 31  MEIASHGINEESG------TDAEVSNHVEKKPNFNSKYGKNAMGE-DLPSGIVLYTCAFS 83

Query: 92  MFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRK 151
           + L IFLAALD  IVST++  +  +F +  K  WI   Y L ++    L+G+++  +G K
Sbjct: 84  LALAIFLAALDIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFK 143

Query: 152 PLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVY 211
             ++ +  +F IG LI G++NS+  ++ GR I+G+GG G+ SLA +I S+LV  R R + 
Sbjct: 144 SCMLAAIIIFEIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLI 203

Query: 212 QGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGILIVVYLELPPRASASN 268
               +  F + +  G  +G  F     WR  F +  P+  ++  L VV+   P R S   
Sbjct: 204 IACMSSAFAVASVIGPFLGGAFTTHATWRWCFYINLPVGGVAFALFVVFYN-PQRKSLEG 262

Query: 269 KDCWSA------RLRRL-------DWAGATS----------LIAFLF------LFMLTSS 299
               S+       LR++       +W    S          +I F+F      L +L  +
Sbjct: 263 ISILSSLKEFCNTLRQITVIKNLKNWPTWKSIVYSLVFRFDIIEFIFCSAGFVLVLLAFT 322

Query: 300 MGGSSVAYGSRLFAAMCAATLVFGAVFVYVEL--------RVAA-------DPVLPVTFL 344
            GG+   + S     M     V G + + V L        R  A        P++  +  
Sbjct: 323 FGGNQYNWSSASIIVM----FVIGIILLIVSLLYDFVIFPRFKAVKENSLYQPLIKWSIF 378

Query: 345 RDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAG 404
               +  ++ A +F   + +    Y+  ++  V G  A       + +       +  +G
Sbjct: 379 SHPGIFTANAALFFECTAYICQTVYIIQFFQLVRGNTAWKAAVHLIATVVPTVITTFSSG 438

Query: 405 LYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLA 464
           +   + G   +      V ++ G   + L+       +   L ++PG G    +  T++ 
Sbjct: 439 IANSKFGLVKHVTFIGVVTSLVGAGLLTLLDNNSSSAKHIGLLILPGIGFGATMQSTMIG 498

Query: 465 MIAAVPHEHHAAT--------TSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAK 511
             A +  +  A T        T+++   +  G  LG  +   VF +S+ + L+A 
Sbjct: 499 --AQIQLDKKAVTYRSDFIAVTTLNAFLKGAGQALGGIICDTVFSASIVNKLNAN 551

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 138/306 (45%), Gaps = 34/306 (11%)

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS-DRLGRKPLLVFSNAV 160
           D  IV+T++  +G+ F++  K  WI   Y L ++    L+G+++   LG K  ++ +  +
Sbjct: 74  DIMIVTTIINDVGAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVI 133

Query: 161 FAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFG 220
           F IG LIC L+NS+  ++ GR I+GIGG G+ SL+ +I S LV  R R       +  FG
Sbjct: 134 FEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSFVIGSTLVSPRGRGFIIAFMSASFG 193

Query: 221 LGTASGGLVGAYFRD---WRLAFILQCPISVLS--------------GILIVVY--LELP 261
           + +  G  +G  F     WR  F +  P+  ++               +L+ ++   EL 
Sbjct: 194 IASVIGPFIGGAFTSHVTWRWCFWINLPVGAVALVIFTWVYNPTGKKQVLLTIHDLKELS 253

Query: 262 PRASASN-KDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSR---------- 310
            +      KD     L +LD      + A +   +L  + GG+   +GS           
Sbjct: 254 EKVKKVRFKDLLKHLLFKLDIIEFMLISAGIVCILLAFTFGGNRFKWGSYSIILLFVIGG 313

Query: 311 --LFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLAN-WFCMMSMMTTN 367
             +  A+    ++F  + +     +   P++    LR R +  +S+   +FC+  M  T 
Sbjct: 314 CLVIVALVYDFVIFPNLQIVKANYIQYQPLISWKNLRIRGIFTASMTTFFFCIGYMSQTV 373

Query: 368 FYLPVY 373
           +Y+  +
Sbjct: 374 YYVQFF 379

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 83/152 (54%), Gaps = 3/152 (1%)

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161
           D  IVST++  +  +F S  +  W+ T Y L ++    ++G+++  +G K  ++F+  +F
Sbjct: 83  DIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIF 142

Query: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221
            IG LI  L+NS+  ++ GR I+G+GGCG+ SL+ +I S LV    R +   + +  F +
Sbjct: 143 EIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAI 202

Query: 222 GTASGGLVGAYFRD---WRLAFILQCPISVLS 250
            +  G  +G  F     WR  F +  PI  L+
Sbjct: 203 ASVVGPFLGGVFTSSVTWRWCFYVNLPIGGLA 234

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 114/530 (21%), Positives = 228/530 (43%), Gaps = 58/530 (10%)

Query: 31  NQIEQQDHLLDIEQG-RAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIM 89
            +++Q++ L +   G  +  +  +  ++++N   DA         +    +   R+ + +
Sbjct: 3   QKLQQEESLNNSMDGPMSKNAIMQVEVTADNASIDANTPDHNDNSNVRL-MSGLRLYVCV 61

Query: 90  FSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLG 149
            ++ L  F+ ALD  IV+T++  + +      K+ W+   Y L +S    ++G+ +  LG
Sbjct: 62  AALVLATFIFALDVFIVNTIIDSVSASLGGYSKSGWLIAGYSLPNSLFSLIWGRTASLLG 121

Query: 150 RKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRA 209
            +  +  S  +F +G ++   + S+  ++ GR I+G+GG GL +L+ +I S +V  ++RA
Sbjct: 122 FQASMTLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQTLSLVIGSSIVEEKNRA 181

Query: 210 VYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPRASA 266
           +   +    F   +  G  VG  F     WR  F +  PI  ++ +L   +   P R SA
Sbjct: 182 MIVSIVMSAFAAASLIGPFVGGAFTTHVIWRWCFWINLPIGAVTALLF-YFTYNPKRLSA 240

Query: 267 SNK--DCWSA---------------------RLRRLDWAGATSLIAFLFLFMLTSSMGGS 303
           +++   C+ +                      L R D  G  +  A + L +L  ++GG 
Sbjct: 241 ASRFTSCFKSVKALSFEKLASWETYRCMGKNLLFRFDIVGFATGCAGVCLLLLGLTLGGE 300

Query: 304 SVAYGSRLFAAMCAATLVFGAVFV----YVELRVAADP-------VLPVTFLRDRSVLGS 352
             ++ S +         +   + V    Y+  ++  +P       +L    L +R +L  
Sbjct: 301 DDSWKSAIVICFLIVGFLLSVLSVVYDFYIFDKINPEPSNLSFRPMLVKGLLNNRFILLP 360

Query: 353 SLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGK 412
           +L      ++      Y   ++  V+G  A + G   +P   +    ++  G  MK+TG+
Sbjct: 361 NLVTCASAIAFSGYMLYSVQFFQLVMGSSAWNAGLHLIPLVIASIVSAIICGGIMKKTGQ 420

Query: 413 YYYFLLA-FCVLAIAGQVQIVLITP-----QMPVWRQYLLQVVPGFGVSVLITVTLLAMI 466
               +++   +L I G V  +L        Q+ VW      ++PGFG+   +   L++  
Sbjct: 421 VKPLMISTVSILLIGGGVSTLLDNHSGNSMQIGVW------ILPGFGLGAALQCALISSQ 474

Query: 467 AAVPHEHHAATTSISY--AFRSTGATLGVSVGA----AVFRSSLTSLLDA 510
             +  E   +   +    AF S   +LG S+G     A+F SSL S ++A
Sbjct: 475 LQIDKESPNSEIELVEVTAFNSFTKSLGSSIGGVLCTAIFTSSLWSKINA 524

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 85.5 bits (210), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 81/156 (51%), Gaps = 3/156 (1%)

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161
           D  IV TL   IG +F+      W+ T Y LS++    L+G+L++ LG K  L+ S  VF
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVF 83

Query: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221
            IG LI  LSNS+  +++GR ++G GG G+ SLA ++ + +V    R +        + +
Sbjct: 84  EIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVI 143

Query: 222 GTASGGLVGAYFRD---WRLAFILQCPISVLSGILI 254
               G  +G  F +   WR  F +  PI   + I++
Sbjct: 144 AEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFIIL 179

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 147/585 (25%), Positives = 235/585 (40%), Gaps = 102/585 (17%)

Query: 51  TTKSSISSENEREDAGGATVAGCGSAE-----FYLPSSRILIIMFSMFLGIFLAALDGTI 105
           T +SS S E+E  +      +  G +E     F  P  R L+I  + FL  F  +LD T+
Sbjct: 16  TNESSRSFEDEDANPANVEFSKLGESEIIAVQFDTPKYRALMIA-TAFLCGFGYSLDHTL 74

Query: 106 VSTLLTHIGSEFNSLDKASWIATSYLLS---SSTCQPLYGKLSDRLGRKPLLVFSNAVFA 162
            ST   + G   NS  + S ++T  +++   S   Q ++ +LSD  GR  L V +  ++ 
Sbjct: 75  RST---YTGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSRLSDYFGRVELFVAATILYV 131

Query: 163 IGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVF-GL 221
           IG ++   + S+    AG      G  G+T +  +I+SD   L+ R +YQ +  + F  +
Sbjct: 132 IGTIVQSQAYSVSIYAAGAVFYNSGNVGVTLVLLLILSDFSSLKWRILYQYVPYWPFIII 191

Query: 222 GTASGGLVGAYF--RDWR-----LAFILQCPISVLSGILIVVYLELPPRASASNKDCWSA 274
              SG +V A    +DW       AFI   P+S L  I ++VY+       +S    W A
Sbjct: 192 PWISGNIVTAANPEKDWSWDIAMWAFIF--PLSALPMICLLVYM----MYKSSKTPEWKA 245

Query: 275 RLRRLDWAGATSLI---AFLF-------LFMLTSSMGGSSV------AYGSRLFAAMCAA 318
              R         +    FLF       + ++T S+G   V          +  ++    
Sbjct: 246 LKERTHIKKNQGFLKNTVFLFWELDSIGIILITVSLGCVLVPLTLANGVSQKWHSSKIIG 305

Query: 319 TLVFGAV----FVYVELRVAADPVLPVTFLRDRSV---LGSSLANWFCMMSMMTTNFYLP 371
           TLVFG V    FV+ E   A +P+LP   L DR +   LG +  N+F     +  +F  P
Sbjct: 306 TLVFGGVLFCIFVFWETAYAKNPLLPFKLLGDRGIWAPLGVAFFNYFTF--FIACDFLYP 363

Query: 372 VYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQI 431
           V   S+     T      +P F          G+ + +  +     L F V+       I
Sbjct: 364 VLLVSMNESSTTATRILNLPDFVGATLSPF-YGILVAKARR-----LKFSVVGGCAAWMI 417

Query: 432 VLITPQMPVWRQY--------------LLQVVPGFGVSVLITVTLLAMIAAVPHEHHAAT 477
                 M ++ QY              ++  + G   S  + V+L AM     H   A  
Sbjct: 418 -----SMGLFYQYRGGSESHGGAIAASVIMGMSGLLCSNSVIVSLQAMTT---HGRMAVI 469

Query: 478 TSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSD 537
           TSI + F   GA +G SV  AV+   + + L      F++D          +A AA  S 
Sbjct: 470 TSIYFTFSKVGAAVGASVSGAVWTQIMPNQLRKA---FSND---------TLADAAYESP 517

Query: 538 WVHRSAPPF---VRATLLECYHFASRATFKFCLTTMVLAGVSCSI 579
           +      P+    R  ++E Y +  R         M+  G+ C+I
Sbjct: 518 YTFIYEYPWGSPERIAVVEAYRYVQR--------IMMTIGLVCTI 554

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 90/173 (52%), Gaps = 4/173 (2%)

Query: 89  MFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRL 148
           M S+ L +FLAALD  I+S  +  I  +FN   K+ WI + Y L  +    L+G+ +   
Sbjct: 44  MGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTLLWGRFATIF 103

Query: 149 GRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDR 208
           G K  L+ S  +F  G LI  +SNS+  ++ GR ++GIGG G+ SL  +I S L   R R
Sbjct: 104 GFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERSR 163

Query: 209 AVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLS-GILIVVY 257
            V   + +  + +   +G  +G  F     WR  F +  PI  L+  +L++ Y
Sbjct: 164 GVAISVLSCAYAVAAVAGPFMGGAFTTHVTWRWCFYINLPIGSLAFAVLVLTY 216

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 111/471 (23%), Positives = 192/471 (40%), Gaps = 54/471 (11%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKL 144
           +++ + S+ + +FL ALD  I  TL   IG EFN      W+   Y L ++    L+G++
Sbjct: 6   VIVCVTSLCVTLFLGALDIVICITLYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRI 65

Query: 145 SDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVP 204
           +  +G K  L+ S  +F  G L+ G +NS+  ++  R ISG GG G+ SL   + + +V 
Sbjct: 66  ASLVGLKCSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTSIVE 125

Query: 205 LRDRAVYQGLCNFVFGLGTASGGLVG---AYFRDWRLAFILQCPISVLSGILIVVYLELP 261
            + RA    +    + L   +G  VG   A    WR  F +  PI  ++  L  +     
Sbjct: 126 EKHRARVITVLGIAYMLAEGAGPFVGGGLAEHVSWRWCFYVNLPIGGVA--LAALGWGYN 183

Query: 262 PRASASNKDC-----------WSARLRRLDWAGATSLIAFLF-------------LFMLT 297
           P   A  +             +   L+   W  A +L+ F               L ML 
Sbjct: 184 PAGRAPGRALARFWVRARAFPYGTLLQAQFWRRAAALMVFRLDIPGLALSSGGFALVMLA 243

Query: 298 SSMGGSSVAYGSRLFAAMC---AATLVFGAVFVYVEL-RVAAD-------PVLPVTFLRD 346
            + GG+  A+ S     M    AA L    ++ +V L RV A        P++P     +
Sbjct: 244 LTFGGNQYAWRSATIVCMFVFGAALLALFMLYDFVVLPRVGARIAGYEPLPLVPWRLAAN 303

Query: 347 RSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLG----MKATDVGKRAMPSFFSVAFGSLG 402
             VL SSL  +F   +    + YL  Y+  V+     + +  + + ++P+  SV    + 
Sbjct: 304 VPVLTSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPTLASVHLWQMSLPALVSV----IA 359

Query: 403 AGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTL 462
           + +  +R G     +LA  V+   G   + L+     + +     V+ G     +  ++L
Sbjct: 360 SAVVNERFGVVKPLVLAGVVMGFVGSGLLTLVRSDTTLGQSIGFSVLAGASFGCVYQLSL 419

Query: 463 LAMIAAVP------HEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSL 507
           ++    V       H      TS +   ++ G +    V   VF  SL +L
Sbjct: 420 ISAQLQVERDDPDFHARFIEVTSYNTFIKTLGFSFAGIVSTTVFTVSLKNL 470

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/319 (25%), Positives = 131/319 (41%), Gaps = 38/319 (11%)

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161
           D  IV TL   IG +F+      W+ T Y L+++    L+G+L++ LG    L+ S  +F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIF 83

Query: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221
            +G LI  LSNS+  +++GR I+G GG G+ SLA ++ + +V    R          + +
Sbjct: 84  EVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVI 143

Query: 222 GTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYL----ELPPRASASNK----- 269
               G  +G  F +   WR  F +  PI   + ++I+ +     E  P+ S  +K     
Sbjct: 144 AEGVGPFIGGAFNEHLSWRWCFYINLPIGAFA-LIILAFCNTSGESLPKVSLLSKIKSIM 202

Query: 270 ----------DCWSARLR----RLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSR----- 310
                       W    +    +LD  G T   A   L ML  S GG++ A+ S      
Sbjct: 203 SYKYDEVFKASFWKKAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTIISL 262

Query: 311 ------LFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMM 364
                 L    CA    F  +           P+L  +   +  +  SS+  +F   +  
Sbjct: 263 FTVGPILLILFCAYDFHFLPLLGLRYENKRTKPLLTWSIASNSGIFTSSVTGFFSCFAYE 322

Query: 365 TTNFYLPVYWSSVLGMKAT 383
             + YL   +  VL  K T
Sbjct: 323 LQSAYLVQLYQLVLKRKPT 341

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 82.4 bits (202), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 90/173 (52%), Gaps = 4/173 (2%)

Query: 89  MFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRL 148
           M S+ L +FLAALD  I+S  +  I  +FN   K+ WI + Y L  +    L+G+ +   
Sbjct: 44  MGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTLLWGRFATIF 103

Query: 149 GRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDR 208
           G K  L+ S  +F  G LI  +SNS+  ++ GR ++GIGG G+ SL  +I S L   R R
Sbjct: 104 GFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERSR 163

Query: 209 AVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLS-GILIVVY 257
            V   + +  + +   +   +G+ F     WR  F +  PI  L+  +L++ Y
Sbjct: 164 GVAISVLSCAYAVAAVASPFMGSAFTTHVTWRWCFYINLPIGGLAFAVLVLTY 216

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 89/408 (21%), Positives = 161/408 (39%), Gaps = 36/408 (8%)

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161
           D  IV T++  + ++FN      W+ T Y L ++    L+G+     G K  ++ S  +F
Sbjct: 91  DILIVGTIMETVAAKFNGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIF 150

Query: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221
            +G LI   + S+  ++ GR ISGIGG G+ +L  +I S LV  R R     + +  F +
Sbjct: 151 EVGSLIAAAATSMTMLIGGRVISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAV 210

Query: 222 GTASGGLVGAYFR---DWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRR 278
            + +G  +G  F     WR  F +  PI  L+    +         +  N      R++R
Sbjct: 211 ASVAGPFLGGAFATHVTWRWCFYINLPIGGLAFFFFLFSYNPNGENTFENFKILLGRIKR 270

Query: 279 LDWAGATSL---------IAFLF-------------LFMLTSSMGGSSVAYGS-RLFAAM 315
           + ++   ++         + F F             L +L  + GG+   + S  + A  
Sbjct: 271 ISYSQLLTVSFYRRLFRTLVFKFDFFEFALSSAGFTLVLLALTFGGNRYDWNSGTIIAYF 330

Query: 316 CAATLVFGAVFVY-------VELRVAADPVLPV---TFLRDRSVLGSSLANWFCMMSMMT 365
               L+  A FVY       V+ +    P LP+     +    VL  ++AN+        
Sbjct: 331 VVGILLIIASFVYDFVVFDRVKPQTDRIPYLPLLSWNVISKPGVLIPNIANFCTCFCYNM 390

Query: 366 TNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAI 425
              Y+  Y+  V G  A       +    S     L  G+  ++TG     L+   ++  
Sbjct: 391 QVVYIVQYFQLVWGDSAWKASIHLIAPVISTVITVLFCGIITRKTGHVKILLVVGGIVIP 450

Query: 426 AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEH 473
                + L+ P+     +  L ++PG     ++  +LL+    +   H
Sbjct: 451 VASGILTLLGPKSSSSAKIGLLILPGISFGSVMNGSLLSSQLQIQKNH 498

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 77/154 (50%), Gaps = 3/154 (1%)

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161
           D  IV TL   IG +F+      W+ T Y LS++    L+G+L++ LG    L+ S  +F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIF 83

Query: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221
            IG LI  LSN++  ++ GR I+G GG G+ SLA ++ + +V    R +        + +
Sbjct: 84  EIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVI 143

Query: 222 GTASGGLVGAYFRD---WRLAFILQCPISVLSGI 252
               G  +G  F +   WR  F +  PI   + I
Sbjct: 144 AEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFI 177

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 81/164 (49%), Gaps = 5/164 (3%)

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161
           D  IV T+L  I  +FN+  K  W+ T Y LS++    L+G+ +   G K  L+ S  +F
Sbjct: 36  DIIIVVTILNTIADKFNAYSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIF 95

Query: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221
            IG L+  +SNS+  ++ GR I+G G  G+ +L   I + LV    R     L +  + +
Sbjct: 96  EIGSLVIAVSNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAV 155

Query: 222 GTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPP 262
            +A G  +G    +   WR  F +  PI  L+  L V YL   P
Sbjct: 156 ASALGPYIGGALTEYVTWRWCFYINLPIGGLA--LGVFYLSYNP 197

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 123/495 (24%), Positives = 212/495 (42%), Gaps = 54/495 (10%)

Query: 54  SSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHI 113
           SSI+S N  +      V         + +  I I+  S+FL  ++AALD T       + 
Sbjct: 46  SSITSCNGEKIVKTRGVTRIEVVREKMSTKVIWILGLSIFLTSWVAALDATTTYNYQPYA 105

Query: 114 GSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAV-FAIGCLICGLSN 172
            S FN     S +  +  +  + C+P   K+SD L  +P+  F   + + IG +I   S 
Sbjct: 106 TSSFNRHSMLSTLTIANSVIGAVCKPFIAKISD-LSSRPVTYFVVLLLYVIGFVITACSP 164

Query: 173 SIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGA 231
           +I A V G     +G  G++ +  +I++D   L+ R+ +  L +  + + T  SG +V  
Sbjct: 165 NISAYVIGSVFIAVGQSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVED 224

Query: 232 YFR-DWRLA---FILQCPISVLSGILIVVYLELPPRAS----------ASNK-DCWSARL 276
               +WR     F +  P+++   IL++ YLE     +          A  K +   AR+
Sbjct: 225 IINSNWRWGYGMFAIITPVALTPAILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARI 284

Query: 277 R--RLDW-----------AGATSLIAFLF-LFMLTSSMGGSSVAYGSRLFAAMCAATLVF 322
           R  ++ W           A    L+ F F L +L  S+   S A G     +M A  +V 
Sbjct: 285 RGFKVYWELLKVSLIEIDAFGLILLGFAFSLILLPCSL--YSYAEGGWNNPSMIAMEVVG 342

Query: 323 GAV---FVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLG 379
           G +   +V  E+  A  P+LP   L +R+ +   + ++   M+   +  +   Y   VL 
Sbjct: 343 GILLISYVVFEVFFAPFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLN 402

Query: 380 MKATDVGKRAMPS-----FFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLI 434
           +   D    +  +     FF V +G+L  G +     +Y  F +    + + G    V  
Sbjct: 403 LSYRDWVYLSNTTTMGLCFFGVVWGALFRGFH-----RYKIFQVVGIAIKLIGMGLYVAC 457

Query: 435 T-----PQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGA 489
           +     P + +    L  VV  FG +  +  T +A  AAVPH+  AAT S+   + S GA
Sbjct: 458 SKKDGSPGIGLVVAAL--VVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGA 515

Query: 490 TLGVSVGAAVFRSSL 504
            +G ++ +AV+   L
Sbjct: 516 AVGTAITSAVWTDQL 530

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 105/501 (20%), Positives = 209/501 (41%), Gaps = 60/501 (11%)

Query: 46  RAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTI 105
           +AY S T+ +++S +ER   GG ++  C               + S+ L +F+ ALD  I
Sbjct: 13  KAYDSDTELNVNSSDER---GGISLYLC---------------LTSLTLVLFITALDILI 54

Query: 106 VSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGC 165
           V T++  +  +F +  K  W+ T Y L ++    ++G+ +  +G +  L+ +  +F  G 
Sbjct: 55  VGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGS 114

Query: 166 LICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTAS 225
           L+  L+NS+  ++ GR ++G+GG GL +L  +I   +V  R R +   + +  F +    
Sbjct: 115 LVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRPLVISILSCAFAVAAIV 174

Query: 226 GGLVGAYFR---DWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSAR-----LR 277
           G ++G  F     WR  F +  PI   + I+ ++  +               R     LR
Sbjct: 175 GPIIGGAFTTHVTWRWCFYINLPIGGFAVIMFLLTYKTKSENILQQTRNILGRISKFELR 234

Query: 278 RLDWAGA--TSLIAFLF---------------LFMLTSSMGGSSVAYGS-RLFAAMCAAT 319
           RL   G    +LI  LF               LF+L  + GG+  ++ S ++   +    
Sbjct: 235 RLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYSWNSGQIITYLVLGI 294

Query: 320 LVF-----GAVFVYVELRVAAD-----PVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFY 369
           L+F        F++ +     D     P+     +   +V+  ++  +   +       Y
Sbjct: 295 LLFVFSLIYDFFIFQKFNPEPDNTSYRPLFLKRLVAKPAVIIVNMVTFLLCIGYNGQMIY 354

Query: 370 LPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQV 429
              ++  +    A   G   +P   +    ++ +G+  K+ G     L+   +L + G  
Sbjct: 355 SVQFFQLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGILGVIGAG 414

Query: 430 QIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAAT------TSISYA 483
            + L++       Q  + ++PG  +   +  +L++    +  +   AT      T+ +  
Sbjct: 415 LMTLMSNNSTSSTQIGVLILPGLSLGFALQASLMSAQLQIKKDRPEATTDFIEITAFNTF 474

Query: 484 FRSTGATLGVSVGAAVFRSSL 504
            +S G TLG  +   VF +SL
Sbjct: 475 MKSLGTTLGGVLSTTVFSASL 495

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 120/551 (21%), Positives = 219/551 (39%), Gaps = 84/551 (15%)

Query: 14  DRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGC 73
           D+D   +  +  P  V N+  + D +          ST +S +  +   +     T+ G 
Sbjct: 23  DKDYEDEKGSGSP--VINEFSKVDQI----------STAQSEMDEKMAEQTEQQRTMTGV 70

Query: 74  GS---------AEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKAS 124
            +         AE Y       I++F+ F+  +   LDG   +T   + G   +S  + S
Sbjct: 71  KNIIIRKTEIMAEVYDKWYYHAILLFTAFVCGYGYGLDG---NTRYIYTGYATSSYAQHS 127

Query: 125 WIATSYLLS---SSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGR 181
            ++T  +++   S+  Q +Y +LSD  GR  L   S  ++++G +I   +  +    AG 
Sbjct: 128 LLSTINVINAVISAASQIVYARLSDVYGRFALFCVSIVLYSVGTIIQSQAYDVQRYAAGS 187

Query: 182 FISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAY---FRDWR- 237
                G  G+  +  +I+SD   LR R VYQ +  + F + T   G V +     ++W  
Sbjct: 188 IFYNTGYVGVILVLLLILSDFSSLRWRLVYQFVPTWPFIINTWISGNVTSRANPLKNWSW 247

Query: 238 ----LAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLF- 292
                AFI   P+S +  + +++++    R +   ++  S         G    I  LF 
Sbjct: 248 DIGMWAFIF--PLSCVPLLCVMIHMWWLARKTEEWQEL-SKEKTFYQKHGLKDTIVELFW 304

Query: 293 ------LFMLTSSM----------GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAAD 336
                 +F++T S+          GG+   + +           V   + V  E + A D
Sbjct: 305 KIDAMGVFIMTISLGCILVPLTLAGGTKSKWNNSHVIGPFVLGFVLIPILVLWEYKFARD 364

Query: 337 PVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPV-YWSSVLGMKATDVGKRAMP---- 391
           P++P   ++DR V  S     F +  ++   +Y+   Y  +VL +   +  K A      
Sbjct: 365 PIIPYKLVKDRGVWAS-----FAISFLIDFIYYMAADYLYTVLIVGVNESVKSATRISSL 419

Query: 392 SFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAI----------AGQVQIVLITPQMPVW 441
           S F    GS    L + R  +   F++  C L +           G      I   + VW
Sbjct: 420 STFVSTVGSPIFSLLITRFSRLKPFIICGCGLWMLAMGLLYHYRGGAESHSGIIGALCVW 479

Query: 442 RQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFR 501
                    G G ++      +++ AA  HEH A  T+++Y F   G+ +G +V  A++ 
Sbjct: 480 ---------GVGTTLFTYPVNVSVQAATSHEHMATVTALNYTFYRIGSAVGAAVSGAIWT 530

Query: 502 SSLTSLLDAKV 512
            +L   L  +V
Sbjct: 531 QTLYKQLLKRV 541

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 120/284 (42%), Gaps = 22/284 (7%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           ++ ++FL  +   L G I  ++ T+  + F    +   I T   + +S     Y ++SDR
Sbjct: 66  LLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARISDR 125

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GR    +F+  ++ IG +I   + +   + AG  I   G  G   LAT +  DL  LRD
Sbjct: 126 FGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSGLRD 185

Query: 208 RAVYQGLCNFVFGLGT-ASGGLVGAYFRD-----WRLAFILQC---PISVLSGILIVVYL 258
           R     +      + T  SG +V +   +     WR  + + C   PIS L  +L  VY 
Sbjct: 186 RTFAMNIFLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPYVYA 245

Query: 259 E--------LPPRASASNKDCWSARLRR----LDWAGATSLIAFLFLFMLTSSM-GGSSV 305
           +        LPP             L +    ++  G     AFL L +L  ++ GG++ 
Sbjct: 246 QYISWRSGKLPPLKLKEKGQTLRQTLWKFADDINLIGVILFTAFLVLVLLPLTIAGGATS 305

Query: 306 AYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSV 349
            +      AM       G +F+  EL+ A +P +P  +L D ++
Sbjct: 306 KWREGHIIAMIVVGGCLGFIFLIWELKFAKNPFIPRVYLGDPTI 349

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 85/361 (23%), Positives = 144/361 (39%), Gaps = 40/361 (11%)

Query: 12  PVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVA 71
           P   D + D ST   G+ + + E +D        ++ GS  +   +      D G  T  
Sbjct: 1   PSKNDNLDDKST--AGY-SEKAETEDD-------KSTGSGIRRIDAVNRVLSDYGSFTAF 50

Query: 72  GCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYL 131
           G         S+   +++ ++FL  +   L G I  ++ T+  + F    +   I T   
Sbjct: 51  GVTF------STLKTVLLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKS 104

Query: 132 LSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGL 191
           + SS     Y ++SDR GR    +F+  ++ +G +I   + +   + AG  I   G  G 
Sbjct: 105 IVSSVVAVPYARMSDRFGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGF 164

Query: 192 TSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYF-----RDWRLAFILQC- 244
             LAT +  DL  LRDR     +      + T  SG +V +         WR  + + C 
Sbjct: 165 RLLATALTGDLSGLRDRTFAMNIFLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGIFCI 224

Query: 245 --PISVLSGILIVVYLE--------LPP-----RASASNKDCWSARLRRLDWAGATSLIA 289
             P S L  +L   Y +        LPP     +     +  W      ++  G     A
Sbjct: 225 IVPFSTLILVLPYAYAQYISWRNGTLPPFKLKEKGQNLRQTIWKFA-EDINLIGIILFTA 283

Query: 290 FLFLFMLTSSM-GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRS 348
           FL L +L  ++ GG++  +      AM       G +F+  ELR A +P +P  +L D +
Sbjct: 284 FLVLVLLPLTIAGGATSKWREGYIIAMIVVGGFLGFIFLIWELRFAKNPFIPRVYLGDPT 343

Query: 349 V 349
           +
Sbjct: 344 I 344

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 102/453 (22%), Positives = 179/453 (39%), Gaps = 35/453 (7%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           I FS+FL  F+  LD  +  ++  +  + +      S +     ++++   PLY +LSD 
Sbjct: 77  IFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVNVVRSVAAACGLPLYSRLSDV 136

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GR  L+V S  ++  G +IC  +  +    AG  +   G CGL  L  +I +D   L  
Sbjct: 137 FGRIELIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFGLCGLAILFKVIAADFSNLNW 196

Query: 208 RAVYQGLCNFVFGLGT-ASGGLVGAYFRDWRLAFI----LQCPISVLSGILIVVYLELPP 262
           R     +    F + T  SG +V A   +W    I    +  P++ +  +L  ++++   
Sbjct: 197 RVFCTLISAAPFIINTWVSGDIVEAIGDNWSWPGIGVWAICLPVATIPLVLCFIHMQYLA 256

Query: 263 RASAS----------------NKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVA 306
           + S                   K        +LD  G  SL+  L L +   ++ G   A
Sbjct: 257 KKSGDLNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLSLMIILGLILTPLTLAGGETA 316

Query: 307 YGSRLFAAMCAATLVFG----AVFVYVELRVAADPVLPVTFLRDRSV---LGSSLANWFC 359
                  A     L+ G     VF + E R+A  P+ P    RDR V   LG  +   FC
Sbjct: 317 ---EWRTAKVIVPLILGFCWIPVFAFWENRIATHPIAPTDMFRDRGVYCALGIGILIDFC 373

Query: 360 MMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLL- 418
               M  ++   +   ++     +     ++ SF ++  G L  GL + +  K   F++ 
Sbjct: 374 W--YMQGDYLYTILVVAIHESVKSATRINSLYSFSTIITG-LCVGLAISKVRKMKCFIVF 430

Query: 419 AFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATT 478
             C+  +A  + I               QV+ GFG +        ++ A V HE  A  T
Sbjct: 431 GVCMWLVAFGIMIKYRGGSQSHGGMIASQVLLGFGGAFFTHPVQASLQAYVNHERMATIT 490

Query: 479 SISYAFRSTGATLGVSVGAAVFRSSLTSLLDAK 511
           ++       G+ +G SV  A++   L + +  +
Sbjct: 491 TLYAISYYIGSAVGSSVSGAIWTQVLPNEIGKR 523

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 118/477 (24%), Positives = 204/477 (42%), Gaps = 57/477 (11%)

Query: 82  SSRILIIM-FSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPL 140
           S+R+  I+  S+FL   +AALD T       +  S FN     S +  +  +  + C+P 
Sbjct: 73  STRVRWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKPF 132

Query: 141 YGKLSDRLGRKPLLVFSNAV-FAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIM 199
             K+SD L  +P+  F   + + IG +I   S +I A V G     IG  G++ +  +I+
Sbjct: 133 IAKISD-LSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIGQSGISLMNMVII 191

Query: 200 SDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFR-DWRLA---FILQCPISVLSGILI 254
           +D   L+ R+ +  L +  + + T  SG +V      +WR     F +  P+++   IL+
Sbjct: 192 ADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPVALTPAILV 251

Query: 255 VVYLE--------LPPRASASNK--------------DCWS---ARLRRLDWAGATSLIA 289
           + YLE        +P  +   +K              + W      L  +D  G   L+ 
Sbjct: 252 MAYLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWELVKVSLIEIDAFGLI-LLG 310

Query: 290 FLF-LFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAV---FVYVELRVAADPVLPVTFLR 345
           F F L +L  S+   S A G     +M A  +V G     +V  E+  A  P+LP   L 
Sbjct: 311 FAFSLILLPCSL--YSYAEGGWNNPSMIAMEVVGGIFLISYVVFEVFFAPFPLLPKRVLM 368

Query: 346 DRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPS-----FFSVAFGS 400
           +R+ +   + ++   M+   +  +   Y   VL +   +    +  +     FF V +G+
Sbjct: 369 NRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMGLCFFGVVWGA 428

Query: 401 LGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLIT-----PQMPVWRQYLLQVVPGFGVS 455
           L  G +     +Y  F +    + + G    V  +     P + +    L  VV  FG +
Sbjct: 429 LFRGFH-----RYKIFQVVGIAIKLIGMGLYVTCSKKEGSPGIGLVVAAL--VVTNFGDA 481

Query: 456 VLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKV 512
             +  T +A  AAVPH+  AAT S+   + S GA +G ++ +A++   L   L   V
Sbjct: 482 ANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAIWTDRLPGALSKYV 538

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 120/524 (22%), Positives = 200/524 (38%), Gaps = 88/524 (16%)

Query: 118 NSLDKASWIATSYLLSSST---CQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSI 174
           NS +K S ++T  +++S      Q  + +LSD  GR  + V    ++ +G +I   ++ +
Sbjct: 93  NSYEKHSLLSTIQVINSVVGVGAQISFARLSDVFGRLQMFVVGTILYVVGTIIQSQAHDV 152

Query: 175 WAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNF-VFGLGTASGGLVGAY- 232
                G      G  G++ L  +++SD+ PLR R  YQ   +F    +   SG +V A  
Sbjct: 153 KVYAVGAIFYNTGFVGVSLLLILVLSDMSPLRWRLFYQFTASFPCIIISWISGDIVEAAN 212

Query: 233 -FRDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSAR---------------- 275
             ++W     +   I  LS +  + YL      S+  K     R                
Sbjct: 213 PMKNWSWDIGMWAFIFPLSSLPFITYLFYATHISSKTKKWKDLRNKVETHKRNIILVVKD 272

Query: 276 -LRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGA----VFVYVE 330
              ++D  G   + A L L ++  ++ G       R       ATLV G     VF++ E
Sbjct: 273 IFNQIDIVGTVLVTAALGLILVPLTLAG---GVSERWHEPGIIATLVIGIALLLVFLFWE 329

Query: 331 LRVAADPVLPVTFLRDRSVLGSSLANWF-CMMSMMTTNFYLPVYWSSVLGMKATDVGKRA 389
            + A +  LP   L+DR V  S +A +   M+  M +++  PV   SV     +      
Sbjct: 330 AKFAKNAALPFNLLKDRGVWASIVAAFLEKMIYAMISDYLYPVLLVSVNETNKSATRIVW 389

Query: 390 MPSFF----SVAFGSL-------------GAGLYMKRTGKYYYFLLAFCVLAIAGQVQIV 432
           +P+F     SV FG L             G  L++   G +Y F          G+    
Sbjct: 390 LPTFMACLCSVFFGLLVVSVQRLKVFTICGTFLWIISIGLFYQFR--------GGESSHS 441

Query: 433 LITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLG 492
            I             +V GFG ++     ++ + A   H++ A+ T + + F   GA  G
Sbjct: 442 GIIGA---------SIVLGFGSAIFTQSIIVTLQAMASHDNMASITGLYFMFAQVGAATG 492

Query: 493 VSVGAAVFRSSLTSLL-------DAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPP 545
            S+  A++  ++   L       D  +  FAS           IAS A    W  +    
Sbjct: 493 ASISGAIWTQTMYKQLLKQLKDSDLTMAVFASPYE-------FIASYA----WGTKE--- 538

Query: 546 FVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSI 589
             R  +++ Y    + T    L   V   VS    K+ KL  S+
Sbjct: 539 --RDLVIQAYRHVQKVTMLVSLILTVPLLVSVLFTKDRKLSDSV 580

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 125/522 (23%), Positives = 213/522 (40%), Gaps = 80/522 (15%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           +I++FS F+  +   LDG I      +  S +      S I     ++S+  Q +Y + S
Sbjct: 113 VILLFSAFVCGYGYGLDGNIRYIYTGYATSSYAEHSLLSTINVINAVASAASQIVYARAS 172

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
           D  GR  L + S   +A+G +I   +  +    AG F   IG  G+  +  +I+SD   L
Sbjct: 173 DVFGRLSLFIVSVVFYAVGTIIQCQAYDVQRYCAGSFFYNIGYVGVILVLLLILSDFSSL 232

Query: 206 RDRAVYQGLCNFVFGLGT-ASGGLVGAY--FRDWR-----LAFILQCPISVLSGILIVVY 257
           + R  YQ    + + + T  SG +  A    + W       AFI   P+S +  IL +++
Sbjct: 233 KWRLFYQFAPTWPYIINTWISGNITSAANPLKHWSWDIGMWAFIF--PLSSIPIILCLIH 290

Query: 258 LELPPRASASNKDCW-------------------SARLRRLDWAGATSLIAFLFLFMLTS 298
           +    R  AS    W                   +    RLD  G   + A L   ++  
Sbjct: 291 M----RWMASKTKEWKLLKQEKSYIQQHTFVSAITDLFWRLDVIGVLLMGASLGCILVPL 346

Query: 299 SM-GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANW 357
           ++ GG+S  +      A  A   V   +F + E + +  P++P   ++DR+V  SS+A  
Sbjct: 347 TLAGGTSSKWNHGNIIAPFALGFVLIPIFTFWEWKFSKSPLIPSKLVKDRAVW-SSMAIS 405

Query: 358 FCMMSMMTTNFYLPV-YWSSVLGMKATDVGKRA-----MPSFFSVAFGSLGAGLYMKRTG 411
           F +  +    FY+ V Y  +VL +   +  K A     + SF S   GS    L + R  
Sbjct: 406 FLIDFI----FYMAVDYLYTVLIVGVNESVKSATRISSLSSFVSTV-GSPIFALLITRFT 460

Query: 412 KYYYFLLAFCVLAI----------AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVT 461
           +   F++A C L +           G      I   + VW         G G ++     
Sbjct: 461 RLKPFIVAGCALWMLSMGLLYHYRGGASSHNGIIASLCVW---------GVGTTLFTYPI 511

Query: 462 LLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHS 521
            +++ AAV H   A  T+++Y     G+ +G +V  A++  +L   L             
Sbjct: 512 NVSVQAAVSHADMATVTALNYTMYRIGSAVGAAVSGAIWTQTLYKQL------------H 559

Query: 522 ERELRGIIASAARSSDW---VHRSAPPFVRATLLECYHFASR 560
           +R     +A+AA SS +   V+ +    VR  ++E Y +  R
Sbjct: 560 KRMGDATLATAAYSSPYSFIVNYTWGTTVRDQMVEAYRYVQR 601

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/343 (24%), Positives = 147/343 (42%), Gaps = 25/343 (7%)

Query: 32  QIEQQDHLL-DIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILII-- 88
           ++ ++DH+  D ++  +   T +  +S+   R DA  AT++  GS   +    + L I  
Sbjct: 5   ELLKKDHVEEDDDKSSSLSQTNEPPLSNGVRRMDAVNATLSRAGSFTAFGVRFQTLKIAL 64

Query: 89  MFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRL 148
           + ++FL  +   L G I  ++ T+  + F    +   I T   + ++     Y +LSDR 
Sbjct: 65  LIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYARLSDRF 124

Query: 149 GRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDR 208
           GR    +F+  ++ +G +I   + +   + AG  I   G  G   LAT + +D+  LRDR
Sbjct: 125 GRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADISGLRDR 184

Query: 209 AVYQGLCNFVFGLGT-ASGGLVGAYF-----RDWRLAFILQCPISVLSGILIVV------ 256
                +      + T  SG +V +        +WR  + + C I   S +L+++      
Sbjct: 185 TFAMNIFLIPVIINTWVSGNIVDSLAGVKVPYEWRWGYGIFCIIVPFSTLLLILPYAYAQ 244

Query: 257 YL-----ELPPRASASNKDCWSARLRRL----DWAGATSLIAFLFLFMLTSSM-GGSSVA 306
           YL      LP          W   L +L    +  G     AFL L +L  ++ GG+S  
Sbjct: 245 YLAWREGRLPQFEFRKQGQSWKQALWKLTEDVNLIGIVLFTAFLVLVLLPLTLAGGASTK 304

Query: 307 YGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSV 349
           +      AM       G +F   EL +A  P +P  +L D ++
Sbjct: 305 WKEGHIIAMIVVGGCCGILFFVWELWLAKKPFIPRVYLGDATI 347

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/347 (24%), Positives = 144/347 (41%), Gaps = 26/347 (7%)

Query: 49  GSTTKSSISSENEREDAGGATVAGCGSAEFY--LPSSRILIIMFSMFLGIFLAALDGTIV 106
           G+    S  S   R DA    V+  GS   +    +S  + ++ ++FL  +   L G I 
Sbjct: 24  GTDINRSTKSGLHRIDAVNKVVSDYGSFTAFGITFNSLKITLLVALFLQGYCTGLGGQIS 83

Query: 107 STLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCL 166
            ++ T+  + F    +   I T   + +S     Y ++SDR GR    +F+  ++ +G +
Sbjct: 84  QSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARMSDRFGRIECWMFALVLYTVGEI 143

Query: 167 ICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-AS 225
           I   + +   + AG  I   G  G   LAT +  DL  LRDR     +      + T  S
Sbjct: 144 ISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDRTFAMNIFLIPVIINTWVS 203

Query: 226 GGLVGAYF-----RDWRLAFILQC---PISVLSGILIVVYLE--------LPP---RASA 266
           G +V +        +WR  + + C   P S L  +L   Y +        LPP   R   
Sbjct: 204 GNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLPYAYAQYIGWRNGTLPPYKLREKG 263

Query: 267 SN--KDCWSARLRRLDWAGATSLIAFLFLFMLTSSM-GGSSVAYGSRLFAAMCAATLVFG 323
            N  +  W   +  ++  G     AFL L +L  ++ GG++  +      AM       G
Sbjct: 264 QNLRQTLWKI-VEDINLIGVILFSAFLVLLLLPLTIAGGATSKWREGYIIAMIVVGGCLG 322

Query: 324 AVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYL 370
            +F+  ELR A +P +P  +L D ++  + L  +   +S+     YL
Sbjct: 323 FIFLIWELRFAKNPFIPRVYLGDPTIYVALLMEFVWRLSLQIELEYL 369

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 125/305 (40%), Gaps = 33/305 (10%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           +I++FS F+  F   LD  I      +  S +      S +A    L S+  Q  Y +LS
Sbjct: 64  VILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLSTVAIINNLLSAASQIFYARLS 123

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
           D  GR  L V S   + IG +I   +  +    AG     IG  GL  +  +I+SD   L
Sbjct: 124 DVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIGYVGLFLILVLILSDCSSL 183

Query: 206 RDRAVYQGLCNFVFGLGT-ASGGLV--GAYFRDWR-----LAFILQCPISVLSGILIVVY 257
           + R  YQ    + F + T  SG ++       +W       AFI   P++ L  +  +++
Sbjct: 184 KWRLFYQYAPTWPFIIITWISGNIISRANPIENWSWGIGMWAFIF--PLTCLPILFCMLH 241

Query: 258 LELPPRASASNKDCWSARLRRLDWAGATSLIAFLF-------LFMLTSSM---------- 300
           +    R +   +D  S++       G    +  LF       +F++T S+          
Sbjct: 242 MRFKARKTPEWQDL-SSQKSFFQTHGIVQALVQLFWKLDVVGIFIMTISLGCILVPLTLA 300

Query: 301 GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANW--- 357
           GGSS  + +           V   VF+Y E + A DP+ P   L+DR +  S   N+   
Sbjct: 301 GGSSSKWQNSEIIGPLVLGFVLVPVFIYWESKWAKDPLAPFELLKDRGIWASMCFNFLMD 360

Query: 358 --FCM 360
             +CM
Sbjct: 361 FVYCM 365

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 105/457 (22%), Positives = 190/457 (41%), Gaps = 44/457 (9%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           I+  S+ L  ++AALD T       +  S FN     S +  +  +  + C+P   K+SD
Sbjct: 80  ILAASILLTAWIAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKPFIAKISD 139

Query: 147 RLGRKPLLVFSNAV-FAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
            L  +P+  F   + + IG +I   S +I A V G     +G  G+  +  +I++D   L
Sbjct: 140 -LSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVFIAVGQSGINLMNMVIVADTTSL 198

Query: 206 RDRAVYQGLCNFVFGLGTASGGLV--GAYFRDWRLA---FILQCPISVLSGILIVVYLEL 260
           + R+    L +  + + T   G +       +WR     F +  P+++   IL++ YLE 
Sbjct: 199 KWRSFITSLLSVPYLVTTWISGYIVQNIISSNWRWGYGMFAIITPVALTPAILVMAYLEH 258

Query: 261 PPRASAS---NKDCWSARLRRLDWAG-----------ATSLI----------AFLF-LFM 295
               +       D  + + R +  +G            TSLI           F F L +
Sbjct: 259 EANKTGEIPIGSDPLTEKKREIRESGISGFKGYWQLLKTSLIEIDAFGLILLGFAFSLIL 318

Query: 296 LTSSMGGSSVAYGSRLFAAMCAATLVFGAV---FVYVELRVAADPVLPVTFLRDRSVLGS 352
           L  S+   S A G     +M A  ++ G     +V  E+  A  P+LP   L +R+ +  
Sbjct: 319 LPCSL--YSYAEGGWKNPSMIAMEVIGGIFLISYVIFEVFFAPFPLLPKRVLVNRTFICC 376

Query: 353 SLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGK 412
            + ++   M    +  +   Y   VL +   +    +  +   + F  +  G+  +   +
Sbjct: 377 VVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYLSNTTTMGLCFFGVVWGVLFRYFHR 436

Query: 413 YYYFLLAFCVLAIAGQVQIVLI-----TPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIA 467
           Y  F +    + + G    V       +P + +    L  +V  FG +  +  T +A  A
Sbjct: 437 YKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLIVAAL--IVTNFGDAANVMGTQVAAQA 494

Query: 468 AVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSL 504
           AVPH+  AAT S+   + S GA +G ++ +AV+ + L
Sbjct: 495 AVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTNEL 531

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 113/480 (23%), Positives = 193/480 (40%), Gaps = 71/480 (14%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           I++FS F+  +   LDG I      +  S ++     S I     + S+  Q +Y +LSD
Sbjct: 81  ILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIVYARLSD 140

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  LLV +  ++A+G +I   +  +    AG      G  G+  +  +I+SD   LR
Sbjct: 141 IYGRMSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGYVGVILILLLILSDFSSLR 200

Query: 207 DRAVYQGLCNFVFGLGTASGGLVGAY---FRDWR-----LAFILQCPISVLSGILIVVYL 258
            R  YQ +  + F + T   G +       + W       AFI   P+S +  +  ++++
Sbjct: 201 WRLFYQFVPTWPFIINTWISGNITQKANPLKHWSWDIGMWAFIF--PLSCVPILCCMIHM 258

Query: 259 ELPPRASASNKDC-----------WSARLRRLDW----AGATSLIAFL--FLFMLTSSMG 301
               R     K+            W   L+ L W     G   ++A L   L  LT + G
Sbjct: 259 HWRVRNDPEWKELQGEKTYFQIHGWKVTLKTLFWKLDVVGVLLMVACLGCILVPLTLAGG 318

Query: 302 GSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSV---LGSSLANWF 358
            SS    S +         V   +F Y E R A +P++P   ++DR V   LG S     
Sbjct: 319 VSSKWNHSNIIGPFVLG-FVLIPIFSYWEARWATNPLVPYKLVKDRGVWAALGISF---- 373

Query: 359 CMMSMMTTNFYLPV-YWSSVLGMKATDVGKRA-----MPSFFSVAFGSLGAGLYMKRTGK 412
               ++   FY+ V Y  +VL +   +  K A     + SF S     + A L + R  +
Sbjct: 374 ----LIDFIFYMAVDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPIVA-LALTRVTR 428

Query: 413 YYYFLLAFCVLAI----------AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTL 462
               ++  C L +           G+     I   + VW         G G ++      
Sbjct: 429 MKPVIIVGCSLWLLAMGLLYHFRGGRESHSGIIGALCVW---------GLGTTLFTYPVT 479

Query: 463 LAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSE 522
           +++ AA  H++ A  T+++Y     G+ +G +V  A++  +L   L  ++      G+SE
Sbjct: 480 VSVQAATNHDNMATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQLLKRI------GNSE 533

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 105/479 (21%), Positives = 198/479 (41%), Gaps = 61/479 (12%)

Query: 76  AEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSS 135
           AE Y      ++++FS FL  +   LDG + S   T   + +++    S I     +  +
Sbjct: 71  AEQYSSWQWRVVLLFSAFLCGYGYGLDGNLRSFYTTWATNSYSTHSLLSTIGVVNAVMGA 130

Query: 136 TCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLA 195
             Q +Y +LSD  GR  L V +   + +G +I   ++ +    AG     IG  G+  + 
Sbjct: 131 ASQIVYARLSDVYGRFTLFVTAIVFYVVGTIIESQAHDVQRYAAGAVFYNIGYVGVILIV 190

Query: 196 TMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYF--RDWR-----LAFILQCPIS 247
            +I+SD   L+ R  Y  +  + F + T  SG +V      ++W       AFI   P+S
Sbjct: 191 LLILSDFSSLKWRLFYSFVPTWPFIINTWISGNIVDVAKPEQNWSWDIAMWAFIF--PLS 248

Query: 248 VLSGILIVVYLELPPRASASNKDCWSAR---------------LRRLDWAGATSLIAFLF 292
            L  +  +++++   R + + K+  S +                 +LD  G   +I  L 
Sbjct: 249 CLPLLGCMLHMKWRARQTEAWKELSSQKTYYQTHGLVQSLVQLFWKLDVIGVFFMIIILG 308

Query: 293 LFMLTSSM-GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLG 351
             ++  ++ GG S  + +    A      V    F+  E + A +P+ P   LRDR +  
Sbjct: 309 CILVPLTLAGGISNKWNNPHIIAPFILGFVLIPFFIAWESKWAREPIAPFKLLRDRGIWA 368

Query: 352 SSLANWFCMMSMMTTNFYLPV-YWSSVLGMKATDVGKRA-----MPSFFSVAFGSLGAGL 405
           +      C+  ++   F +   Y  ++L +   +    A     + +F S  F    A L
Sbjct: 369 A-----LCIAFLINFIFTMAAGYLYTILMVAVNESVTSATRISSVSTFTSTVFSPFFA-L 422

Query: 406 YMKRTGKYYYFLLAFCVLAI----------AGQVQIVLITPQMPVWRQYLLQVVPGFGVS 455
           ++ R  +   F++A C L +          +GQ     I   + VW         G G +
Sbjct: 423 FITRFTRLKPFIIAGCSLWMVAMGILFHFRSGQNSDKGIIGALVVW---------GLGTT 473

Query: 456 VLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMR 514
           +      +++ +   HE+ A  T++SY     G+ +G +V  A++    T LL  ++++
Sbjct: 474 MFTYPVTVSLQSVTSHENMATVTALSYTMYRIGSAVGSAVSGAIW----TQLLYKQLLQ 528

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/368 (21%), Positives = 149/368 (40%), Gaps = 39/368 (10%)

Query: 37  DHLLDIEQGRAYGSTTKSSISSENEREDAGGATV-------AGCGSAEFYL-----PSSR 84
           DH+   + G+   +   S+I        A  +T+       +G  +AE Y      P  R
Sbjct: 15  DHVPANDSGKVELTGKASAIKINELSSSAASSTIGSEYIENSGVHNAEIYCKYYSHPIKR 74

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKL 144
           I++   S+FL  F   LD ++ +T  T   S ++     S +     + S+  Q  + + 
Sbjct: 75  IMVFS-SLFLIAFAYGLDNSVRTTYQTMATSSYSQHSLLSTVTCIKKVISAAAQLWFARS 133

Query: 145 SDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVP 204
           +D  GR  +L  S   + IG +I   +  +    AG  I  +G  G+  ++ + ++D   
Sbjct: 134 ADMFGRPTILTISIIFYVIGTIIECRAFDVSRYAAGACIFSLGHAGIVLVSELYVADFSN 193

Query: 205 LRDR---AVYQGLCNFVFGLGTASGGLVGAYFRDWR-----LAFILQCPISVLSGILIVV 256
           L  R   A  Q L N +      SG + GA  ++W       AFI   P+S +  I+ ++
Sbjct: 194 LNWRVTAAAAQVLPNVI--TTWISGNITGAIDKNWEWGIGMWAFIF--PLSCVPLIICII 249

Query: 257 YLELPPRASASN--------------KDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGG 302
           ++    R +  N              + C      +LD  G   L+AF  L ++  ++ G
Sbjct: 250 HMRYLARKNNENLKVVFQKPNYMTWKEYCIDIFFWKLDIIGLILLVAFFSLILVPFTLAG 309

Query: 303 SSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMS 362
           S      ++        ++   +++  EL+ A  P+ P   ++DR +    + N F   +
Sbjct: 310 SLTWKSPKIIVPEVLGWVLAIPLYLIWELKYARYPLTPWNSIKDRGIWAPLIINLFQEFA 369

Query: 363 MMTTNFYL 370
               N Y+
Sbjct: 370 YYMQNTYM 377

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 120/296 (40%), Gaps = 44/296 (14%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           +++F  F+  +  +LD  +     T+  S +      S I     ++S+T Q +Y + SD
Sbjct: 115 LLLFGAFICSYGYSLDSRVRRVYKTYAASSYKKHSLVSTINVIDSVASATSQVVYSRASD 174

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  LL+ +   + +G +I   +  I    AG F   +G  G++ L T+I+SD   L+
Sbjct: 175 IFGRLSLLLVAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSLK 234

Query: 207 DRAVYQGLC-------NFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVV 256
            R  YQ +        +++ G+       +  +  D   W   F L C I +L  ++ + 
Sbjct: 235 WRFFYQAILAWPNIINDWISGIIVDRANPIKHWSWDIGMWAFIFPLSC-IPILCCLIHMQ 293

Query: 257 YLELPPRASASNKDCWSARLR-------------------RLDWAGATSLIAFLFLFMLT 297
           +L       AS  D W    +                   R D  G   L AF+ L ++ 
Sbjct: 294 WL-------ASQTDEWKQLKKGKSYFKYYGYKDSLIDMFWRFDVVGVILLAAFIGLILIP 346

Query: 298 SSMGGSSVAYGSRLFAAMCAATLVFGAV----FVYVELRVAADPVLPVTFLRDRSV 349
            ++ G +    SR       A  V G V    F   E   A  P++P   ++DRS+
Sbjct: 347 LTLAGGT---KSRWSEGKLIAPFVIGCVMVPCFAIWEKWFAKHPIMPWRLIKDRSI 399

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 135/304 (44%), Gaps = 37/304 (12%)

Query: 75  SAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLS- 133
           SA+F     +IL+I  +   G F  +LD T+ ST   + G   NS  + S ++T  +++ 
Sbjct: 50  SAQFDSLKYKILLISTAFVCG-FGISLDYTLRST---YTGYATNSYSEHSLLSTVQVINA 105

Query: 134 --SSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGL 191
             S   Q +Y +LSD  GR  L + +   + +G +I   +  +    AG      G  G 
Sbjct: 106 VVSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGT 165

Query: 192 TSLATMIMSDLVPLRDRAVYQGLCNFVF-GLGTASGGLVGAYF--RDWR-----LAFILQ 243
             L T+I+SD   L+ R  YQ    + +  +   SG ++ A    ++W       AFI  
Sbjct: 166 NLLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIY- 224

Query: 244 CPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLF-------LFML 296
            P+S L  I +++Y++     +A  +     + R+    G    + FLF       + ++
Sbjct: 225 -PLSTLPIIFLILYMKYKSSKTAEWRSL-KEQARKERTGGLFENLVFLFWKLDIVGILLI 282

Query: 297 TSSMG-----------GSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLR 345
           T S+G            S   + S++ A + +   +F  +F+Y E + A  P+LP   L 
Sbjct: 283 TVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLF-FIFLYWEAKFAKSPLLPFKLLS 341

Query: 346 DRSV 349
           DR +
Sbjct: 342 DRGI 345

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 135/304 (44%), Gaps = 37/304 (12%)

Query: 75  SAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLS- 133
           SA+F     +IL+I  +   G F  +LD T+ ST   + G   NS  + S ++T  +++ 
Sbjct: 50  SAQFDSLKYKILLISTAFVCG-FGISLDYTLRST---YTGYATNSYSEHSLLSTVQVINA 105

Query: 134 --SSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGL 191
             S   Q +Y +LSD  GR  L + +   + +G +I   +  +    AG      G  G 
Sbjct: 106 VVSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGT 165

Query: 192 TSLATMIMSDLVPLRDRAVYQGLCNFVF-GLGTASGGLVGAYF--RDWR-----LAFILQ 243
             L T+I+SD   L+ R  YQ    + +  +   SG ++ A    ++W       AFI  
Sbjct: 166 NLLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIY- 224

Query: 244 CPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLF-------LFML 296
            P+S L  I +++Y++     +A  +     + R+    G    + FLF       + ++
Sbjct: 225 -PLSALPIIFLILYMKYKSSKTAEWRSL-KEQARKERTGGLFENLVFLFWKLDIVGILLI 282

Query: 297 TSSMG-----------GSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLR 345
           T S+G            S   + S++ A + +   +F  +F+Y E + A  P+LP   L 
Sbjct: 283 TVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLF-FIFLYWEAKFAKSPLLPFKLLS 341

Query: 346 DRSV 349
           DR +
Sbjct: 342 DRGI 345

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 106/486 (21%), Positives = 205/486 (42%), Gaps = 57/486 (11%)

Query: 75  SAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSS 134
           +AE+     RIL+ +F  F+  +   LD  I     +++ + F+     S +     + S
Sbjct: 86  AAEYDWWPFRILL-LFCAFICGYGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNVINAVIS 144

Query: 135 STCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL 194
           +  Q +Y +L+D  GR  L + +   +++G +I   S +I    AG     +G  G+  +
Sbjct: 145 AASQIVYARLADVFGRLTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGYVGVVLV 204

Query: 195 ATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYF---RDWR-----LAFILQCPI 246
             +I+SD   L+ R  YQ    + F + T   G + +      +W       AFI   P+
Sbjct: 205 LLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNITSRANPQENWSWDIGMWAFIF--PL 262

Query: 247 SVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFL-------FMLTSS 299
           S +  I  ++++    R +   K   +         G  S I  LF        F++T S
Sbjct: 263 SCVPLICCMLHMWWKARRTEEWKIL-NEEKTYFKTHGLVSFIKELFWKLDTIGTFIMTVS 321

Query: 300 M----------GGSSVAY-GSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRS 348
           +          GG+S  +  S++   +    ++   + VY EL+ A +P+LP   ++DR+
Sbjct: 322 LGCILVPLTLAGGTSSKWDDSQIIGPLVLGVVLLPMLIVY-ELKWAREPILPWKLIKDRA 380

Query: 349 VLGS-SLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYM 407
           V  S S++  +  +  M  ++   V   +V     +     ++ +F S  F    A LY+
Sbjct: 381 VWASMSISFLYDFIFYMAYDYLYTVMIVAVDESVKSATRISSLSAFVSTVFSPFFA-LYI 439

Query: 408 KRTGKYYYFLLAFCVLAI----------AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVL 457
            R  +   +++A C L +           G+     I   + VW         G G ++ 
Sbjct: 440 TRVTRLKPYIIAGCGLWMVAMGLLYHFRGGKSSHSGIIGGLCVW---------GVGTTMF 490

Query: 458 ITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSL-----TSLLDAKV 512
                +++ +A  HE+ A  TS++Y     G+ +G++V   ++  +L       + DAK+
Sbjct: 491 TYPVNVSVQSATSHENMATVTSLNYTLYRIGSAVGIAVSGCIWTQNLYHEIFKRVKDAKI 550

Query: 513 MRFASD 518
             +A +
Sbjct: 551 ASYAYE 556

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 101/456 (22%), Positives = 184/456 (40%), Gaps = 53/456 (11%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           I++ S F+  +   LDG I      +  S ++     S I     + S+  Q +Y +LSD
Sbjct: 81  ILLISAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSD 140

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  L + +  ++ +G +I   +  +    AG      G  G+  +  +I+SD   L+
Sbjct: 141 VFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGSIFYNAGYVGVILILLIILSDFSSLK 200

Query: 207 DRAVYQGLCNFVFGLGTASGGLVGAY---FRDWR-----LAFILQCPISVLSGILIVVYL 258
            R +YQ    + F + T   G + +      +W       AFI   P+S +  +L ++++
Sbjct: 201 WRLLYQFAPTWPFIINTWIAGNITSKANPVENWSWDIGMWAFIF--PLSCIPIVLCMLHM 258

Query: 259 E-----------LPPRASASNKDCWSARLRRLDWAGATSLIAFLF--------LFMLTSS 299
           +           L    S   +  +   L +L W     +I  L         L  LT +
Sbjct: 259 QWIARKTPEWHALKDEKSYYQEHGFVKVLEQLFW--KLDVIGVLLMGCSLGCILVPLTLA 316

Query: 300 MGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS-SLANWF 358
            G  +    SRL        ++   ++V+ E RVA DP++P   ++DR V  S  ++   
Sbjct: 317 GGVKTTWNDSRLIGPFVLGFVLIPILWVW-EYRVARDPIIPYKLVKDRGVWSSMGISFLI 375

Query: 359 CMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLL 418
             +  M  ++   V   +V     +      + SF SV   S   GL M R  +   F++
Sbjct: 376 DFIYYMAADYLYTVMLVAVNESIKSATRISTLSSFVSVV-ASPFFGLIMTRCTRLKPFIM 434

Query: 419 AFCVLAI----------AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAA 468
             C L +           G+     I   + VW         G G ++      +++ +A
Sbjct: 435 FGCCLWMLAMGLLYRYRGGRESHSGIIGALCVW---------GLGTTLFTYPVTVSVQSA 485

Query: 469 VPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSL 504
           V HE+ A  T+++Y     G+ +G +V  A++  +L
Sbjct: 486 VSHENLATVTALNYTLYRIGSAVGAAVSGAIWTQTL 521

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 108/563 (19%), Positives = 222/563 (39%), Gaps = 58/563 (10%)

Query: 40  LDIEQGRAYGSTTKSSISSENER-EDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFL 98
           + + +G    + TK S   E E   D+  +     G A+  L    + + + S+ L +F+
Sbjct: 1   MSLSKGSQNMAETKCSSQPEIEEASDSDTSLNVNGGDAKMGL---SLYLCLASLTLVLFI 57

Query: 99  AALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSN 158
            ALD  IV T++  +  +F +  K  W+ T Y L ++    L+G+ +  +G +  L+ + 
Sbjct: 58  TALDILIVGTIIDVVAKQFGNYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAV 117

Query: 159 AVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFV 218
            +F  G L+  L+NS+  ++ GR ++G+GG GL +L  +I   +V  R R +   + +  
Sbjct: 118 LIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVDERSRPLVISILSCA 177

Query: 219 FGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGILIVVYLE-----LPPRASASNKD 270
           F +    G ++G  F     WR  F +  PI  L+ I+ ++  +     +  +   + + 
Sbjct: 178 FAVAAIVGPIIGGAFTTHVTWRWCFYINLPIGGLAVIMFLLTYDAKNDGIIQQMKGALRK 237

Query: 271 CWSARLRRLDWAG----ATSLIAFLF-------------LFMLTSSMGGSSVAYGSRLFA 313
                  RL   G    A + + F F             LF+L  + GG+   + S    
Sbjct: 238 ISGFEFSRLKKPGNLRKAINCLIFKFDFFGFALSSTGLVLFLLGLTFGGNKYTWSS---- 293

Query: 314 AMCAATLVFGAVFVYVEL---------------RVAADPVLPVTFLRDRSVLGSSLANWF 358
                 LV G V     L                ++  P+     +   +++  ++  + 
Sbjct: 294 GQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNISYRPLFLRRLVAKPAIIIVNMVTFL 353

Query: 359 CMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLL 418
                     Y   ++  +    A   G   +P   +    ++ +G+  K+ G     L+
Sbjct: 354 LCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIASGIITKKLGLVKPLLI 413

Query: 419 AFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEH----- 473
               L + G   + L+        Q  + ++PGF +   +  +L++    +  +      
Sbjct: 414 FGGFLGVIGAGLMTLMKNNSTSSTQIGVLILPGFSLGFALQASLMSAQLQINKDRPETPM 473

Query: 474 -HAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASA 532
                T+ +   +S G TLG  +   VF +SL +    KV     + ++ + +  +I   
Sbjct: 474 DFIEITAFNTFMKSLGTTLGGVLSTTVFSTSLHN----KVSHVHLEPYAGKTVDEMILYR 529

Query: 533 ARSSDWVHRSAPPFVRATLLECY 555
             + D  H +    + A++   +
Sbjct: 530 LHNFDGAHSTIGNILGASIKNVF 552

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 107/469 (22%), Positives = 195/469 (41%), Gaps = 71/469 (15%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           II+FS F+  +   LDG++     ++  S ++     S I     + S+  Q ++ +LSD
Sbjct: 56  IILFSAFICGYGYGLDGSVRYVYTSYAVSSYSDHPLISTITVVTAIISAASQIVFARLSD 115

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  L + +   +A+G +I   +  +    AG      G  GL  +  +I+SD   LR
Sbjct: 116 VFGRLSLFITALLFYAVGTIIQSQATDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLR 175

Query: 207 DRAVYQGLCNFVFGLGTASGGLVGAYFR-----DWRLA-FILQCPISVLSGILIVVYLEL 260
            R VYQ   ++ + + T   G V A         W +A +    P+S L  I  ++++  
Sbjct: 176 WRLVYQFAPSWPYIINTWFAGTVTARANPQEHWSWDIAMWAFIVPLSALPMIFCMLHM-- 233

Query: 261 PPRASASNKDCWSARLRRLDWAGATSLIAFLF----------LFMLTSSMG----GSSVA 306
             R  A   + W+A      +  +  LI  L           + ++T S+G      ++A
Sbjct: 234 --RFKARKTEQWAAIKDEKSFFQSHGLIRTLVELFWKLDIVGVLLMTISVGCILAPLTLA 291

Query: 307 YG--SRLFAAMCAATLVFGAV----FVYVELRVAADPVLPVTFLRDRSVLG--------- 351
            G  S+         LV G V    F+  E + A  PV+P   ++DR+V G         
Sbjct: 292 GGVKSKWSNPHLIGPLVLGFVLLPLFMIWESKAAKYPVVPYGLIKDRAVWGALGCQFLIG 351

Query: 352 ---SSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSL------- 401
              +++A +   + ++  N    V  ++V+   ++ V   A  +FFS+            
Sbjct: 352 FIYNAVAGYIYTILIVAVN--ESVKSATVISSLSSFVSTVA-STFFSLYITRCTKLKGYI 408

Query: 402 --GAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLIT 459
             G G++M   G +Y++          G+     I   M +W         G G ++LI 
Sbjct: 409 IGGCGIWMLAMGLFYHYR--------GGEFAHSGIVGAMVIW---------GLGDTLLIY 451

Query: 460 VTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLL 508
            T +++ +A  H++ A  T+++Y     G   G +V  A++  +L   L
Sbjct: 452 PTTISVQSATSHDNMATVTALNYTLYRIGLATGAAVSGAIWSQTLYKAL 500

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 115/527 (21%), Positives = 207/527 (39%), Gaps = 75/527 (14%)

Query: 34  EQQDHLLDIEQG---RAYGSTTKSSISSENEREDAGG---------------ATVAGCGS 75
           E++   LDIEQ     A+  +  SS + ++      G                 + G   
Sbjct: 13  EKKHVPLDIEQELNPEAHTDSHSSSYARDDTLPQMSGKYDALRQNRSLIIKQTEIIGTAY 72

Query: 76  AEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSS 135
            ++YL +    I++FS F+  +   LDG I      +  S ++     S I     + S+
Sbjct: 73  NKWYLQA----ILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSKHSLLSTINVINAVVSA 128

Query: 136 TCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLA 195
             Q +Y +LSD  GR  L + +  ++ +G +I   +  +    AG      G  G+  + 
Sbjct: 129 ASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILIL 188

Query: 196 TMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR---DWR-----LAFILQCPIS 247
            +I+SD   L+ R +YQ    + F + T   G + +      +W       AFI   P+S
Sbjct: 189 LIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIF--PLS 246

Query: 248 VLSGILIVVYL-----------ELPPRASASNKDCWSARLRRLDWAGATSLIAFLF---- 292
            +  +L ++++           EL  + S   +      L +L W     +I  L     
Sbjct: 247 CIPIVLCMLHMQWRAGKTPEWQELKGQKSYYQEHGLMKILEQLFW--KLDVIGVLLMGCS 304

Query: 293 ----LFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRS 348
               L  LT + G  +    SRL        ++   ++V+ E   A DP+LP   ++DR 
Sbjct: 305 LGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPILWVW-EYSYARDPILPYKLVKDRG 363

Query: 349 VLGS-SLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYM 407
           V  S  ++     +  M  ++   V   +V     +      + SF SV   S   GL M
Sbjct: 364 VWSSMGISFLIDFIYYMAADYLYTVMIVAVNESIKSATRISTLSSFVSVV-ASPFFGLLM 422

Query: 408 KRTGKYYYFLLAFCVLAI----------AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVL 457
            R  +   F+++ C L +           G      I   + VW         G G ++ 
Sbjct: 423 TRCTRLKPFIMSGCSLWMLAMGLLYRFRGGSESHSGIIGALCVW---------GVGTTLF 473

Query: 458 ITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSL 504
                +++ +AV HE+ A  T+++Y     G+ +G +V  A++  +L
Sbjct: 474 TYPVTVSVQSAVSHENLATVTALNYTMYRIGSAVGSAVSGAIWTQTL 520

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 102/459 (22%), Positives = 182/459 (39%), Gaps = 49/459 (10%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           LI +F  FL  +   LD  I      +  S ++     S +     + S+  Q +Y +LS
Sbjct: 68  LIFLFCAFLCGYGYGLDSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIVYARLS 127

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
           D  GR  L V +  ++++G +I   +  +    AG      G  G+  +  +I+SD+  L
Sbjct: 128 DAFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILSDMSTL 187

Query: 206 RDRAVYQGLCNFVFGLGT-ASGGLVGAY--FRDWR-----LAFILQCPISVLSGILIVVY 257
           R R  YQ +  + + + T  SG +  A     +W       AFI   P+S L  +  +++
Sbjct: 188 RWRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGMWAFIF--PLSCLPILACMIH 245

Query: 258 LELPPRASASNKDCWSAR---------------LRRLDWAGATSLIAFL--FLFMLTSSM 300
           ++   R +   KD  + +                 ++D  G   + A L   L  LT + 
Sbjct: 246 MQWRARKTQEWKDLKTQKTYYQQHGLMKSLVSLFWKIDIIGVLLMAASLGCILVPLTLAG 305

Query: 301 GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS-SLANWFC 359
           G SS    SR+        ++    F++ E + A DP++P   ++DR V  S  ++    
Sbjct: 306 GTSSKWRDSRIIGVFVLGFVLIPIFFIW-EKKFATDPIVPYKLVKDRGVWASLGISFLID 364

Query: 360 MMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLA 419
            +  M  ++   V   +V    +      ++ SF S    S    L + R  +   F++ 
Sbjct: 365 FIYYMAADYLYTVLIVAVNESVSAATRISSLYSFVSTV-ASPFVSLALTRFTRLKPFIIF 423

Query: 420 FCVLAI----------AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAV 469
            C L             G      I   + VW         G G +       +++ AAV
Sbjct: 424 GCCLWFLAMGLLYHFRGGASSHSGIIGGLCVW---------GLGSTFFTYPVTVSVQAAV 474

Query: 470 PHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLL 508
            HE  A  ++++Y F   G+ +G +V  A++   L   L
Sbjct: 475 SHEQMATVSALNYTFYRIGSAVGAAVSGAIWTQKLYKKL 513

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 102/434 (23%), Positives = 169/434 (38%), Gaps = 65/434 (14%)

Query: 111 THIGSEFNSLDKASWIATSYLLSSSTC---QPLYGKLSDRLGRKPLLVFSNAVFAIGCLI 167
           T+ G   NS  + S +AT  +++S      Q  + +LSD  GR  L  F   ++ +G ++
Sbjct: 103 TYTGYATNSFSQHSLLATINVINSVVSIASQLFFARLSDHFGRLQLFGFCTLMYIVGTIL 162

Query: 168 CGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASG 226
              S ++     G      G  G+  L T++MSD   L  R       ++ + + T  SG
Sbjct: 163 QSQSKNVSIYAGGAVFYNAGYTGVRLLMTIMMSDFSTLGWRYFMIASPDWCYIIITWVSG 222

Query: 227 GL--VGAYFRDWR-----LAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLR-- 277
            +  +     +W       AFI       L G L+ ++ +      AS  D W   LR  
Sbjct: 223 NIIEISNPLENWSWDIAMWAFIFPLTTIPLVGFLVYMFYK------ASRTDEWK-ELRSV 275

Query: 278 ---------------RLDWAGATSLIAF---LFLFMLTSSMGGSSVAYGSRLFAAMCAAT 319
                           LD  G   LIA      L  LT S G +     SR    +C  +
Sbjct: 276 TKKMPTPVYIKEVFWNLDIPGVL-LIAISLGCILIPLTVSGGETEEWKDSRNIGVLCLGS 334

Query: 320 LVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLG 379
           ++F  +F+  E ++A  PVL +T+L+DR V     A++F   + +    YL  Y   ++G
Sbjct: 335 VLF-PIFLLWEGKIAKRPVLALTYLKDRGVWAPLAASFFMSNAYLIATDYL--YAVLLVG 391

Query: 380 MKATDVGKRA---MPSFFSVAFGSLGAGLYMKR---------TG-KYYYFLLAFCVLAIA 426
              ++   +    +PSF  V       GL + R         TG  +YY           
Sbjct: 392 FNQSESASQRITWLPSFAGVVITPF-TGLLITRWKHLKVLTITGCIFYYIAFGLFYRYRG 450

Query: 427 GQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRS 486
           G   +  I          +  +  GFG  +     ++++ A   H   A  T++ Y F  
Sbjct: 451 GSTNVAGII---------VGTIFMGFGSGISTYPLMVSLQAVSSHTKIAIVTALFYTFEQ 501

Query: 487 TGATLGVSVGAAVF 500
            G  +G S+  A++
Sbjct: 502 VGRAVGSSISGAIW 515

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 127/291 (43%), Gaps = 34/291 (11%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           +++FS+FL  +   LDG++ S   T+  + +++    S I+   L+  ++ Q  + +LSD
Sbjct: 69  VLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISIINLVIGASAQVFFARLSD 128

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  LL+ +   +++G +I   +  +    AG     +G  G+     +I+SD   LR
Sbjct: 129 VFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGLVGVVLQVILILSDFSSLR 188

Query: 207 DRAVYQGLCNFVFGLGT-ASGGLVGAY--FRDWR-----LAFILQCPISVLSGILIVVYL 258
            R  Y  + ++ F +    SG +V A     +W       AFI   P++ L  +  ++++
Sbjct: 189 WRLFYTFVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAFIF--PLTCLPLVCCILHM 246

Query: 259 ELPPRASASNKDCWSA-RLRRLDWAGATSLIAFLFLF---------MLTSSM-------- 300
               R  AS  + W   +L +  +     L   + LF         +LT ++        
Sbjct: 247 ----RYRASKTEAWRHLQLEKTYYQSHGLLQTLIQLFWKLDVVGVLLLTVTLGCILVPLT 302

Query: 301 --GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSV 349
             GG S  + +    A      V   +FV  E + A DP+ P   L+DR V
Sbjct: 303 LAGGVSQKWNNPHVIAPFVLGFVLLPIFVVWESKWALDPIAPFELLKDRGV 353

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 82/347 (23%), Positives = 144/347 (41%), Gaps = 33/347 (9%)

Query: 31  NQIEQQDHLLDIEQGRAYGSTTK-SSISSENEREDAGGATVAGCGS--AEFYLPSSRILI 87
           + I+ Q++L    + + +    K  SIS   + E+      A       ++Y    R+ I
Sbjct: 2   SDIKYQENL----KTKTFDEDAKIESISVHTDSENIVTNIAAHNARIYVKYYSTPLRVTI 57

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLS---SSTCQPLYGKL 144
           + FS+FL  +   L   +  T  T   S ++   K S +AT   ++   S+  Q  Y + 
Sbjct: 58  LYFSLFLLAYAYNLHKDVRGTYQTLATSSYS---KHSLLATVQCINQVISAAGQIWYARA 114

Query: 145 SDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVP 204
           SD  GR P+L+ S   + IG LI   +  I    AG  I  +G  G   +  +++SD   
Sbjct: 115 SDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALGYAGSVLVTQVLVSDYST 174

Query: 205 LRDRAVYQGLCNFVFGLGTASGGLVGAYFRD-WRLAFILQCPISVLSGILIVVYLELPPR 263
           L+ R V   +      + T  GG +     + W+  F +   I  L+ I ++  L     
Sbjct: 175 LKWRLVSSTVLFLPNIINTWVGGNITEDVGNRWQWGFGMWAFIFPLASIPLLCCLAHMKY 234

Query: 264 ASASNKD------------CWSARLR-----RLDWAGATSLIAFLFLFMLTSSMG-GSSV 305
            +  NK+             W+  L      +LD  G   L+AF  L ++  ++  G   
Sbjct: 235 LAIKNKEDVKLTISKPRSISWARHLYDIFFWKLDMLGLILLVAFFALILVPLTLAKGLHE 294

Query: 306 AYGSRLFAAMCAATLVFG-AVFVYVELRVAADPVLPVTFLRDRSVLG 351
            +GS  F             +F+  EL+ A++P+ P+  ++DR + G
Sbjct: 295 GWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKDRGIYG 341

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 133/306 (43%), Gaps = 41/306 (13%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSS---STCQPLYG 142
           +I++F+ F+  +   LDG I      + G   N+  + S ++T  ++++   +  Q +Y 
Sbjct: 63  VILLFAAFICGYGYGLDGNI---RYIYTGYATNAYSEHSLLSTIGVVNNVIGAASQLVYA 119

Query: 143 KLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDL 202
           +L+D  GR  L + +   +A+G +I   +  +    AG     IG  G+  +  +++SD 
Sbjct: 120 RLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGYVGVILVLLLMLSDF 179

Query: 203 VPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRD----WRL---AFILQCPISVLSGILI 254
             LR R +Y  +  + F + T  SG +  A   +    W +   AFI   P+S +  I  
Sbjct: 180 SSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAFIF--PLSCVPLIAC 237

Query: 255 VVYLELPPRASAS------------NKDCWSARLR---RLDWAGATSLIAFLFLFMLTSS 299
           ++++ +  R +                  W   +    +LD  G   LIA L   ++  +
Sbjct: 238 MIHMRIKARKTPEWIALKQEKSYFQTNGLWDTLVELFWKLDVVGVLLLIATLGCILVPLT 297

Query: 300 MGGSSVAYGSRLFAAMCAATLVFGAVFV----YVELRVAADPVLPVTFLRDRSV---LGS 352
           + G    Y S+          V G V V    + E+R A DP++P   ++DR V   L  
Sbjct: 298 LAG---GYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWARDPLVPYGLIKDRGVWSALAI 354

Query: 353 SLANWF 358
           S  N+F
Sbjct: 355 SFLNYF 360

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 109/521 (20%), Positives = 196/521 (37%), Gaps = 80/521 (15%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           + +FS FL  F   LDG I    +T+  + +++    S +    ++ S+  Q +Y  LSD
Sbjct: 72  LFLFSAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGVISMVISAVAQVIYAGLSD 131

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  L + S   + +G +I   +  +    AG     +G  G+     +++SD   L+
Sbjct: 132 VFGRLSLFIVSIVFYVVGTIIQSQAYDVQRYAAGSVFYSVGLVGVMLQVILVLSDNSSLK 191

Query: 207 DRAVYQGLCNFVFGLGT-ASGGLVGAYFRD----WRL---AFILQCPISVLSGILIVVYL 258
            R  Y  +  +   + T  SG ++     +    W +   AFI   P+S +  I  ++++
Sbjct: 192 WRLFYTFVPAWPSIITTWVSGNVIETANPEDNWSWNIAMWAFIF--PLSCIPLIACMLHM 249

Query: 259 ELPPRASASNKDCWSAR---------------LRRLDWAGATSLIAFLFLFMLTSSM-GG 302
               R     K+  + +                 +LD  G   L       ++  ++ GG
Sbjct: 250 RWKVRNEPEWKELQTEKTYYQSHGLIQTVVQLFWKLDVVGIILLTVGTGCILVPLTLAGG 309

Query: 303 SSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMS 362
            S  + S    A      V  A+F+Y E ++A  P+ P   L+DR +       +     
Sbjct: 310 VSTQWQSAKLIAPFVLGFVLIAIFIYWESKLALAPIAPFKMLKDRGIWAPLWIMFLIAFV 369

Query: 363 MMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVA--------------------FGSLG 402
                 YL  Y   ++ +  TD+    + S +S                      +  LG
Sbjct: 370 YQMAAGYL--YTILMVAVDETDLSATRITSLYSFVSAIFAPVLGFIVARSSRLKPYMVLG 427

Query: 403 AGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTL 462
             LY    G +Y + +        G+     +   M VW   +   +  + V+V I    
Sbjct: 428 CSLYFVTMGLFYRYRV--------GKDAHQGVIGAMVVWG--ICSCLFDYPVTVSIQ--- 474

Query: 463 LAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSE 522
               +   HE+ A  T++SY   S G  +  SV  A++    T LL  K++ +  D    
Sbjct: 475 ----SVTSHENMATVTALSYTIFSIGGAVAASVSGAIW----TQLLYPKLLEYIGDAD-- 524

Query: 523 RELRGIIASAARSSDWVHRSAPPF---VRATLLECYHFASR 560
                 +A AA SS        P+   +R  ++E Y    +
Sbjct: 525 ------LAEAAYSSPLTFYLDYPWGTPIRDAMVEAYKHVQK 559

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 109/537 (20%), Positives = 214/537 (39%), Gaps = 74/537 (13%)

Query: 15  RDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGS---TTKSSISSENEREDAGGATVA 71
           RD +++    +   + +++  + H  +     +YG    + K +   +N         + 
Sbjct: 7   RDPVKEEKKHVFMGMEHELNPETH--NDSNSDSYGLPQLSEKYNALRQNRSLIIQQTEII 64

Query: 72  GCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYL 131
           G    ++YL +    I++ S F+  +   LDG I      +  S ++     S I     
Sbjct: 65  GSAYNKWYLQA----ILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINA 120

Query: 132 LSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGL 191
           + S+  Q +Y +LSD  GR  L + +  ++ +G +I   +  +    AG      G  G+
Sbjct: 121 VVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGV 180

Query: 192 TSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR---DWR-----LAFILQ 243
             +  +I+SD   L+ R +YQ +  + F + T   G + +      +W       AFI  
Sbjct: 181 ILILLIILSDFSSLKWRLLYQFVPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIF- 239

Query: 244 CPISVLSGILIVVYLELPPRASAS------NKDCWSAR-----LRRLDWAGATSLIAFL- 291
            P+S +  +L +++++   R +         K  +        L++L W      +  + 
Sbjct: 240 -PLSCVPIVLCMLHMQWRARKTPEWHALKGQKSYYQEHGFIKILKQLFWMLDVVGVLLMG 298

Query: 292 -----FLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRD 346
                 L  LT + G  +    SRL        ++   ++++ E R A DP+LP   ++D
Sbjct: 299 CSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPILWIW-EYRFARDPILPYRLVKD 357

Query: 347 RSVLGSS----LANWFCMM------SMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSV 396
           R+V  S     L ++   M      ++M       V  ++ +   ++ V   A P FF++
Sbjct: 358 RAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRIATLSSFVSTVASP-FFAL 416

Query: 397 ---------AFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQ 447
                     F   G  L+M   G  Y+F          G      I   + VW      
Sbjct: 417 LVTRCTRLKPFIMFGCALWMVAMGLLYHFR--------GGSQSHSGIIGALCVW------ 462

Query: 448 VVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSL 504
              G G ++      +++ +AV HE+ A  T+++Y     G+ +G +V  A++  +L
Sbjct: 463 ---GVGTTLFTYPVTVSVQSAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTL 516

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 98/467 (20%), Positives = 190/467 (40%), Gaps = 73/467 (15%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           + ++F+ FL  +   LDG I S   ++  + + +    S ++    + S+  Q  + +LS
Sbjct: 58  VFLLFAAFLCGYGYGLDGNIRSVYTSYAAASYAAHPLISTLSVVTGVMSAASQIFFARLS 117

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
           D  GR  L V + A + +G +I   +  I     G     IG  G+  +  +I+SD   L
Sbjct: 118 DVFGRLSLFVTAIAFYVVGTIIQSQAYDIQRYAVGSVFWSIGYVGILLMLILIVSDFSSL 177

Query: 206 RDRAVYQ------GLCN-FVFGLGTASGGLVGAYFRDWRL---AFILQCPISVLSGILIV 255
           R R +YQ      G+ N ++ G  TA       +   W +   AFI+  P++ L  IL +
Sbjct: 178 RWRLLYQFAPSWPGIINTWIAGTITARSNPQEKW--SWNIGMWAFII--PLTCLPMILCM 233

Query: 256 VYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLF------LFMLTSSM--------- 300
           +++    R +    +  + R          +LI   +      + ++T+S+         
Sbjct: 234 LHMRFKARRTEQWAELRNERSYYQTHGLIKTLIELFWKVDVVGILLMTASIGCVLAPLTL 293

Query: 301 -GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFC 359
            GG+   + +    +      V   +F+  E + A DP++P   ++DR+V  S  + +  
Sbjct: 294 AGGTGSKWQNPRVISPFVLGFVLLPIFLIWEKKWARDPIIPYDLIKDRAVWASLNSQFLI 353

Query: 360 MMSMMTTNFYL----------PVYWSSVLGMKATDVGKRAMPSF------------FSVA 397
               M    Y+           +  ++ + + ++ V   A P F            + VA
Sbjct: 354 GFIYMMAAGYIYNILIVGVNESIKSATTITILSSFVATAASPPFCLWITRCTRMKGYIVA 413

Query: 398 FGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVL 457
               G GL+M   G +Y++          G+     I   M VW         G G  +L
Sbjct: 414 ----GCGLWMLAMGLFYHYR--------GGEFAHGGIVAAMVVW---------GLGDVLL 452

Query: 458 ITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSL 504
           I    +++ +A  H++ A  T+++Y     G + G ++  A++  +L
Sbjct: 453 IYPITVSVQSATSHDNMAMVTALNYTTYRIGLSTGSAISGAIWTQTL 499

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 111/238 (46%), Gaps = 10/238 (4%)

Query: 30  ANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIM 89
           A + E +    +I  G  +G T+  ++S  N + + G  +         +  + ++L+++
Sbjct: 12  AYRPEGESERDEIGSGPDHGETSGLAVS--NSQSEVGNESDFELEPYSRFSHTQKMLLVV 69

Query: 90  FSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDK-ASWIATSYLLSSSTCQPLYGKLSDRL 148
              F G F + + G+I   +LT I  +FN  ++ A+     Y +       + G L+D  
Sbjct: 70  QCAFTG-FFSTVAGSIYYPVLTVIEKKFNITEELANVTIVVYFVFQGLAPSIMGGLADTF 128

Query: 149 GRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDR 208
           GR+P+++++   +   C+    S++   ++A R +   G   + ++ + IM D+    +R
Sbjct: 129 GRRPVVLWAVLTYCCACIGLASSHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVER 188

Query: 209 AVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPR 263
             Y GL +    +GTA G L+GA       WR  F     +++ SGI +VV   L P 
Sbjct: 189 GGYVGLVSGFQVVGTAFGALIGAGLSSRWGWRAIFWF---LAIGSGICLVVSALLLPE 243

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 123/562 (21%), Positives = 213/562 (37%), Gaps = 87/562 (15%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKL 144
           I + +F+ FL      L+  + +   T+  + + S    S I     + S+    +Y +L
Sbjct: 81  ICVFLFTAFLAGVGTDLNSQLRNNYTTYATNSYRSHSLLSTIGVVSSIISAGALTVYARL 140

Query: 145 SDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVP 204
           SD  GR  L + +   F +G +I   +N++    AG     +G  G+  +  +IMSD   
Sbjct: 141 SDVFGRIRLYLSAMLFFVVGTIIQSQANNVQKYAAGTVFYSLGTAGIQVMMFIIMSDFSS 200

Query: 205 LRDRAVYQGLCNF-VFGLGTASGGLVGAY--FRDWRLAFILQCPISVLSGILIVVYLELP 261
           L+ R  +     +    +   +G +V        W     +   I  LS +  V YL L 
Sbjct: 201 LKWRLFFTFAPTWPNLFIPWITGSIVDRLDPVERWSWGIGMWAFIYPLSSVPFVAYL-LL 259

Query: 262 PRASASNKDCWS-------------------ARLRRLDWAGATSLIAFL--FLFMLTSSM 300
            R  AS  + W                        ++D  G    +AFL   L  LT + 
Sbjct: 260 VRYKASKTEEWKMLSSEKTYYETHGIIQTLVQLFWKVDVVGLLLFVAFLGCILVPLTLAG 319

Query: 301 GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCM 360
           G SS     ++         +  A F+  E + A  P+ P   L+DR +  +       +
Sbjct: 320 GVSSQWSNGKILGPFILGFCLVPA-FILWETKYARLPIAPFKMLKDRGIWSA------LI 372

Query: 361 MSMM-TTNFYLPV-YWSSVL--------GMKATDV--------GKRAMPSFFSV------ 396
           +SM+  T +YL   Y  ++L        GM A  +        G     S+F V      
Sbjct: 373 ISMLAKTVYYLAAGYLLTILMVAVNQSRGMAAVIMNVWSVVGCGFSPFFSYFVVRVRRLK 432

Query: 397 AFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSV 456
            F  +G G++M   G  YY+         +G+     I   M +W         G G ++
Sbjct: 433 PFIIIGCGIWMVSMGLLYYYR--------SGEHSKGGIIGAMVLW---------GLGSTM 475

Query: 457 LITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFA 516
           +   T+++  +   HE+ A  T+I  A    G  +G +V  A++    T  L AK++   
Sbjct: 476 ITRTTVISSQSITAHENMATITAIMLAISRIGGGIGSAVSGAIW----TQTLYAKLVETI 531

Query: 517 SDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVS 576
            D    +++     SA R   W     P   R  ++E Y    R      +  ++   ++
Sbjct: 532 GDPEIAKKVYQSPLSAIRVYAW---GTP--TRDAIVEAYRHVQRFEVLVAMILVIPLFIA 586

Query: 577 CSIIKEHKL-----HTSIKRGS 593
              +++ +L     HT IK G 
Sbjct: 587 SLCLRDPELTDEVAHTDIKDGE 608

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 100/414 (24%), Positives = 166/414 (40%), Gaps = 51/414 (12%)

Query: 113 IGSEFNSLD--KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170
           IG  F + +  + SW A+SY L+  T   + G+L D  G +   +     +A+  L+ G 
Sbjct: 71  IGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGF 130

Query: 171 ---SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL--GTAS 225
              SN I+     R   G+G   L   A  I+        R       N VF L   +A 
Sbjct: 131 SVYSNKIFFDCC-RAFQGMGPAFLLPNAIAILGRTYKPGKRK------NMVFSLFGASAP 183

Query: 226 GGLV-GAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNKDCWSA 274
           GG V GA F         W  A+ +    C +  ++G  ++ ++++P R S S       
Sbjct: 184 GGFVLGAVFSSMLGQLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFN----- 238

Query: 275 RLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVA 334
            L R+D+AG+ + +  L LF    +  G  V + +     +     VF  VFV++E R A
Sbjct: 239 MLERVDFAGSVTGVIGLILFNFAWNQ-GPVVGWETPYTYVLLIVGTVFLGVFVFIESR-A 296

Query: 335 ADPVLPVTFLRDRS--VLGSSLANW--FCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAM 390
           A P+LP   L   +  VLG   A W  F +    T  F       S L + +      A+
Sbjct: 297 AYPLLPFAALSSDAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPL-LSSAQFAPVAI 355

Query: 391 PSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQ--- 447
             F +    ++  G  +  T      L A     +     I+LI    PV + Y  Q   
Sbjct: 356 SGFCA----AVTTGFLLSHTPASTVMLFAMTAFTVG----IILIA-TAPVHQTYWAQTFV 406

Query: 448 --VVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499
             +V  +G+ +      + +  ++PHEH     S+     +   ++G+ +   +
Sbjct: 407 SIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 460

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 99/408 (24%), Positives = 157/408 (38%), Gaps = 39/408 (9%)

Query: 113 IGSEFNSLD--KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170
           IG  F + +  + SW A++Y L+  T   + G+L D  G K   V     +A+  L+ G 
Sbjct: 71  IGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130

Query: 171 ---SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL--GTAS 225
              SN I+     R   G+G   L   A  I+        R       N VF L    A 
Sbjct: 131 SVYSNKIFFDCC-RAFQGMGPAFLLPNAIAILGRTYKSGKRK------NMVFSLFGACAP 183

Query: 226 GGLV-GAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNKDCWSA 274
           GG V GA F         W  A+ +    C    ++G  I+ +  +P R ++S K     
Sbjct: 184 GGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFK----- 238

Query: 275 RLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVA 334
            L R+D+AG+ + +  L LF    +  G  V + +     +     VF A+F ++E R A
Sbjct: 239 LLERVDFAGSVTGVIGLILFNFAWNQ-GPVVGWQTPYTYILLIVGTVFLAIFAFIESR-A 296

Query: 335 ADPVLPVTFLRDRS--VLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPS 392
           A P+LP   L   +  VL    A W    S     FY   +     G        +  P 
Sbjct: 297 AFPLLPFAALSSDTAFVLSCIAAGW---ASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 353

Query: 393 FFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQ-VVPG 451
             S    +L  G  + RT      L A      AG + I         W Q  +  +V  
Sbjct: 354 AVSGFCAALTTGYLLSRTPPSTVMLFAMTAFT-AGTILIATAPVHQTYWAQTFVSIIVMP 412

Query: 452 FGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499
           +G+ +      + +  ++PHEH     S+     +   ++G+ +   +
Sbjct: 413 WGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 460

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 108/514 (21%), Positives = 201/514 (39%), Gaps = 66/514 (12%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           I +FS F+  F   LD +I  T +T+  + +++    S ++   L+ S+  Q ++G LSD
Sbjct: 71  IFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVIVLMISAVSQVIFGGLSD 130

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  L + S  ++ +G +I   +  +    AG     +G  G+     +++SD   L+
Sbjct: 131 IFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGLVGVMLQVVLMLSDNSSLK 190

Query: 207 DRAVYQGLCNFVFGLGT-ASGGLVGAY--FRDWR-----LAFILQCPISVLSGILIVVYL 258
            R  Y  + ++   + T  SG +V A     +W       AFI   P+  +  IL ++++
Sbjct: 191 WRLFYTLIPSWPSIITTWVSGSVVEAANPLENWSWNIAMWAFIF--PLCCIPLILCMLHM 248

Query: 259 ELPPRASASNKDCWSAR---------------LRRLDWAGATSLIAFL--FLFMLTSSMG 301
               R     K+    +                 +LD  G     A +   L  LT + G
Sbjct: 249 RWKVRNDVEWKELQDEKSYYQTHGLVQMLVQLFWKLDVVGVLLFTAGVGCILVPLTLAGG 308

Query: 302 GSSVAYGSRLFAAMCAA-TLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS-SLANWFC 359
            S+    S++         LV G  F+Y E R+A  P  P   L+DR V     +  + C
Sbjct: 309 VSTNWRNSKIIGPFVLGFVLVPG--FIYWESRLALVPFAPFKLLKDRGVWAPLGIMFFIC 366

Query: 360 MMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRT--------- 410
            +  M   +   +   +V    ++      + SF +        GL + R+         
Sbjct: 367 FVYQMAAGYLYTILVVAVDESASSATRIINLYSFVTAVVAPF-LGLIVTRSSRLKSYIIF 425

Query: 411 -GKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAV 469
            G  Y+  +       +GQ     I   M +W         G    +    T++++ +  
Sbjct: 426 GGSLYFITMGLFYRYRSGQDADGGIIAGMVIW---------GLSSCLFDYPTIVSIQSVT 476

Query: 470 PHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGII 529
            HE+ A  T+++Y     G  +  ++  A++  SL      K++ +  D          +
Sbjct: 477 SHENMATVTALNYTVFRIGGAVAAAISGAIWTQSLY----PKLLHYMGDAD--------L 524

Query: 530 ASAARSSDWVHRSAPPF---VRATLLECYHFASR 560
           A+AA  S      + P+   VR+ ++E Y    +
Sbjct: 525 ATAAYGSPLTFILSNPWGTPVRSAMVEAYRHVQK 558

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 104/473 (21%), Positives = 185/473 (39%), Gaps = 39/473 (8%)

Query: 51  TTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMF-SMFLGIFLAA---LDGTIV 106
           +T SS++ +N   +A          +EF +   R   +++ S F+G+  +A       + 
Sbjct: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLG 61

Query: 107 STL--LTHIGSEFNSLD--KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFA 162
            +L  L  IG+ F + +  + SW A++Y L+  T   + G+L D  G K   V     +A
Sbjct: 62  QSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYA 121

Query: 163 IGCLICGL---SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVF 219
           +  L+ G    SN I+     R   G+G   L   A  I+        R   + +   +F
Sbjct: 122 LWSLLAGFSVYSNQIFFDCC-RAFQGMGPAFLLPNAIAILGRTYKPGRR---KNMVFSLF 177

Query: 220 GLGTASGGLVGAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNK 269
           G     G  +GA F         W  A+ +    C +  ++G  ++ +  +P R ++S K
Sbjct: 178 GASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFK 237

Query: 270 DCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYV 329
                 L R+D+AG+ + +  L LF    +  G  V + +    A+      F  +F Y+
Sbjct: 238 -----LLERIDFAGSVTGVVGLILFNFAWNQ-GPVVGWQTPYTYALLIVGTFFLVIFAYI 291

Query: 330 ELRVAADPVLPVTFLRDRS--VLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGK 387
           E R AA P+LP   L   +  VL    A W    S     FY   +     G        
Sbjct: 292 ESR-AAFPLLPFAALSSDTAFVLSCIAAGW---ASFGIWIFYTWQFMEDSRGQTPLLSSA 347

Query: 388 RAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQ 447
           +  P   S    ++  G  +  T      L A     + G + I         W Q  + 
Sbjct: 348 QFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTV-GTILIATAPVHQTYWAQTFVS 406

Query: 448 -VVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499
            +V  +G+ +      + +  ++PHEH     S+     +   ++G+ +   +
Sbjct: 407 IIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 459

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 79/164 (48%), Gaps = 5/164 (3%)

Query: 81  PSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQP 139
           P ++  ++M   F G F +++ G I   +LT I  +F+ + ++ +     Y +       
Sbjct: 71  PRAKFGLVMQCAFTG-FFSSIAGAIYYPVLTVIEKKFSITEEQVNITVVVYFIFQGLSPS 129

Query: 140 LYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIM 199
           L G L+D LGR+P++++S  ++   C+   LS +   ++  R +   G   + ++ + IM
Sbjct: 130 LMGGLADSLGRRPVVLWSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAINSGIM 189

Query: 200 SDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAF 240
            D+    +R  Y G       LG+A G L+GA      DWR  F
Sbjct: 190 GDVTTKAERGGYVGYVAGFQILGSALGALIGAALSSRWDWRAIF 233

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 95/224 (42%), Gaps = 16/224 (7%)

Query: 92  MFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLGR 150
           +FLG     L+   + +L+  +  +++ S   ASW  TSY ++ +      G+L D +G 
Sbjct: 34  IFLGCTFDLLNVASMISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGN 93

Query: 151 KPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAV 210
             L   S   FAI  L+C +  +  A    R I GI   GL   A  ++  L P  +   
Sbjct: 94  SILFTVSCFFFAILSLLCAVMPNFPAFAVFRAIQGISAAGLVPCAYALIPMLAPEEEVQK 153

Query: 211 YQGL--CNF--VFGLGTASGGLVGAYFRDWRLAFILQCPISVLSGILIVVY------LEL 260
           Y  +  C F    GLG   GG   A    ++  F L   +  L  I+   +      L  
Sbjct: 154 YFSIVSCGFSSTIGLGLIIGGAFAATKIGYKGIFYLTFAVMFLISIVAFFFTYGVENLSE 213

Query: 261 PPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSS 304
           PPR     KD  + R+R LD+ G+   +    L ++  + GG S
Sbjct: 214 PPR-----KDQATNRVRSLDFIGSLIFVTGSILIVVGLTEGGES 252

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 94/406 (23%), Positives = 160/406 (39%), Gaps = 36/406 (8%)

Query: 113 IGSEFNSLD--KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170
           IG  F + +  + SW A +Y L+  T   + G+L D  G K   +     +A+  L+ G 
Sbjct: 73  IGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGF 132

Query: 171 ---SNSIWAVVAGRFISGIGGCGLTSLATMIMS-DLVPLRDRAVYQGLCNFVFGLGTASG 226
              SN I+     R   GIG   L   A  I+    VP R +A+   L    FG    +G
Sbjct: 133 SVYSNQIFFDCC-RAFQGIGPALLLPNAIAILGRTYVPGRRKAMILSL----FGATAPAG 187

Query: 227 GLVGAYFRD-------WRLAFI---LQCPISVLSGILIVVYLELPPRASASNKDCWSARL 276
            ++GA F         W  A+    + C    ++GIL++      PR      D   +  
Sbjct: 188 FVLGAVFSSIFGQLTWWPWAYWAMGIVCFFLAVAGILVI------PRMPLPELDTSVSTY 241

Query: 277 RRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAAD 336
           +RLD  G+ + +  L L     +  G  V + +    ++   + VF  VF ++E R A  
Sbjct: 242 QRLDIPGSVTGVIGLVLLNFAWNQ-GPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-APH 299

Query: 337 PVLPVTFLRDRS--VLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFF 394
           P+LP++ L   +  VLG   A W    S     +Y  ++   + G        +  P   
Sbjct: 300 PLLPLSALSSDAAFVLGCVGAGW---SSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAI 356

Query: 395 SVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQ-VVPGFG 453
           S    +L  G  + R       L A     + G + I     +   W Q  +  +V  +G
Sbjct: 357 SGLCAALTTGFVITRVRASLVMLFAMTAFTVGG-ILIATAPVKQVYWAQAFVSIIVMPWG 415

Query: 454 VSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499
           + +      + +  ++PHEH     S+     +   ++G+ +   V
Sbjct: 416 MDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTV 461

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 88/186 (47%), Gaps = 8/186 (4%)

Query: 82  SSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATS-YLLSSSTCQPL 140
           + + L+I+   F G F +++ G I   +LT I  +FN  ++   I    Y +        
Sbjct: 97  TEKSLLIIQCAFTG-FFSSVAGAIYYPVLTVIEKKFNITEELVNITVVVYFIFQGLAPSF 155

Query: 141 YGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMS 200
            G L+D LGR+P+++FS  V+   C+   LS +   +V  R +   G   + ++ + I  
Sbjct: 156 MGGLADSLGRRPVVLFSILVYCCACIGLALSQNYTQIVVLRCLQAAGISPVIAINSGICG 215

Query: 201 DLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVY 257
           D+    +R  Y G  +    +G+A G L+GA       WR  F     +++ SGI +++ 
Sbjct: 216 DITTRAERGAYVGYVSGFIVIGSAFGALIGAGLSSTWGWRSIFWF---LTIGSGICLMIS 272

Query: 258 LELPPR 263
           + + P 
Sbjct: 273 IIVLPE 278

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 98/409 (23%), Positives = 158/409 (38%), Gaps = 41/409 (10%)

Query: 113 IGSEFNSLD--KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170
           IG  F + +  + SW A++Y L+  T   + G+L D  G K   V     +A+  L+ G 
Sbjct: 71  IGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130

Query: 171 ---SNSIWAVVAGRFISGIGGCGLTSLATMIMS-DLVPLRDRAVYQGLCNFVFGL--GTA 224
              SN I+     R   G+G   L   A  I+     P R +       N VF L   +A
Sbjct: 131 SVYSNQIFFDCC-RAFQGMGPAFLLPNAIAILGRTYKPGRRK-------NMVFSLFGASA 182

Query: 225 SGGLV-GAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNKDCWS 273
            GG V GA F         W  A+ L    C +  ++G  ++ +  +P R  AS K    
Sbjct: 183 PGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFK---- 238

Query: 274 ARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRV 333
             L R+D+AG+ + +  L LF    +  G  V + +    A+     VF  +F ++E R 
Sbjct: 239 -LLERIDFAGSVTGVVGLILFNFAWNQ-GPVVGWQTPYTYALLIVGTVFLIIFAFIESR- 295

Query: 334 AADPVLPVTFLRDRS--VLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMP 391
           AA P+LP   L   +  VL    A W    S     FY   +     G        +  P
Sbjct: 296 AAFPLLPFAALSSDTAFVLSCIAAGW---ASFGIWIFYTWQFMEDSRGQTPLLSSAQFSP 352

Query: 392 SFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQ-VVP 450
              S    +L  G  +  T        A     + G + I         W Q  +  +V 
Sbjct: 353 VAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTV-GTILIATAPVHQTYWAQTFVSIIVM 411

Query: 451 GFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499
            +G+ +      + +  ++PHEH     S+     +   ++G+ +   +
Sbjct: 412 PWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 460

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 107/525 (20%), Positives = 205/525 (39%), Gaps = 75/525 (14%)

Query: 10  LTPVDRDAMQDPSTDLPGFVANQIEQQDHLL---DIEQGRAYGSTTKSS-ISSENEREDA 65
           + PV  + +   S D P      ++ +D ++   + E      S+ KS+ +S+++  +D 
Sbjct: 1   MYPVIEEKVNVQSKDSPVIDKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDP 60

Query: 66  GGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSL-DKAS 124
                       ++    R L+ + +  L   L     T   T++  +   FNS  DK +
Sbjct: 61  -----------TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQA 109

Query: 125 WIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFIS 184
           W+  S+ L + +   + G+L D  G K +L+       +  LICGLS   ++     FI+
Sbjct: 110 WLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSK--YSNNDAFFIT 167

Query: 185 --GIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYF--------- 233
                G G+  +   +M             GL   V+ +G+    LV ++          
Sbjct: 168 CRAFQGLGIAFILPNVM-------------GLVGHVYKVGSTRKNLVISFIGACAPAGGM 214

Query: 234 --------------RDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRL 279
                           W   F        L+  +I+ +  +P     +N   +S     +
Sbjct: 215 FGGLFGGLIVNEDSEQWPWVFYAFAIAFFLN--MILAWYSIPNNI-PTNVHGFS-----M 266

Query: 280 DWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVL 339
           DW G+   +  L LF    +   ++  +G+    A+   ++ F   F   E++ A  P+L
Sbjct: 267 DWTGSVLAVIGLILFNFVWNQAPTA-GWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLL 325

Query: 340 PVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFG 399
           P    ++R ++   LA +    S     FY   Y S  L ++           F  V FG
Sbjct: 326 PHAVTKNRHMIMILLAVFLGWGSFGIWTFY---YMSFQLNLRHYSPVWTGGTYFVFVIFG 382

Query: 400 SLGA---GLYMKRTGKYYYFLLAFCVLAI-AGQVQIVLITPQMPVWR-QYLLQVVPGFGV 454
           ++ A    L +KR G    FLL F ++A   G +   ++  +   W+  + +Q +  FG+
Sbjct: 383 TIAAFMVALSIKRVGP--AFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGM 440

Query: 455 SVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499
            +    + + +   +P E+     S+     +  A+L + +GA V
Sbjct: 441 DLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATV 485

>CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103w ITR2 myo-inositol permease minor
          Length = 570

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 88/188 (46%), Gaps = 18/188 (9%)

Query: 30  ANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIM 89
           A +I  ++     +  + +  + +  I   N+ +D         G + F      I+++ 
Sbjct: 24  AKEISSENKSESYDDNKEFEGSNRVVIKPVNDEDDVSVMINFNQGVSHF------IIMLT 77

Query: 90  FSMFLGIFLAALDGTIVSTLLTHIGSEFNSLD------KASWIATSYLLSSSTCQPLYGK 143
           F   L  FL   D   +S+ L  IG++ ++ +      + +  ATS  L +     + G 
Sbjct: 78  FVASLSGFLFGYDTGYISSALISIGTDLDNKELTYGEKEITTAATS--LGALIFALVAGF 135

Query: 144 LSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIMSDL 202
             D  GRKP L+FSN +F IG ++   ++  W + AGRFI G  G G+ SL A + +S++
Sbjct: 136 SVDIFGRKPCLMFSNIMFLIGAILQVTAHKFWQMTAGRFIMGF-GVGIGSLIAPLYISEI 194

Query: 203 VP--LRDR 208
            P  +R R
Sbjct: 195 APKMIRGR 202

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 129/551 (23%), Positives = 221/551 (40%), Gaps = 84/551 (15%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           + FS+FL  +   LDG I  T   +  S ++     S +     + ++  Q  + +LSD 
Sbjct: 73  LFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GR  +LV S   +++G +I   + +I     G     +G  G+  +  +I SD   L  
Sbjct: 133 FGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNW 192

Query: 208 RAVYQGLCNFVFGLGT-ASGGLVGAYFRDWR-----LAFILQCPISVLSGILIVVYLELP 261
           R +   +    F + T  SG +  A   +W+      AFIL  P++ +   L ++++   
Sbjct: 193 RLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFIL--PLACIPLGLCMLHMRYL 250

Query: 262 PRASASNK-DCWSARLRRLDWAGATSLIAF-----LFLFMLTSSMGGSSVAY--GSRLFA 313
            R  A +K       L  LDW   +  I F     + L ++T+  G   V +     L  
Sbjct: 251 ARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGGLKE 310

Query: 314 AMCAATLVFGAVFVYV---------ELRVAADPVLPVTFLRDRSVLGSSLA------NWF 358
              AA ++   V  +V         E++ +  P+ P   ++DR VL +         NW+
Sbjct: 311 EWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALFIAFFINFNWY 370

Query: 359 CMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMK--RTGKYYYF 416
                M T   + V+ S     + T     A+ SF SV  G++   + +K  RT  +  F
Sbjct: 371 MQGDYMYTVLVVAVHESIKSATRIT-----ALYSFVSVIVGTILGFILIKVRRTKPFILF 425

Query: 417 -----LLAFCVL--------AIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLL 463
                +++F +L        A AG +  + +                GFG      VT  
Sbjct: 426 GISCWIVSFGLLVHYRGDSGAHAGIIGSLCLL---------------GFGAGSFTYVTQA 470

Query: 464 AMIA-AVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSE 522
           ++ A A  H   A  TS+  A  + G+  G SV  AV+    T++L  ++ +  SD    
Sbjct: 471 SIQASAGTHARMAIVTSLYLATYNIGSAFGSSVSGAVW----TNILPKEISKRISDPTLA 526

Query: 523 RELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMV----LAGVSCS 578
            E  G   +   +  W     P   R  L+  Y +  +     C+  +V    L G +C 
Sbjct: 527 AEAYGSPFTFITTYTW---GTPE--RIALVMSYRYVQKI---LCIIGLVFCFPLLGCAC- 577

Query: 579 IIKEHKLHTSI 589
           +++ HKL  SI
Sbjct: 578 MLRNHKLTDSI 588

>TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa]
           {ON} Anc_3.84 YDR497C
          Length = 638

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 87/197 (44%), Gaps = 22/197 (11%)

Query: 34  EQQDHLLDIEQGRAYGSTTKSSISSE-------NEREDAGGATVAGCGSAEFYLPSSRIL 86
           EQ      I+ G  Y +  K S+ S+       N+ +D           + F      I+
Sbjct: 85  EQHHRKSTIDNGFQYATDPKKSLESDRIMIKPINDEDDTSIMITFNQKISPF------II 138

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNS----LDKASWIATSYLLSSSTCQPLYG 142
           I+ F   +  F+   D   +S+ L  I  + ++      +  +I  +  L +       G
Sbjct: 139 ILTFVASISGFMFGYDTGYISSALLSINKDLDNKILTYGEKEYITAATSLGALITSIGAG 198

Query: 143 KLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIMSD 201
             +D  GRKP L+FSN +F +G ++   S++ W + AGR I G  G G+ SL + + +S+
Sbjct: 199 TAADVFGRKPCLMFSNVMFVVGAILQISSHTFWQMCAGRLIMGF-GVGIGSLISPLFISE 257

Query: 202 LVP--LRDR-AVYQGLC 215
           + P  +R R  V   LC
Sbjct: 258 IAPKMIRGRLTVINSLC 274

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 114/531 (21%), Positives = 210/531 (39%), Gaps = 87/531 (16%)

Query: 34  EQQDHLLDIEQG-RAYGSTTKSSIS----SENEREDA---------GGATVAGCGSAEFY 79
           E+   L D+E    A   T  +SIS      +E+ DA             + G    ++Y
Sbjct: 13  EKIHVLTDVEHELNAETHTGSNSISFGLPQLSEKYDALRQNRSLIIQQTEIFGAAYNKWY 72

Query: 80  LPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQP 139
           L     + ++ S F+  +   LDG I      +  S ++     S I     + S+  Q 
Sbjct: 73  LQ----VFLLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQI 128

Query: 140 LYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIM 199
           +Y +LSD  GR  L + +  ++ +G +I   +  +    AG      G  G+  +  +I+
Sbjct: 129 IYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIIL 188

Query: 200 SDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR---DWRL-----AFILQCPISVLSG 251
           SD   L+ R +YQ    + F + T   G + +      +W       AFI   P+S +  
Sbjct: 189 SDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIF--PLSCIPI 246

Query: 252 ILIVVYLE-----------LPPRASASNKDCWSARLRRLDWAGATSLIAFLF-------- 292
           +L +++++           L  + S   +  +   +++L W     +I  L         
Sbjct: 247 VLCMLHMQWRAKKTPEWHTLKGQKSYYQEHGFIKIIKQLFWM--LDIIGVLLMGCSLGCI 304

Query: 293 LFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS 352
           L  LT + G  +    SRL        ++   ++++ E R A DP+LP   ++DR+V  S
Sbjct: 305 LVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPVLWIW-EYRFARDPILPYKLVKDRAVWSS 363

Query: 353 S----LANWFCMM------SMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSV------ 396
                L ++   M      ++M       V  ++ +   ++ V   A P FF++      
Sbjct: 364 MGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRISTLSSFVSTVASP-FFALLVTRCT 422

Query: 397 ---AFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFG 453
               F   G  L+M   G  Y+F          G      I   + VW         G G
Sbjct: 423 RLKPFIMFGCSLWMVAMGLLYHFR--------GGSQSHSGIIGALGVW---------GVG 465

Query: 454 VSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSL 504
            ++      +++ +AV HE+ A  T+++Y     G+ +G +V  A++  +L
Sbjct: 466 TTLFTYPVTVSVQSAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTL 516

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 117/552 (21%), Positives = 215/552 (38%), Gaps = 62/552 (11%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           ++++ S F+  +   LDG I      +  S +      S +     + S+  Q +Y +LS
Sbjct: 71  VVLLVSAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLS 130

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
           D  GR  L V +  ++ +G +I   +  +    AG      G  G+  +  +I+SD   L
Sbjct: 131 DFFGRFILFVIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSL 190

Query: 206 RDRAVYQGLCNFVFGLGT--------ASGGLVGAYFRDWRLAFILQCPISVLSGILIVVY 257
           + R  YQ    + F + T        A+  LV   +     AFI   P+S +  +L +++
Sbjct: 191 KWRLFYQFAPTWPFIINTWISGNITLAANPLVHWSWDVGMWAFIF--PLSCIPMLLCMIH 248

Query: 258 LELPPR-----------ASASNKDCWSARLR----RLDWAGATSLIAFL--FLFMLTSSM 300
           ++                S   K      L+    RLD  G   ++A+L   L  LT + 
Sbjct: 249 MQWKASKTEEWKELKKEKSYYEKHGLLLTLKELFWRLDIIGVLLMVAWLGCILVPLTLAG 308

Query: 301 GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS-SLANWFC 359
           G  S     R+         V   +F   E   A DP++P   ++DR V  S  ++    
Sbjct: 309 GVKSKWNDGRIIGPFVLG-FVLVPIFAAWEYFFARDPLIPYALIKDRGVWASMGISFLID 367

Query: 360 MMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLA 419
            +  M +++   V   +V     +     ++ SF S       A L + R  +   F++ 
Sbjct: 368 FIFYMASDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPFFA-LLLTRCSRLKPFIMV 426

Query: 420 FCVLAI----------AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAV 469
            C L +           G+     I   + VW         G G ++      +++ +A 
Sbjct: 427 GCSLWMLSMGLLYHFRGGEQSHSGIIGALCVW---------GIGTTLFTYPVNVSVQSAT 477

Query: 470 PHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGII 529
            HE+ A  T+I+Y     G+ +G +V  A++   L   +  +V      G +E      I
Sbjct: 478 SHENMATVTAINYTCYRLGSAIGAAVSGAIWTQKLYPDILKRVTEVV--GATEAV---TI 532

Query: 530 ASAARSSDWVHRSAPPF---VRATLLECYHFASR----ATFKFCLTTMVLA-GVSCSIIK 581
           A+ A SS +   +   +   VR  ++E Y +  R        FC+  ++ +  +  + + 
Sbjct: 533 ATEAYSSPYTFITKYTWGTPVRDAVVESYRYIQRLETIVALVFCVPLIIFSLCLRDAKLT 592

Query: 582 EHKLHTSIKRGS 593
           +   H +IK G 
Sbjct: 593 DEIAHENIKEGE 604

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 128/604 (21%), Positives = 227/604 (37%), Gaps = 49/604 (8%)

Query: 19  QDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCG---- 74
           QD   +    V + I+ +D+   I            S +SE    +     V+  G    
Sbjct: 5   QDMYINSDEIVNDDIKLEDY--QIRNKILSDKDATESNASEEITTNKLKPAVSSTGVYNM 62

Query: 75  --SAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLL 132
              A++Y    +  +I FS+F+  +   LDG +  T  T   S FN     S +     +
Sbjct: 63  EIYAKYYANPFQKFLIYFSLFVIYYAYGLDGNVRPTYQTLATSSFNRHSLNSTVTCINRV 122

Query: 133 SSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLT 192
           +SS  Q  + + SD   R+  +V S   + +G +I   + S+     G  I GIG  G+ 
Sbjct: 123 TSSAGQIWFARASDIFSREFSMVISILFYVVGTIISSQATSVAKYAVGACIYGIGHAGIV 182

Query: 193 SLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWRLAFILQCPISVLSG 251
            L  + M+D   L  R V +        + T  SG +       W+    +   I   S 
Sbjct: 183 LLCEIYMADFSNLNWRVVAENAPMLPAIINTWVSGNITSDLGSKWQWGLGMWAIIFPASC 242

Query: 252 I-LIVVYLELPPRASASNKD-----------CWSARL-----RRLDWAGATSLIAF--LF 292
           I L V    +   A  +N+             W   L      +LD+ G   L+A   L 
Sbjct: 243 IPLFVCIYHMRYMAKKNNEKIRKIFEKPSEIAWKKYLIDIFIWKLDFIGLVLLVAVFALI 302

Query: 293 LFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS 352
           L   T+S G       +          +V   +F   E + +  P+L +  + DR +  +
Sbjct: 303 LVPFTTSGGLHREWNSANFIVPEVVGWVVALPIFSVWEWKFSRYPILRLDLISDRGIYSA 362

Query: 353 SLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKR--AMPSFFSVAFGSLGAGLYMKRT 410
              ++F    +   + YL  +    +  + T  G R  ++ SF +V   +   GL++ + 
Sbjct: 363 LSISFFIQFCLYVNDTYLYTFLLVAVD-QTTKSGTRINSLMSFVNV-ITACCLGLFIVKI 420

Query: 411 GKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQV--VPGFGVSVLITVTLLAMIAA 468
            +   F++  CV         V     +   R  ++    + GFG    I   L A + A
Sbjct: 421 RRTQIFIVIGCVSWFVVYGLYVHYNGGLGS-RSGIITASCLSGFGYG-FIKSPLKASLQA 478

Query: 469 VPHEHH--AATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFA-SDGHSEREL 525
             + H   A  T++  A  + G   G +V  A++ + L   L+  +     +D   +  +
Sbjct: 479 SSNSHQNLAIVTALFLAIGNIGTAFGAAVAGAIWSNLLPHRLEKSIGNVTLADSAFDSPI 538

Query: 526 RGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKL 585
           + I     +   W H +    VR  L+  Y    R     CL  ++   VS  ++++ KL
Sbjct: 539 KFI-----KQYKW-HTA----VRQHLVSSYGSVWRILNIVCLVLVIPMLVSSFLLRDRKL 588

Query: 586 HTSI 589
             S+
Sbjct: 589 SNSV 592

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 6/130 (4%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLD----KASWIATSYLLSSSTCQPL 140
           I+I+ F   +  F+   D   +ST L  IG++ +  +       +I  +  L +      
Sbjct: 119 IIILTFVTSISGFMFGYDTGYISTALISIGTDLDHKELTYGNKEFITAATSLGALISSIF 178

Query: 141 YGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIM 199
            G  +D  GRKP ++ SN +F IG +I   +++ W +V GRFI G  G G+ SL A + +
Sbjct: 179 AGISADIFGRKPCILLSNLMFLIGAIIQVTAHTFWQMVVGRFIMGF-GVGIGSLIAPLYI 237

Query: 200 SDLVPLRDRA 209
           S++ P   R 
Sbjct: 238 SEIAPKNIRG 247

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 128/321 (39%), Gaps = 55/321 (17%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           + +FS F+  F   LD  I S  +T+  +++ +    S ++   L  S+  Q  +  LSD
Sbjct: 73  LFLFSAFICAFSYGLDSIIRSVYMTYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSD 132

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  + + + A + +G +I   +  +    AG     IG  G     T+++SD   L+
Sbjct: 133 VFGRLSIFIVAIAFYVVGTIIQSQAYDVQRYAAGSIFYNIGLVGAMFQVTLMLSDSSSLK 192

Query: 207 DRAVYQGLCNFVFGLGTASGGLVGAYF-----------RDWR-----LAFILQCPISVLS 250
            R  Y    NFV     A   LV  +            ++W       AFI   P + L 
Sbjct: 193 WRLFY----NFV----PAWPALVTVWISGNVIHLANPKQNWSWGIAMWAFIF--PAACLP 242

Query: 251 GILIVVYLELPPRASASNKDCWSAR-----------LRRLDWAGATSLIAFLFLFMLTSS 299
            I  ++++    R     KD    +           L++L W     ++  L   + T  
Sbjct: 243 IIGCLLHMRWKLRNDPEWKDLQEEKTYFQTHGLVQTLKQLFW--KLDVVGVLLFSVSTGC 300

Query: 300 M-------GGSSVAYGSRLFAAMCAATLVFGAV----FVYVELRVAADPVLPVTFLRDRS 348
           +       GG+S  + S    A   A +V G+V    F+Y E ++A  P+ P   L+DR 
Sbjct: 301 ILIPLTVAGGASTHWRS----AKVIAPIVLGSVLVPAFIYWESKLALVPLAPFKMLKDRG 356

Query: 349 VLGSSLANWF-CMMSMMTTNF 368
           +    L  +  C + MM   +
Sbjct: 357 IWAPLLITFLICFIYMMAAGY 377

>ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 538

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 107/233 (45%), Gaps = 16/233 (6%)

Query: 41  DIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSR------ILIIMFSMFL 94
           D +    + S+ K S S +   + + G+       +E  +P SR      +L++      
Sbjct: 4   DTDTKVVFDSSQKDSNSLKTSDQKSDGSLAGKDNESE--IPYSRFKRRDKLLLVAQCAST 61

Query: 95  GIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPL 153
           G+F +++  +I   +LT +  +F+ + ++A+     Y +         G ++D LGR+P+
Sbjct: 62  GLF-SSIAASIYFPVLTTVERKFHITEEQANITVVVYYVFQGLSPSFMGNMADTLGRRPV 120

Query: 154 LVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQG 213
           ++ S  ++ + CL     N+   ++  R +   G   + ++ + +M+D+    +R  Y G
Sbjct: 121 ILVSVLIYFVACLGIASCNTYSQLIGLRCLQAAGISPVIAINSGMMTDITTRAERGGYVG 180

Query: 214 LCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPR 263
             +    LG+A G L+GA       WR  F     +S+ SGI +V+   L P 
Sbjct: 181 YTSGCQVLGSAFGALIGAGLSSRWGWRSVFWF---LSIGSGICLVISTLLLPE 230

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 103/438 (23%), Positives = 171/438 (39%), Gaps = 35/438 (7%)

Query: 92  MFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLGR 150
           +FLG     L+   + +L+  +  ++N S   ASW  TSY ++ +      G+L D +G 
Sbjct: 34  IFLGCTFDLLNVASMISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGN 93

Query: 151 KPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAV 210
             L   S + FAI  L+C +  +  A    R I GI   GL   A  ++  L P      
Sbjct: 94  SVLFTISCSCFAILSLLCAVMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQK 153

Query: 211 YQGL--CNF--VFGLGTASGGLVGAYFRDWRLAFILQCPI-SVLSGILIVVYLELPPRAS 265
           Y  +  C F    GLG   GG   A    +R  F L   + S++S I       +     
Sbjct: 154 YFSIVSCGFSSTIGLGLIIGGAFAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENFDK 213

Query: 266 ASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSS----VAYGSRL---------F 312
              K      ++ LD+ G+   +A   L ++  + GG S    V Y + +         F
Sbjct: 214 KPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNRPVTYVTLIIGILLFFGFF 273

Query: 313 AAMCA-ATLVFGAVFVYVELRVAADPV---LPVTFLRDRSVLGSSLA---NWFCMMSMMT 365
              C  A +V G  FV ++     + V   +PV  L  ++ +   LA   N  C+ S + 
Sbjct: 274 VWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFSCL- 332

Query: 366 TNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAI 425
             + +  Y            G + +P    +  G+        +        L F  LA+
Sbjct: 333 --YIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFS-LAL 389

Query: 426 AGQ---VQIVLITPQMPVWRQYL-LQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSIS 481
           AG    +Q+ LI   +  W+ +   Q + GFGV++     L   +   P +     + ++
Sbjct: 390 AGSIILIQLHLIKDNV-FWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVA 448

Query: 482 YAFRSTGATLGVSVGAAV 499
             F   G  +  SV A+V
Sbjct: 449 QTFGQLGIEITFSVMASV 466

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 107/490 (21%), Positives = 198/490 (40%), Gaps = 53/490 (10%)

Query: 60  NEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNS 119
             R+DAG   +     A+ Y      +++ FS+FL  +   LDG +      +  + + S
Sbjct: 20  QRRKDAGVNNIEV--YADQYSHIGYRILLFFSLFLVAYAYGLDGMVRYNFQAYATNSYGS 77

Query: 120 LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVA 179
               S +     + ++  Q  + + +D  GR  +++ S   + +G +I   + ++    A
Sbjct: 78  HSLLSTVNCIKAVIAAAGQLCFARAADIFGRISIIIVSILFYVVGTIIDSQATTVSKYAA 137

Query: 180 GRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWR- 237
           G  I  +G  G+  +  +I  D   L  R +   +    F + T  SG +V A   +W+ 
Sbjct: 138 GACIYQLGYTGIILILEIIAMDFSNLNWRLLASFVPAIPFIINTWISGDVVSAVGANWKW 197

Query: 238 ----LAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARL-RRLDWAGATSLIAFLF 292
                AFI   P+S L  +  + ++    R  AS++      L + + W  +T L    F
Sbjct: 198 GIGMWAFIF--PLSALPLLGCMFHMRYLARRRASDRLVTEVSLYKHMSW--STYLTEVFF 253

Query: 293 LFMLTSSMGGSSVAYGSRLFAAMCAATL-------------VFG-----AVFVYVELRVA 334
             +    +    V +G  L     A +L             V G      +F+  E++ A
Sbjct: 254 WRLDAVGLIMVCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLWEMKFA 313

Query: 335 ADPVLPVTFLRDRSVLGSSLAN------WFCMMSMMTTNFYLPVYWSSVLGMKATDVGKR 388
             P++P   ++DR +  + +        W+   S M T   + V  S     + T     
Sbjct: 314 KHPLVPWNVIKDRGIWSALIIAIHINFIWYMQGSFMYTVLIIAVNESVKSATRIT----- 368

Query: 389 AMPSFFSVAFGSLGAGL---YMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMP--VWRQ 443
           ++ SF SV  G LG G    Y+++T K+  F +   V++    +     +      +  Q
Sbjct: 369 SLYSFVSVLTG-LGLGFVIAYIRKTKKFIMFGIGCWVVSFGLLIHYRGDSSSHSGIIGAQ 427

Query: 444 YLLQVVPGFGVSVLITVTLLAMIA-AVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRS 502
            LL    GFG       T  ++ A A  H+  A  T++  +F + G+ LG SV  A++ +
Sbjct: 428 CLL----GFGAGFFTYTTQTSIQASAKTHQDMAVITALYLSFYNIGSALGSSVSGAIWTN 483

Query: 503 SLTSLLDAKV 512
            L   L  ++
Sbjct: 484 ILPRELRKRI 493

>TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.242
           YNL065W
          Length = 550

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/257 (21%), Positives = 112/257 (43%), Gaps = 12/257 (4%)

Query: 13  VDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAG 72
           +D D     + +   F  + IE      D E+G  + +T     +    R++        
Sbjct: 32  LDFDESDQVTYNPVSFEKDSIEIPTDDDDDEEGNHHDTTNGMYKTKSQNRDEPD----ID 87

Query: 73  CGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATS-YL 131
                ++    +  +++   F G+ L++L G+I   +L+ +  +F+  ++   I+   Y 
Sbjct: 88  SPPYSWFDKKEKAFLVVQCAFTGL-LSSLAGSIYYPVLSVLEVKFHITEEQINISVVVYY 146

Query: 132 LSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGL 191
           +  +    L G L+D LGR+P+++ S  ++   C+     N+   ++  R +   G   +
Sbjct: 147 VFQAVSPTLMGGLADSLGRRPVIITSVFLYFCACIGLACCNNYSQLIGLRCLQATGISPV 206

Query: 192 TSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISV 248
            ++ + +M D+    +R  Y GL +    LGTA G L+GA       WR  F     + +
Sbjct: 207 IAVNSGLMGDVTTKAERGGYMGLVSGTQVLGTAFGALIGAALFSRWGWRSIFWF---LVI 263

Query: 249 LSGILIVVYLELPPRAS 265
            SG+ +V+ L + P   
Sbjct: 264 GSGVCLVLSLFILPETK 280

>CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180w DTR1
          Length = 542

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 86/193 (44%), Gaps = 14/193 (7%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLY-GKL 144
           LI++++ FLG     L G +    L  +  EFN  +       S  +++ +  PL+ G L
Sbjct: 83  LIVIYNGFLG----PLAGNVFIPALPLLQKEFNVSETTINATVSVFMATFSISPLFWGAL 138

Query: 145 SDRLGRKPLLVFSNAVFAI-GCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV 203
           +D+ GRK L + S ++  I   L+  +   I +++  R I       + SL    ++DL 
Sbjct: 139 ADKGGRKILYIISISLMVIINILLASVPKKIGSLIFLRIIQAFASSSVISLGAGTVADLT 198

Query: 204 PLRDRAVYQGLCNFVFG------LGTASGGLVGAYFRDWRLAFILQCPISVLSGILIVVY 257
           P +DR   + +  F+ G      L     GL+     +WR  F   C +S L  I++++ 
Sbjct: 199 PPKDRG--KAMAYFMLGPNLGPILAPIIAGLILLDNNNWRWLFGFLCIVSGLGLIMVILL 256

Query: 258 LELPPRASASNKD 270
           L    R    N D
Sbjct: 257 LPETLRCIVGNGD 269

>NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa]
           {ON} 
          Length = 587

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 96/210 (45%), Gaps = 15/210 (7%)

Query: 57  SSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSE 116
            S N+  D   A  +  G      P  ++++++   F G F +++  +I   +LT I   
Sbjct: 72  KSTNDEPDVTTAPYSRFG------PREKMILVVQCAFTG-FFSSIASSIYYPVLTVIEKL 124

Query: 117 FN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIW 175
           F+ S +  +     Y +       + G L+D LGR+P+++FS AV+   C+    + +  
Sbjct: 125 FDISEESVNITVVVYFIFQGLSPSIMGGLADSLGRRPVVLFSVAVYFCACVGLACAQTYP 184

Query: 176 AVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR- 234
            ++  R +   G   + ++ + IM D+    +R  Y G  +    LG + G L+GA    
Sbjct: 185 QIIVLRCLQAAGISPVIAINSGIMGDVTTRAERGGYVGYVSGFQVLGNSFGALIGAGISS 244

Query: 235 --DWRLAFILQCPISVLSGI-LIVVYLELP 261
              WR  F     +++ SGI L+  ++ LP
Sbjct: 245 TWSWRAIFWF---LAIGSGICLLASFIVLP 271

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 109/493 (22%), Positives = 201/493 (40%), Gaps = 51/493 (10%)

Query: 61  EREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSL 120
            R+DAG   +    +A++   + R+  + FS+FL  +   LDG + S+L  +  S + S 
Sbjct: 41  RRKDAGVNNIE-VYAAQYSHFAYRV-ALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSH 98

Query: 121 DKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAG 180
              + I     + ++  Q  + + SD  GR  +L  +  ++A+G +I   + +I    AG
Sbjct: 99  SLLATINCVKAVIAAAGQICFARASDIFGRMTILALAVVLYAVGTIIDSQATNITRYAAG 158

Query: 181 RFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWRLA 239
             I  +G  G+  +  +I  D   L  R +   +    F + T  SG  + A   +W+  
Sbjct: 159 ACIYQLGYTGIILILEIIAMDFSNLNWRLMASFVPALPFIINTWISGNALEALGMNWKWG 218

Query: 240 FILQCPISVLSGI-LIVVYLELPPRASASNKDCWSARL---RRLDWAGATSLIAFLFLFM 295
             +   I  LS + L    L +   A  + KD   + +   + + W  +  L+   F  +
Sbjct: 219 IGMWAFIVPLSCVPLFACILHMRFLAHKNAKDQLESEVLLYKHMPW--SQYLVEVFFWRL 276

Query: 296 LTSSMGGSSVAYGSRLFAAMCAATL-------------VFG-----AVFVYVELRVAADP 337
               +    V +G  L     A +L             V G      +F+  E + +  P
Sbjct: 277 DLLGLLLVCVVFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHP 336

Query: 338 VLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPV---YWSSVLGMKATDVGKRA----- 389
           ++P + ++DR +       W  ++  +  NF   +   Y  +VL +   +  K A     
Sbjct: 337 LVPWSLVKDRGI-------WSALIIAIHINFVWYMQGDYMYTVLMVAVNETAKSAARITS 389

Query: 390 MPSFFSVAFGSL--GAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMP--VWRQYL 445
           + SF SV  G L  G  +Y +RT K+  F +A   +A    V     +      V    L
Sbjct: 390 LYSFVSVITGFLLGGVIVYARRTKKFILFGIACWFVAFGLLVHYRGDSSSHSGIVGSLCL 449

Query: 446 LQVVPGFGVSVLITVTLLAMIAAVP-HEHHAATTSISYAFRSTGATLGVSVGAAVFRSSL 504
           L    GFG       T  ++ A+   H+  A  T++  +  + G+ LG S+  A++ + L
Sbjct: 450 L----GFGAGFFTYTTQTSIQASTKSHQDMAVITALYLSHYNIGSALGASISGAIWTNIL 505

Query: 505 TSLLDAKVMRFAS 517
              L  ++   A+
Sbjct: 506 PRELRKRITDVAT 518

>NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa]
           {ON} Anc_3.84
          Length = 602

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 90/203 (44%), Gaps = 20/203 (9%)

Query: 19  QDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENER------EDAGGATVAG 72
           Q P+TD   F+    EQ++    ++  +   S    + S  ++R       D    +V  
Sbjct: 32  QRPTTDYEEFLN---EQEESTKKMKNKQTTTSFDYENASDNDDRIQIKPVNDEDNTSVII 88

Query: 73  CGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN----SLDKASWIAT 128
             + +    S  I+ + F   +  F+   D   +S+ L  IG++ +    S      +  
Sbjct: 89  TFNQKI---SPFIITLTFVASISGFMFGYDTGYISSALISIGTDLDNKVLSYGDKEIVTA 145

Query: 129 SYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGG 188
           +  L +       G  +D  GRKP L+FSN +F IG ++   ++  W + AGR I G  G
Sbjct: 146 ATSLGALISSIFAGTAADVFGRKPCLMFSNVMFIIGAILQISAHKFWQMAAGRLIMGF-G 204

Query: 189 CGLTSL-ATMIMSDLVP--LRDR 208
            G+ SL + + +S++ P  +R R
Sbjct: 205 VGIGSLISPLFISEIAPKMIRGR 227

>TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.84
           YDR497C
          Length = 634

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 64/130 (49%), Gaps = 6/130 (4%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNS----LDKASWIATSYLLSSSTCQPL 140
           I+I+ F   +  FL   D   +S+ L  IG++ ++         +I  +  L +      
Sbjct: 133 IVILTFVASISGFLFGYDTGYISSALISIGNDLDNRPLTYGDKEFITAATSLGALISSIF 192

Query: 141 YGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIM 199
            G  +D  GRKP L+FSN +F +G ++   ++  W + AGR + G  G G+ SL A + +
Sbjct: 193 AGTAADVFGRKPCLMFSNLMFVVGAIVQITAHKFWQMTAGRLVMGF-GVGIGSLIAPLYI 251

Query: 200 SDLVPLRDRA 209
            ++ P + R 
Sbjct: 252 GEIAPRKIRG 261

>KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively
          Length = 569

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 67/131 (51%), Gaps = 10/131 (7%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTC------Q 138
           ILI+ F+  +  F+   D   +S+ L  IG++ +  +KA       +++++T        
Sbjct: 61  ILILTFTASISGFMFGYDTGYISSALVSIGTDLD--NKALTYGDKEIITAATSLGALISA 118

Query: 139 PLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIG-GCGLTSLATM 197
              G  +D  GRKP L+FSN +F IG  +   ++S W +  GR I G G G G + LA +
Sbjct: 119 VFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFWQMAVGRLIMGFGVGIG-SLLAPL 177

Query: 198 IMSDLVPLRDR 208
            +S++ P   R
Sbjct: 178 FISEIAPKHIR 188

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 90/186 (48%), Gaps = 8/186 (4%)

Query: 82  SSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATS-YLLSSSTCQPL 140
           + ++++++   F G F +++ G I   +L+ I +EFN  ++   I    Y +       +
Sbjct: 75  TEKMILVIQCAFTG-FFSSIAGAIYYPVLSVIENEFNITEEMVNITVVVYFIFQGIAPSI 133

Query: 141 YGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMS 200
            G L+D +GR+P+++ S  V+   C+    S++   ++  R +   G   + ++ + IM 
Sbjct: 134 MGGLADSMGRRPVVLSSVLVYCCACIGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMG 193

Query: 201 DLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGILIVVY 257
           D+    +R  Y G  +    +G+A G L+GA       WR  F     +++ SG+ +V  
Sbjct: 194 DITTRAERGGYVGYVSGFQVIGSAFGALIGAGLSATWSWRSIFWF---LAIGSGVCLVAS 250

Query: 258 LELPPR 263
           + + P 
Sbjct: 251 IIILPE 256

>KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 90/185 (48%), Gaps = 8/185 (4%)

Query: 83  SRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLY 141
           S++ +++   F G F +++ G I   +L+ I ++F+ + ++ +     Y +       L 
Sbjct: 78  SKLGLVVQCAFTG-FFSSIAGAIYYPVLSVIENKFHINEEQVNMTVVVYFIFQGLSPTLM 136

Query: 142 GKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSD 201
           G L+D LGR+P+++ S  ++   C+    SN+   V+A R +   G   + ++ + +M D
Sbjct: 137 GGLADSLGRRPVILCSVIIYFCACIGLACSNNYAQVIALRCLQAAGISPVIAINSGMMGD 196

Query: 202 LVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYL 258
           +    +R  Y G  +    +GTA+G + GA       WR  F     +++ SG   +V L
Sbjct: 197 VTTKAERGGYVGYVSGFQVVGTATGAVFGALLSSRWGWRSIFWF---LAIGSGACSIVSL 253

Query: 259 ELPPR 263
            L P 
Sbjct: 254 LLLPE 258

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 99/216 (45%), Gaps = 14/216 (6%)

Query: 58  SENEREDAGGATVAGCGSAEFYLPSSR------ILIIMFSMFLGIFLAALDGTIVSTLLT 111
           S+N+ E +   +     S    +P SR      +L+++   F G F + + G+I   +LT
Sbjct: 36  SDNDAERSNSHSEIDNESNFDMVPYSRFSHKQKMLLVVQCAFTG-FFSTVAGSIYYPVLT 94

Query: 112 HIGSEFNSLDK-ASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170
            I  +FN  ++ A+     Y +       + G L+D  GR+P+++++   +   C+    
Sbjct: 95  IIERKFNITEELANVTIVVYFIFQGVAPSIMGGLADTFGRRPIVLWAILAYFCACIGLAC 154

Query: 171 SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVG 230
           +++   ++A R +   G   + ++ + IM D+    +R  Y GL      +GTA G L+G
Sbjct: 155 AHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVERGGYVGLVAGFQVVGTAFGALIG 214

Query: 231 AYFRD---WRLAFILQCPISVLSGILIVVYLELPPR 263
           A       WR  F     +++ SGI +V    L P 
Sbjct: 215 AGLSSKWGWRAIFWF---LAIGSGICLVFSTLLMPE 247

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 89/406 (21%), Positives = 162/406 (39%), Gaps = 48/406 (11%)

Query: 134 SSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTS 193
           S   Q ++ +LSD  GR  L +    ++ +G +I   +  I     G      G  G++ 
Sbjct: 126 SIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQCEARDIRTYAVGAAFYNSGYVGVSI 185

Query: 194 LATMIMSDLVPLRDRAVYQGLCNF-VFGLGTASGGLVGAYF--RDWRL-----AFILQCP 245
           L  +++SDL P + R ++Q   ++    +   SG +V +    ++WR      AF+   P
Sbjct: 186 LLIIVLSDLSPSKWRLLFQFATSWPCIIICWISGDIVQSANPAKNWRFDIGMWAFLF--P 243

Query: 246 ISVLSGILIVVYLELPPRASASNK----DCWSARLRRLDWAGA---------TSLIAFLF 292
           IS L  I+ ++Y       +A  K    D     +R + W  +         TSL+    
Sbjct: 244 ISALPFIIFLLYFTRQASKTAEWKEIQGDNKEPSVRIVYWIKSIYSNIDVVGTSLVTVSL 303

Query: 293 --LFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVL 350
             + +  +  GG S  +      A      V    F+  +++ A + VLP   L+DR V 
Sbjct: 304 GCILVPLTLAGGISDDWNKPGIIATIVVGFVSFMFFLAWDIKFAKNAVLPFKLLKDRGVW 363

Query: 351 GSSLANWFCMMSMMTTNFYL-PVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKR 409
            S  A     +   T + YL PV   SV     +      +P+F +   GS+  GL + R
Sbjct: 364 ASLAAALLEKLIYATISDYLYPVLLVSVNESSKSATRILWLPTFVACT-GSIFFGLLVVR 422

Query: 410 TGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYL-----------LQVVPGFGVSVLI 458
           T +          L I   + + L    + ++  Y              VV G G ++  
Sbjct: 423 TKR----------LKIYSIIGVCLWILSIGLFYHYRGGASSHSGIIGASVVLGTGSAIFT 472

Query: 459 TVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSL 504
              ++ +     H++ A+ T + + F   G+  G S+  A++  ++
Sbjct: 473 QSLIVNLQTMTSHKNMASITGLYFMFAQIGSASGASISGAIWTQTM 518

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 113/265 (42%), Gaps = 15/265 (5%)

Query: 3   QSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENER 62
           QS HS  ++  D+ +      D P       E  D ++   +  A       + S++ E 
Sbjct: 6   QSLHS-FISDYDQRSHAVEKYDGPDLSEVDSEDNDKMIKTNEDEAVKEPIYRTRSNQTEP 64

Query: 63  EDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDK 122
           +      +A       +    ++ +++   + G+F + + G I   +L+ I  +F+  ++
Sbjct: 65  D------IANAPPYSRFDAKYKMALVLQCAYTGLF-STMAGAIYYPVLSVIEKQFHITEE 117

Query: 123 ASWIATS-YLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGR 181
              I    Y +       L G L+D LGR+P+++F+  V+   C+    + +   +V  R
Sbjct: 118 LVNITVVVYFIFQGIAPTLMGGLADSLGRRPVVLFAVTVYFGACIGLACAQTYAQIVVLR 177

Query: 182 FISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRL 238
            +   G   + ++ + I+ D+    +R  Y G  +    LG+A G L+GA       WR 
Sbjct: 178 CLQAAGISPVIAINSGIIGDVTTRAERGGYVGYISGFQVLGSAFGALIGAGLSSRWGWRS 237

Query: 239 AFILQCPISVLSGILIVVYLELPPR 263
            F     +++ SG+ +V  + + P 
Sbjct: 238 IFWF---LAIGSGVCLVFSIIMLPE 259

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 90/219 (41%), Gaps = 6/219 (2%)

Query: 92  MFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLGR 150
           +FLG     L+   + +L+  +   +N S   ASW  TSY ++ +      G+L D +G 
Sbjct: 34  IFLGCTFDLLNVASMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGN 93

Query: 151 KPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAV 210
             L   S + FA+  L+C +  +  A    R I GI   GL   A  ++  L P      
Sbjct: 94  SVLFTISCSCFAVLSLLCAVMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQK 153

Query: 211 YQGL--CNF--VFGLGTASGGLVGAYFRDWRLAFILQCPISVLSGILIVVY-LELPPRAS 265
           Y  +  C F    GLG   GG        +R  F L   +  L  I+   +   +     
Sbjct: 154 YFSIVSCGFSSTIGLGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLNK 213

Query: 266 ASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSS 304
              KD  S  ++ LD+ G+   +A   L ++  + GG S
Sbjct: 214 KPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGGES 252

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 74/162 (45%), Gaps = 5/162 (3%)

Query: 83  SRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLY 141
            + L+++   F G F + +   I   +LT I   F+ S +K +     Y +       L 
Sbjct: 68  EKFLLVVQCAFTG-FFSTIAAAIYYPVLTVIEDLFDISEEKVNITVVVYFIFQGISPTLM 126

Query: 142 GKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSD 201
           G L+D LGR+P+++ S  V+   C+    S S   ++A R +   G   + ++ + IM D
Sbjct: 127 GGLADYLGRRPIVILSVLVYFSACVGLACSQSYAQIIALRCLQAAGISPVIAINSGIMGD 186

Query: 202 LVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAF 240
           +    +R  Y G  +    +G+A G L+GA       WR  F
Sbjct: 187 VTTRAERGGYVGYVSGCQVVGSAFGALIGAGLSSRWGWRSIF 228

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 129/316 (40%), Gaps = 45/316 (14%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           + +FS F+  F   LD  I S  +T+  +++ +    S ++   L  S+  Q  +  LSD
Sbjct: 73  MFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSD 132

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  + + +   + +G +I   +  +    AG     IG  G     T+++SD   L+
Sbjct: 133 VFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGLVGSMFQVTLMLSDCSSLK 192

Query: 207 DRAVYQGLCNFVFGLGTASGGLVGAYF-----------RDWR-----LAFILQCPISVLS 250
            R +Y    NFV     A   LV  +            ++W       AFI   P + L 
Sbjct: 193 WRLLY----NFV----PAWPALVTVWISGNVVHVANPEKNWSWGIAMWAFIF--PATCLP 242

Query: 251 GILIVVYLELPPRASASNKDCWSAR-----------LRRLDWA-GATSLIAF-----LFL 293
            I  ++++    R ++  K+    +           L++L W      ++ F       L
Sbjct: 243 IIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLFSVSTGCIL 302

Query: 294 FMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSS 353
             LT + G S+    +++ A +   +L+    F+Y E ++A  P+ P   L+DR +    
Sbjct: 303 IPLTIAGGASTHWRSAKVIAPLVLGSLLV-PFFIYWESKLALVPLAPFKMLKDRGIWAPL 361

Query: 354 LANWF-CMMSMMTTNF 368
           L  +  C + MM   +
Sbjct: 362 LITFLICFIYMMAAGY 377

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 129/316 (40%), Gaps = 45/316 (14%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           + +FS F+  F   LD  I S  +T+  +++ +    S ++   L  S+  Q  +  LSD
Sbjct: 73  MFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSD 132

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  + + +   + +G +I   +  +    AG     IG  G     T+++SD   L+
Sbjct: 133 VFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGLVGSMFQVTLMLSDCSSLK 192

Query: 207 DRAVYQGLCNFVFGLGTASGGLVGAYF-----------RDWR-----LAFILQCPISVLS 250
            R +Y    NFV     A   LV  +            ++W       AFI   P + L 
Sbjct: 193 WRLLY----NFV----PAWPALVTVWISGNVVHVANPEKNWSWGIAMWAFIF--PATCLP 242

Query: 251 GILIVVYLELPPRASASNKDCWSAR-----------LRRLDWA-GATSLIAF-----LFL 293
            I  ++++    R ++  K+    +           L++L W      ++ F       L
Sbjct: 243 IIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLFSVSTGCIL 302

Query: 294 FMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSS 353
             LT + G S+    +++ A +   +L+    F+Y E ++A  P+ P   L+DR +    
Sbjct: 303 IPLTIAGGASTHWRSAKVIAPLVLGSLLV-PFFIYWESKLALVPLAPFKMLKDRGIWAPL 361

Query: 354 LANWF-CMMSMMTTNF 368
           L  +  C + MM   +
Sbjct: 362 LITFLICFIYMMAAGY 377

>SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {ON}
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1
          Length = 578

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 81/183 (44%), Gaps = 15/183 (8%)

Query: 41  DIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAA 100
           D    R  GS  +  I   N+ +D           + F      I+I+ F   +  F+  
Sbjct: 30  DEHHKRVSGSQDRILIKPVNDEDDTSVMITFNQKVSPF------IIILTFVASISGFMFG 83

Query: 101 LDGTIVSTLLTHIGSEFNS----LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVF 156
            D   +S+ L  IG++ ++      +   I  +  L +       G  +D  GRKP ++F
Sbjct: 84  YDTGYISSALVSIGTDLDNKTLTYGEKEIITAATSLGALITAVFAGVSADLFGRKPCIMF 143

Query: 157 SNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIMSDLVP--LRDR-AVYQ 212
           SN +F IG ++   +++ W +  GR + G  G G+ SL + + +S++ P  +R R  V  
Sbjct: 144 SNLLFVIGAILQVSAHTFWQMAIGRLVMGF-GVGIGSLISPLFISEIAPKMIRGRLTVVN 202

Query: 213 GLC 215
            LC
Sbjct: 203 SLC 205

>NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84
          Length = 607

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 86/209 (41%), Gaps = 18/209 (8%)

Query: 2   VQSEHSPLLTPVDRDAMQDPSTDLPGFVANQ-IEQQDHLLDIEQGRAYGSTTKSSISSEN 60
           V S+  P     D  +    +  + G  + Q I   DH  D E         +  I   N
Sbjct: 37  VDSKRFPYEITKDTSSSTQSNLIVEGTQSRQDINSFDHETDDEN-----ENDRIVIKPVN 91

Query: 61  EREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-- 118
           + +D         G + F      I+ + F   +  F+   D   +S+ L  IG++ +  
Sbjct: 92  DEDDTSVIITFNQGISAF------IITLTFVASISGFMFGYDTGYISSALVSIGTDLDNK 145

Query: 119 --SLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWA 176
             S      I  +  L +     + G  +D  GR+P L+FSN +F IG ++   ++  W 
Sbjct: 146 VLSYGDKEIITAATSLGALITSTMAGTAADIFGRRPCLMFSNVMFVIGAILQITAHKFWQ 205

Query: 177 VVAGRFISGIGGCGLTSL-ATMIMSDLVP 204
           +  GR I G  G G+ SL + + +S++ P
Sbjct: 206 MAVGRLIMGF-GVGIGSLISPLFISEIAP 233

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 72/138 (52%), Gaps = 14/138 (10%)

Query: 82  SSRILIIMFSMF--LGIFLAALDGTIVSTLLT--HIGSEFNSLDKA------SWIATSYL 131
           + R L+   S+F  LG+FL   D  ++S  LT  +  + FN+  +A      S +    L
Sbjct: 100 TGRPLLYFTSIFVSLGVFLFGYDQGVMSGCLTGHYFKNHFNNPSRAAIGNMVSILEIGAL 159

Query: 132 LSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGL 191
           +SS     L G+L ++ GR+  + + + +F IG L  G ++ +  ++ GR ISG+G   L
Sbjct: 160 VSSL----LVGRLGEKWGRRRTIKYGSLIFVIGGLFQGFADKMMHLIIGRTISGLGVGLL 215

Query: 192 TSLATMIMSDLVPLRDRA 209
           +++  +  S++ P  +R 
Sbjct: 216 STIVPIYQSEISPPHNRG 233

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 113/291 (38%), Gaps = 34/291 (11%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           + +F++F+  F   LD  I    +T+  + + +    S +    ++ S+  Q  + +LSD
Sbjct: 71  LFLFTVFICSFAYGLDSIIRDIYMTYAMNAYETHSLLSTVNVISMVISAVGQIFFARLSD 130

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  L + S  ++ +G +I   +  +    AG     +G  G     T+I+SD   L+
Sbjct: 131 VFGRLSLFIVSIVLYVVGTVIQSQAYDVQRYAAGSVFYNVGLVGAMFQVTLILSDCSTLK 190

Query: 207 DRAVYQGLCNFVFGLGT-----ASGGL--VGAYFRDWR-----LAFILQCPISVLSGILI 254
            R  Y    NFV           SG +  V     +W       AFI   P+S +  I  
Sbjct: 191 WRLFY----NFVPAWPAIITVWISGNVVHVANPLENWSWGIAMWAFIF--PVSCIPFIAC 244

Query: 255 VVYLELPPRASASNKDCWSAR---------------LRRLDWAGATSLIAFLFLFMLTSS 299
           ++++    R S   ++    +                 RLD  G   L  F     +  +
Sbjct: 245 ILHMRWKVRNSHEWRELQEEKSFYQTHGLVQTFVQLFWRLDVVGVILLSVFTGCICVPLT 304

Query: 300 M-GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSV 349
           + GG S  + S    A           FVY E R+A  P+ P   L+DR +
Sbjct: 305 VAGGVSTEWRSGKVIAPFVLGFSLIPAFVYWESRLARFPLAPFLMLKDRGI 355

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 89/186 (47%), Gaps = 8/186 (4%)

Query: 82  SSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPL 140
             +I +++   F G+F +++ G+I   +L+ +  EF  + ++ +     Y +  +    L
Sbjct: 96  KEKIFLVIQCAFTGLF-SSIAGSIYYPVLSVMEKEFYITEEQVNVSVVVYFIFQALSPTL 154

Query: 141 YGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMS 200
            G L+D LGR+P+++ S  ++   C+      +   ++  R +   G   + ++ + IM 
Sbjct: 155 MGGLADSLGRRPVVLSSIVLYFCACIGLARCTNYSQLIGLRCLQAAGISPVIAVNSGIMG 214

Query: 201 DLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGILIVVY 257
           D+    +R  Y GL +    LGTA G L+GA       WR  F     + + SGI ++V 
Sbjct: 215 DVTTKAERGGYMGLVSGTQVLGTAFGALIGAGLSSRWSWRSIFWF---LVIGSGICLIVS 271

Query: 258 LELPPR 263
           + + P 
Sbjct: 272 IIVLPE 277

>NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 107/244 (43%), Gaps = 20/244 (8%)

Query: 28  FVANQIEQQDHL-----LDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPS 82
           ++  Q EQ   L     + I +  A     K+  + ++E         +  GS+E     
Sbjct: 25  YIDAQSEQSSILSYNKPVHIHETSATADLCKTQSNKKDEPNLDNAVPYSRFGSSE----- 79

Query: 83  SRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLY 141
            + ++++   F G F + + G I   +L+ I   F+ S +  +     Y +       + 
Sbjct: 80  -KTILVLQCAFTG-FFSTIAGAIYYPVLSEIEEIFHISEESVNITVVVYFIFQGISPSIM 137

Query: 142 GKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSD 201
           G L+D +GR+P+++ S AV+   C+      +   +V  R +   G   + ++ + IM D
Sbjct: 138 GGLADTMGRRPIVLCSIAVYFCACIGLACCQTYPQIVVLRCLQAAGISPVIAINSGIMGD 197

Query: 202 LVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGI-LIVVY 257
           +    +R  + G  +    +G+A G L+GA       WR  F     +++ SGI LI+ +
Sbjct: 198 ITTRAERGGFVGYVSGFQVMGSAFGALIGAGISSTWSWRAIFWF---LAIGSGICLIISF 254

Query: 258 LELP 261
           + LP
Sbjct: 255 IILP 258

>ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conserved
           hypothetical protein
          Length = 682

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 130/300 (43%), Gaps = 53/300 (17%)

Query: 1   MVQSEHSPLLTPVDRDAMQDPSTDLPGFVAN--QIEQQDHLLDIEQGRAYGSTTKSSISS 58
           MVQ+ ++     +D D  ++P  D P    +  Q E+ D +L      ++G    +SI +
Sbjct: 1   MVQANYN-----LDEDGGENPFAD-PNLREDNHQEEEIDDILTPSPTTSHGFGLHTSIPT 54

Query: 59  ENEREDA--GGATVAGCGSAEFY---------LP--------------SSRILIIMFSMF 93
           + +  D   G    +G   A  Y         +P              + R L+   S+F
Sbjct: 55  DEDLTDVMVGDRRSSGSPKAVEYDGETLQQQIIPPGYNEHMMVKDSFLTGRALLYFTSVF 114

Query: 94  --LGIFLAALDGTIVSTLLT--HIGSEFNSLDKAS-WIATSYLLSSSTCQPLY-GKLSDR 147
             +G+FL   D  ++S  LT  +    F+   +A+  I  S L   +    L   +L ++
Sbjct: 115 VSIGVFLFGYDQGVMSGCLTGKYFKRHFHDPSRAAIGIMVSILEIGALVSSLVTSRLGEK 174

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
           LGR+  + + + VF IG L    +  I  ++AGR ISG+G   L+++  +  S++ P  +
Sbjct: 175 LGRRRTIKYGSLVFIIGGLFQAFAGGIGYLIAGRLISGVGVGLLSTIVPIYQSEISPPHN 234

Query: 208 R---AVYQGLCNFVFGLGTASGGLVG---AYFRD---WRLAFILQCPIS--VLSGILIVV 256
           R   A  +   N V   G A+   +    +YF +   WRL   +Q  I   + SG  ++V
Sbjct: 235 RGKLACIEFTGNIV---GYATSVWIDYACSYFENNAAWRLPLFIQSVIGFMLFSGSFVIV 291

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 129/605 (21%), Positives = 232/605 (38%), Gaps = 94/605 (15%)

Query: 6   HSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYG------STTKSSISSE 59
           H+  +  ++ D ++D         A +I + D   D ++G  +         TKS +  +
Sbjct: 2   HNNPVLKMENDQIEDGVGHRKEGAAEKINEMDE--DSKKGVQFSGVCDGMKQTKSLVIRK 59

Query: 60  NEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNS 119
            E             ++++    S++L +  + FL  +  +LD +I    +T+  + +N+
Sbjct: 60  TE-----------IMASQYNTWYSQVLFLSCA-FLCAYGYSLDSSIRYVYMTYATNSYNT 107

Query: 120 LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVA 179
               S I+   ++ S+  Q  +  LSD  GR  L++ +   + +G +I   +  I    A
Sbjct: 108 HSLLSTISIINMMISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVIQSQAYDIQRYAA 167

Query: 180 GRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQ------GLCN-FVFG-LGTASGGLVGA 231
           G     IG  G+    ++ ++D   L+ R +Y        + N +V G +  A+  LV  
Sbjct: 168 GSVFYNIGVVGVMLQVSLFLADNSSLKWRLLYSFVPAWPAIINMWVSGNIVKAANPLVNW 227

Query: 232 YFRDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDW---AGATSLI 288
            +     AFIL  P+S +  +  VV++    R  AS    W      L +    G    I
Sbjct: 228 SWNIAMWAFIL--PLSCVPLLCCVVHM----RWKASKTPEWQELESELTFYQKHGFVHTI 281

Query: 289 AFLF-------LFMLTSSMG----GSSVAYG--SRLFAAMCAATLVFGAVFV----YVEL 331
             +F       L +LT+SMG      ++A G   +         LV G   V    Y E 
Sbjct: 282 VEVFWKVDIVGLLLLTASMGCILVPLTIAGGISEQWNNGKIIGPLVLGVFLVPLTIYWES 341

Query: 332 RVAADPVLPVTFLRDRSVLGS-SLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAM 390
             A  P  P   L+DR +    S+    C +  M   +   +Y   ++ M  T++    +
Sbjct: 342 NWAKVPFAPFLLLKDRGIWAPMSIMFLVCFIYQMAAGY---LYTILLVSMNQTELSATRI 398

Query: 391 PSFFSVAFGSLGA--GLYMKRTGKYYYFLLAFCVLAI----------AGQVQIVLITPQM 438
            + +S   G      G  + RTG+   F+L  C L             G      I   M
Sbjct: 399 MNLYSFVAGIYSPIFGFVVARTGRLKSFMLVGCCLYFLVMGLFYRYRGGLGAESGIIGAM 458

Query: 439 PVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAA 498
            VW         G    +       +  +   HE+ A  T++       G  +G SV  A
Sbjct: 459 VVW---------GIASCMYTYPVTTSAQSVTSHENMATVTAMLLTIFRIGGAVGASVSGA 509

Query: 499 VFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPF---VRATLLECY 555
           ++    T+LL  K+++   D          +ASAA ++      + P+   VR  +++ Y
Sbjct: 510 IW----TNLLYPKLLQNLGDVE--------LASAAYTAPLTFIVSHPWNTEVRTAMIDAY 557

Query: 556 HFASR 560
               +
Sbjct: 558 RHVQK 562

>TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.242
           YNL065W
          Length = 602

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 87/190 (45%), Gaps = 8/190 (4%)

Query: 82  SSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPL 140
           + +I++I    F G F +++ G I   +LT I   F  + ++A+     Y +       +
Sbjct: 120 NDKIMLIAQCAFTG-FFSSIAGAIYYPVLTLIEGLFKITEEQANISVVVYFIFQGIAPII 178

Query: 141 YGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMS 200
            G L+D  GR+PL++    ++   C+     N+   ++  R +   G   + ++ + I  
Sbjct: 179 VGNLADTNGRRPLILSCLLIYFCACVGLASCNTYAQLIGLRCLQAAGIAPVIAINSGIAG 238

Query: 201 DLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGILIVVY 257
           D+   R+R  Y G  +    +G+A G L+GA      DWR  F     +++ SG+ ++  
Sbjct: 239 DITTRRERGSYIGYVSGFVVIGSAFGALIGAGLSSTWDWRAIFWF---LAIGSGVCVIYS 295

Query: 258 LELPPRASAS 267
           + L P    S
Sbjct: 296 IILFPETKRS 305

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 111/527 (21%), Positives = 210/527 (39%), Gaps = 71/527 (13%)

Query: 31  NQIEQQD--HLLDIEQGRAYGSTTKSSISSENER--EDAGGATVAGCGSAEFYLPSSRIL 86
             I+Q +  H  +        S T +S++ E E   E++ G   +    A++Y   +R  
Sbjct: 7   ENIKQNETIHSEEFSSNITVSSITTNSLNGEKEPHLEESAGVYNSEV-YAKYYSSPTRRS 65

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           I+   +F   +   LD  + S   T   S +      S +     + S+  Q  + + SD
Sbjct: 66  IVFLCLFFICYAYGLDNKLRSPYQTLATSSYKQHSLLSTVNAIKSVISAAGQIWFARASD 125

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  +L+ +   + +G ++   +  +    AG  +  +G  G+  +  +++SD   L 
Sbjct: 126 LFGRGTILIVAVMFYVVGTIVESQAVDVSKFAAGACLFQLGYDGVVMMVQILVSDFSNLN 185

Query: 207 DRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWRL-----AFILQCPISVLS-GILIVVYLE 259
            R            + T  SG +  A   +W+      AFI   P+S +  GIL++    
Sbjct: 186 WRVTAVAFPVLPNVINTWVSGDIASAVDENWKWGIGMWAFIF--PLSCIPFGILLLHMKY 243

Query: 260 LPPRASASNKD--------CWSARLR-----RLDWAGATSLIAFLFLFMLTSSMGG--SS 304
           L  + + + K          W   L      +LD+ G    +AF  L ++  ++ G  + 
Sbjct: 244 LARKNNDTLKSSFDKPEDITWKQYLTEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNK 303

Query: 305 VAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMM 364
               +R+        +V    F+  E++ A  P+ P   ++DR V  + +   F     +
Sbjct: 304 KWKTARIIVPEVLGWVVAFPAFLTWEIKFAKYPLTPWKTVKDRGVFSALIIAIF-----L 358

Query: 365 TTNFYL-PVYWSSVLGMKATDVGKRA-----MPSFFSVAFGSLGAGLYMK--RTGKYYYF 416
            T FY+   Y  ++L +      K A     + +F +   G+L   + +K  RT ++ +F
Sbjct: 359 QTAFYMQKTYMYTILLVAVNQTKKSATRINSLFTFVTALSGTLLGLVIVKVRRTKEFIFF 418

Query: 417 -----LLAFCVL--------AIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLL 463
                 L+F +L        A AG +  + +                GFG   +   T  
Sbjct: 419 GIAVWFLSFGLLERYTGGTNAYAGIIAALCLL---------------GFGNGFIKYPTKA 463

Query: 464 AMIA-AVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLD 509
           +M A A+ HE  A  TS+  A  + G ++G SV  A++ + L   ++
Sbjct: 464 SMQASALTHEMMAIITSLFMAISTIGTSVGSSVAGAIWTNVLPDKIE 510

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 117/516 (22%), Positives = 204/516 (39%), Gaps = 79/516 (15%)

Query: 51  TTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLL 110
           TT S   S  E  D G   +     AE Y      + + FS+FL  +   LDG I  T  
Sbjct: 38  TTSSPAPSYIELIDPGVYNIEI--YAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQ 95

Query: 111 THIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170
            +  S ++     S +     + ++  Q  + +LSD  GR  +++ S   +++G +I   
Sbjct: 96  AYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQ 155

Query: 171 SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLV 229
           + +I     G     +G  G+  +  +I SD   L  R +   +    F + T  SG + 
Sbjct: 156 AVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVT 215

Query: 230 GAYFRDWR-----LAFILQCPISVLS-GI--LIVVYL-------ELPPRASASNKDCWSA 274
            A   +W+      AFIL  P++ +  GI  L + YL        L P   A NK  W +
Sbjct: 216 SAIGTNWKWGIGMWAFIL--PLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS 273

Query: 275 -----RLRRLDWAGATSLIAFLFLFMLTSSM-GGSSVAYGS-RLFAAMCAATLVFGAVFV 327
                   +LD  G   +  F    ++  ++ GG    + S  +        +V   +++
Sbjct: 274 FCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYM 333

Query: 328 YVELRVAADPVLPVTFLRDRSVLGSSLA------NWFCMMSMMTTNFYLPVYWSSVLGMK 381
             E++ +  P+ P   ++DR +  + L       NW+     M T   + V+ S     +
Sbjct: 334 LWEMKYSRHPLTPWDLIKDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATR 393

Query: 382 ATDVGKRAMPSFFSVAFGSLGAGLYMK--RTGKYYYF-----LLAFCVLA---------- 424
            T     ++ SF SV  G++   + +K  RT  +  F     +++F +L           
Sbjct: 394 IT-----SLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHS 448

Query: 425 -IAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIA-AVPHEHHAATTSISY 482
            I G + ++                  GFG      VT  ++ A A  H   A  TS+  
Sbjct: 449 GIIGSLCLL------------------GFGAGSFTYVTQASIQASAKTHARMAVVTSLYL 490

Query: 483 AFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASD 518
           A  + G+  G SV  AV+    T++L  ++ +  SD
Sbjct: 491 ATYNIGSAFGSSVSGAVW----TNILPKEISKRISD 522

>KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {ON}
           Anc_3.84 YDR497C
          Length = 577

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 8/131 (6%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLD----KASWIATSYLLSSSTCQPL 140
           I+ + F   +  F+   D   +S+ L  IG++ ++ +       +I  +  L +      
Sbjct: 80  IITLTFVASISGFMFGYDTGYISSALVSIGTDLDNKELTYGDKEFITAATSLGALISSIF 139

Query: 141 YGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIM 199
            G  +D  GRKP L+FSN +F IG ++   +++ W +  GR I G  G G+ SL + + +
Sbjct: 140 AGVAADMYGRKPCLMFSNVMFLIGAILQISASNFWQMTVGRLIMGF-GVGIGSLISPLFI 198

Query: 200 SDLVP--LRDR 208
           S++ P  LR R
Sbjct: 199 SEIAPKMLRGR 209

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 108/488 (22%), Positives = 194/488 (39%), Gaps = 71/488 (14%)

Query: 76  AEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSS 135
           AE Y      + + FS+FL  +   LDG I  T   +  S ++     S +     + ++
Sbjct: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 136 TCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLA 195
             Q  + +LSD  GR  +LV S   + +G +I   + +I     G     +G  G+  + 
Sbjct: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 196 TMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWR-----LAFILQCPISVL 249
            +I SD   L  R +   +    F + T  SG +  A   +W+      AFIL  P++ +
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFIL--PLACI 238

Query: 250 SGILIVVYL----------ELPPRASASNKDCWSA-----RLRRLDWAGATSLIAFLFLF 294
              L ++++           L P   A NK  W +        +LD  G   + AF    
Sbjct: 239 PLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCV 298

Query: 295 MLTSSMGG--SSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS 352
           ++  ++ G        + +        +V   +++  E++ +  P+ P   ++DR +  +
Sbjct: 299 LVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFA 358

Query: 353 SLA------NWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLY 406
            L       NW+     M T   + V+ S     + T     ++ SF SV  G++   + 
Sbjct: 359 LLIAFFINFNWYMQGDYMYTVLIVAVHESIKSATRIT-----SLYSFVSVIVGTILGFIL 413

Query: 407 MK--RTGKYYYF-----LLAFCVL--------AIAGQVQIVLITPQMPVWRQYLLQVVPG 451
           +K  RT  +  F     +++F +L        A AG +  + +                G
Sbjct: 414 IKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLL---------------G 458

Query: 452 FGVSVLITVTLLAMIA-AVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDA 510
           FG      VT  ++ A A  H   A  TS+  A  + G+  G SV  AV+    T++L  
Sbjct: 459 FGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIGSAFGSSVSGAVW----TNILPR 514

Query: 511 KVMRFASD 518
           ++ +  SD
Sbjct: 515 EISKRISD 522

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 112/524 (21%), Positives = 195/524 (37%), Gaps = 81/524 (15%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           L ++F+ F+  +   LDG I      +  S +      S +     + S+  Q       
Sbjct: 74  LFLLFTAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAVSQIYTPDFQ 133

Query: 146 DRLGRKPLLVFSNAV-FAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVP 204
              GR  ++     V +++G +I   +  +    AG      G  G+  +  +I+SD   
Sbjct: 134 IVFGRLYIIFLVAIVLYSVGTIIQSQAYDVQRYAAGAIFYNAGYSGVLFILLIILSDFSS 193

Query: 205 LRDRAVYQGLCNFVFGLGT-ASGGLVGAY--FRDWRL-----AFILQCPISVLSGILIVV 256
           L+ R  YQ    + F + T  SG +  A     +W       AFI+  P+S L  I  ++
Sbjct: 194 LKWRLAYQFAPTWPFIINTWISGNITSAANPIENWSWDIGMRAFII--PLSCLPFIACMI 251

Query: 257 YLELPPRASASNKDCWSARLRRLDWAGATSLIAFLF-------LFMLTSSM--------- 300
           ++E   R +   K+    +    +  G    +  LF       L ++ SS+         
Sbjct: 252 HMEWKARKTPEWKELLKEKTFYEEHNGLWGTLVELFWRLDVAGLILMGSSLGCILVPLTL 311

Query: 301 -GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFC 359
            GG+S  +             V    F   E   A DP+LP   ++DR V       W  
Sbjct: 312 AGGTSSKWNHGNVIGPFILGFVLIPFFALWEKFFARDPLLPAKLVKDRGV-------WSA 364

Query: 360 MMSMMTTNF--YLPV-YWSSVLGMKATDVGKRA-----MPSFFSVAFGSLGAGLYMKRTG 411
           M      +F  Y+   Y  +VL +   +  K A     + SF S       A LY+ R  
Sbjct: 365 MGISFLIDFIYYMAADYLYTVLIVAVDESVKSATRISSLSSFVSTVASPFFA-LYLTRCS 423

Query: 412 KYYYFLLAFCVLAI----------AGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVT 461
           +   +++  C L +           G+     I   + VW         G G ++     
Sbjct: 424 RLKPWIMLGCSLWMLAMGLLYYFRGGRESHSGIIGALCVW---------GVGTTLFTYPV 474

Query: 462 LLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHS 521
            +++ AAV HE+ A  T+ +Y     G+ +G +V  A++  +L   L   +   A     
Sbjct: 475 TVSVQAAVSHENMATVTAANYTLYRIGSAIGAAVSGAIWTQTLYKQLYKHLQDIA----- 529

Query: 522 ERELRGIIASAARSSDWVHRS-----APPFVRATLLECYHFASR 560
                  +A+AA SS +   +      PP  R  +++ Y +  R
Sbjct: 530 -------LATAAYSSPYTFTTNYAWGTPP-EREAVVQAYRYVQR 565

>KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3.84
           YDR497C
          Length = 618

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 65/131 (49%), Gaps = 8/131 (6%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN----SLDKASWIATSYLLSSSTCQPL 140
           I+ + F   +  FL   D   +S+ L  IG++ +    +      +  +  L +     +
Sbjct: 120 IITLTFVASISGFLFGYDTGYISSALISIGTDLDGRVLTYGNKEIVTAATSLGALISSTM 179

Query: 141 YGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIM 199
            G  +D  GRKP ++FSN +F +G ++   ++  W + AGR I G  G G+ SL + + +
Sbjct: 180 AGTAADMYGRKPCIMFSNIMFLVGAILQVSAHKFWQMAAGRLIMGF-GVGIGSLISPLFI 238

Query: 200 SDLVP--LRDR 208
           S++ P  +R R
Sbjct: 239 SEIAPKMIRGR 249

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 75/408 (18%), Positives = 157/408 (38%), Gaps = 46/408 (11%)

Query: 177 VVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR-- 234
           ++ GR ++ +GG GL +L  +I   +V  R R +   + +  F +    G ++G  F   
Sbjct: 4   LIVGRVVASVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTH 63

Query: 235 -DWRLAFILQCPISVLSGILIVVYLELPP----------------------RASASNKDC 271
             WR  F +  PI  L+ I+ ++  +                         R   + K  
Sbjct: 64  VTWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKRL 123

Query: 272 WSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGS-RLFAAMCAATLVFGAVFVYVE 330
            +  + + D+ G     A L LF+L  + GG+  ++ S ++ A +    L+F    VY  
Sbjct: 124 MNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVIAYLVLGVLLFIFSLVYDF 183

Query: 331 L----------RVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGM 380
                       ++  P+L    +   +++  ++  +           Y   ++  +   
Sbjct: 184 FLFDKFNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLLCTGYNGQMIYSVQFFQLIFAS 243

Query: 381 KATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPV 440
            A   G   +P   +    ++ +G+  K+ G     L+   VL + G   + L+T     
Sbjct: 244 SAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNTSTK 303

Query: 441 WRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAA------TTSISYAFRSTGATLGVS 494
             Q  + ++PGF +   +  +L++    +  +   A       T+ +   +S G TLG  
Sbjct: 304 STQIGVLLLPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFNTFMKSLGTTLGGV 363

Query: 495 VGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRS 542
           +   VF +S  +    KV R   + +  + +  +I    ++ D  H +
Sbjct: 364 LSTTVFSASFHN----KVSRAHLEPYEGKTVDDMILYRLQNYDGSHST 407

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 118/594 (19%), Positives = 224/594 (37%), Gaps = 92/594 (15%)

Query: 19  QDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEF 78
           +DPS +L G  +++   + ++++ E+        + S  ++NE E A    V    +   
Sbjct: 7   EDPSLNL-GSTSSETNGKTNVVETEE--------QFSKEADNEHELADKFHV----TKRI 53

Query: 79  YLPSSRIL-----------IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIA 127
            +  S ++           + +FS F+  F   LD  I +  +T+  + + +    S + 
Sbjct: 54  VIRKSELMANQYDNWVLKSLFLFSAFICSFSYGLDSIIRNIYMTYAMNNYETHSLLSTVN 113

Query: 128 TSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIG 187
              +  S+  Q  +  LSD  GR  + + +   + +G +I   +  +    AG     IG
Sbjct: 114 VISMTISAVAQIFFAGLSDVFGRLSIFIVTIVFYVVGTIIQSQAYDVQRYAAGSIFYNIG 173

Query: 188 GCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTA-----SGGLVGAYF--RDWR--- 237
             G     T+++SD   L+ R  Y    NFV           SG ++      ++W    
Sbjct: 174 LVGAMFQVTLMLSDSSSLKWRLFY----NFVPAWPAVVTVWISGDVINVANPKQNWSWGI 229

Query: 238 --LAFILQCPISVLSGILIVVYLELPPRASASNKDCWSAR-----------LRRLDWA-G 283
              AFI   P + L  I  ++++    +     KD    +           L++L W   
Sbjct: 230 AMWAFIF--PATCLPIIGCLLHMRWKLKNDPEWKDLQEKKTYFQTHGLVQTLKQLFWKLD 287

Query: 284 ATSLIAF-----LFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPV 338
           A  ++ F       L  LT + G S+    +++ A +   + V   VF+Y E ++A  P+
Sbjct: 288 AVGVLLFSVSTGCILVPLTIAGGVSTQWRSAKIIAPIVLGS-VLVLVFIYWESKLALVPL 346

Query: 339 LPVTFLRDRSVLGSSLANWF-CMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSF-FSV 396
            P   L+DR +    L  +  C + +M  ++   +    V G +++    R    + F  
Sbjct: 347 APFKMLKDRGIWAPLLLMFLVCFVYVMPADYLYTIL--LVAGNESSLSATRITSLYSFVT 404

Query: 397 AFGSLGAGLYMKRTGKYYYFLLAFCVLAIA----------GQVQIVLITPQMPVWRQYLL 446
           A  S  AG+ + R  +   F    C L             G+     +   M VW     
Sbjct: 405 AVLSAAAGILVTRFPRLKPFAFFGCALYFVTMALFYCFRGGEDTGKGVIGAMVVW----- 459

Query: 447 QVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTS 506
               G           ++M     HE+ A  T++  A    G  +G +V  A++    T 
Sbjct: 460 ----GVASCFFDYPINISMQTVTSHENMATVTALGLAIFRIGGAVGAAVSGAIW----TQ 511

Query: 507 LLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASR 560
            L  ++++   D     E   +  S     +W     P  VR  +++ Y +  +
Sbjct: 512 TLYPRLLKTLGDPDMAIEAYDMPLSFMLEHEW---GTP--VREAMVDSYRYVQK 560

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 74/335 (22%), Positives = 127/335 (37%), Gaps = 35/335 (10%)

Query: 31  NQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMF 90
           N  E  D     E      S++ +    + + E  G  +     + +++    +  I + 
Sbjct: 2   NMKENDDE----ENWEKLQSSSAAGEERDGQTEAIGPKS--RLQNPDYFDKPWKEYIFVL 55

Query: 91  SMFLGIFLAALDGTIVSTLLTHIGSEFNS-LDKASWIATSYLLSSSTCQPLYGKLSDRLG 149
           S  L   L     T  + L   +  + N+ + +  W+  S+ L S +   + GK+ D  G
Sbjct: 56  SSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYG 115

Query: 150 RKPLLVFSNAVFAIGCLICGLSNSIWAV---VAGRFISGIGGCGLTSLATMIMSDLVPLR 206
            K  L+    V  I  LICGLS+    V   V  R   G+G   +      I+ ++    
Sbjct: 116 LKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPN 175

Query: 207 DRAVYQGLCNFVFG-----------LGTASGGLVGAYFRDWRLAFILQCPISVLSGILIV 255
             A      N VF            LG    GL+GA    W   F      + L+G+   
Sbjct: 176 TEA-----KNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGL--- 227

Query: 256 VYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAM 315
           V L + P    +N + +     ++DW G+   +  L LF    +       +GS     +
Sbjct: 228 VALWIIPNNIPTNVNEY-----KMDWIGSAIGVFGLILFNFVWNQ-APIAGWGSAYIIVL 281

Query: 316 CAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVL 350
               +V    F+  E+R A  P+LP + L +R ++
Sbjct: 282 LIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLM 316

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 129/590 (21%), Positives = 229/590 (38%), Gaps = 90/590 (15%)

Query: 51  TTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLL 110
           TT S   S  E  D G   +     AE Y      + + FS+FL  +   LDG I  T  
Sbjct: 38  TTSSPAPSYIELIDPGVHNIEI--YAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQ 95

Query: 111 THIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170
            +  S ++     S +     + ++  Q  + +LSD  GR  +++ S   +++G +I   
Sbjct: 96  AYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQ 155

Query: 171 SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLV 229
           + +I     G     +G  G+  +  +I SD   L  R +   +    F + T  SG + 
Sbjct: 156 AVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVT 215

Query: 230 GAYFRDWR-----LAFILQCPISVLS-GI--LIVVYL-------ELPPRASASNKDCWSA 274
            A   +W+      AFIL  P++ +  GI  L + YL        L P   A NK  W +
Sbjct: 216 SAIDANWKWGIGMWAFIL--PLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS 273

Query: 275 -----RLRRLDWAGATSLIAFLFLFMLTSSMGG--SSVAYGSRLFAAMCAATLVFGAVFV 327
                   +LD  G   +  F    ++  ++ G        + +        +V   +++
Sbjct: 274 FCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYM 333

Query: 328 YVELRVAADPVLPVTFLRDRSVLGSSLA------NWFCMMSMMTTNFYLPVYWSSVLGMK 381
             E++ +  P+ P   ++DR +  + L       NW+     M T   + V+ S     +
Sbjct: 334 LWEIKYSRHPLTPWDLIQDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATR 393

Query: 382 ATDVGKRAMPSFFSVAFGSLGAGLYMK--RTGKYYYF-----LLAFCVL----------- 423
            T     ++ SF SV  G++   + +K  RT  +  F     +++F +L           
Sbjct: 394 IT-----SLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHS 448

Query: 424 AIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIA-AVPHEHHAATTSISY 482
            I G + ++                  GFG      VT  ++ A A  H   A  TS+  
Sbjct: 449 GIIGSLCLL------------------GFGAGSFTYVTQASIQASAKTHARMAVVTSLYL 490

Query: 483 AFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRS 542
           A  + G+  G SV  AV+    T++L  ++ +  SD     +  G   +   +  W    
Sbjct: 491 ATYNIGSAFGSSVSGAVW----TNILPKEISKRISDPTLAAQAYGSPFTFITTYTW---G 543

Query: 543 APPFVRATLLECYHFASRATFKFCLTTMVLAG--VSCS-IIKEHKLHTSI 589
            P   R  L+  Y +  +     C+  +V     + C+ +++ HKL  SI
Sbjct: 544 TPE--RIALVMSYRYVQKI---LCIIGLVFCFPLLGCAFMLRNHKLTDSI 588

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 92/419 (21%), Positives = 169/419 (40%), Gaps = 45/419 (10%)

Query: 30  ANQIEQQDHLLDIEQGRAYG-STTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILII 88
           +NQ E++     I Q   Y   +T  S  SE   +DAG   +    + ++  P  R+L+ 
Sbjct: 8   SNQGEEE-----IAQKETYSVHSTDISSGSEISIKDAGVQNIE-VYAEQYKKPYYRVLL- 60

Query: 89  MFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRL 148
            FS+FL  +   LDG I  T   +  S ++     S +     + ++  Q  + + SD  
Sbjct: 61  FFSLFLVAYAYGLDGNIRYTYQAYATSSYSQHSLLSTVNCIKTVIAAAGQIWFARASDIF 120

Query: 149 GRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDR 208
           GR  +L+ +   + +G +I   + ++    AG     +G  G   +  +I +D   L  R
Sbjct: 121 GRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180

Query: 209 AVYQGLCNFVFGLGT-ASGGLVGAYFRDWRLAFILQCPISVLSGI-LIVVYLELPPRASA 266
            +   +    F + T  SG +  A   DW+    +   I  L+ I L    L +   A+ 
Sbjct: 181 LLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK 240

Query: 267 SNKDCWSARLR------------------RLDWAGATSLIAFL--FLFMLTSSMGGSSVA 306
           ++KD  +  +                   +LD  G   ++ F    L   T + G +S  
Sbjct: 241 NSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEW 300

Query: 307 YGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLG----SSLAN--WFCM 360
             + +        +V   +++  E++ +  P+ P   L+DR V      +++ N  W+  
Sbjct: 301 KTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQ 360

Query: 361 MSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYM---KRTGKYYYF 416
              M T   + V+ S     + T     ++ SF SV  G+ G GL +   +RT  +  F
Sbjct: 361 GDYMYTVLVVAVHESVKSATRIT-----SLYSFVSVLTGT-GLGLVLIKVRRTKPFIIF 413

>NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {ON}
           Anc_3.84
          Length = 587

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN---SLDKASWIATSYLLSSSTCQPLY 141
           ILI+ F   +  F+   D   +S+ L  I  +     +      I  +  L +       
Sbjct: 88  ILILTFVASISGFMFGYDTGYISSALISINKDLGRTLTYGDKEIITAATSLGALISSIFA 147

Query: 142 GKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIMS 200
           G  +D  GRKP L+FSN +F IG ++   ++  W + AGR I G  G G+ SL + + +S
Sbjct: 148 GTAADIFGRKPCLMFSNVLFVIGAILQITAHRFWQMNAGRLIMGF-GVGIGSLISPLFIS 206

Query: 201 DLVP 204
           ++ P
Sbjct: 207 EIAP 210

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 134/323 (41%), Gaps = 30/323 (9%)

Query: 76  AEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSS 135
           +EFY    + +I+  S+FL  +  +LD T+  T  T   + F+     S++     + S+
Sbjct: 46  SEFYNTPMKRIILFSSIFLVCYSYSLDSTLRKTFKTDATNSFSEHSLVSFVNCFSAIVSA 105

Query: 136 TCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLA 195
             +  + + +D  GR  +       + +G +I   S  I    AG  I   G  G+  + 
Sbjct: 106 IGELFFARSADIFGRTSIFYICLVFYVVGTIIVATSKGISQFAAGYCIYSFGESGIDMVM 165

Query: 196 TMIMSDLVPLRDR---AVYQGLCNFVFGLGTASGGLVGAYFRDWRLA---FILQCPISVL 249
            +++SD   L  R    V   L N +     ASG +V  +  +W+     F +  P++ +
Sbjct: 166 QLLVSDFSHLNWRLVAGVIPMLPNVINAW--ASGTIVSDFSDNWQWGIGMFAIIVPVACI 223

Query: 250 SGILIVVYL----------ELPPRASASNKDCWSARLR-----RLDWAGATSLIA----F 290
              + + ++          EL     ++N+  W+  +R     RLD  G  +L A     
Sbjct: 224 PLAVCLFHMRYMAKKNKKNELKRPWHSNNELSWAQFIRETLFWRLDLVGLITLGASLGCI 283

Query: 291 LFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVL 350
           L  F LT   G       + +   +  A  +   +++  E   A  P+ P+  +RDR V 
Sbjct: 284 LVPFTLTKKAGKKWAKASTIVPEVIGWAVGL--PLYIVWEKFYAKYPLTPLRLIRDRGVY 341

Query: 351 GSSLANW-FCMMSMMTTNFYLPV 372
            + +A + +  + +M  N+ + V
Sbjct: 342 AALVAVFLYEFIYVMEANYMVTV 364

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 90/409 (22%), Positives = 155/409 (37%), Gaps = 28/409 (6%)

Query: 104 TIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAI 163
           +I++ +    GS  NS    +W+  S+ L S +   + G+L D  G K +L     V  I
Sbjct: 92  SIMNIIANSFGSNENS---RTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIII 148

Query: 164 GCLICGL---SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV---PLRDRAVYQ---GL 214
             LICGL   S S    +  R   G+G   +      I+ ++      R   V      +
Sbjct: 149 WSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAM 208

Query: 215 CNFVFGLGTASGGLVGAYF-RDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWS 273
                 LG    GL+G    + W  AF      S+++  L V  +   P    +N   +S
Sbjct: 209 APVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSI---PNNIPTNIQHFS 265

Query: 274 ARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRV 333
                +DW G+   +  L L     +    S  +       +   ++VF  VF+  E R 
Sbjct: 266 -----MDWIGSALGVIGLVLMNFVWNQAPIS-GWDQAYIIVLLVISVVFLVVFIIYENRF 319

Query: 334 AADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSF 393
           A  P+LP   L+DR ++   LA +F   S     FY   Y+   L ++           F
Sbjct: 320 AKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFY---YFQFQLNIRHYSAVWAGGTYF 376

Query: 394 FSVAFGSLGA---GLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVP 450
             + +G + A   G+Y+K+     +  L+     I   +  V    +     Q    ++ 
Sbjct: 377 MFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIIL 436

Query: 451 GFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499
            FG+      + +     +P E+     S+     +   +L + +GA V
Sbjct: 437 SFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 485

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 81/378 (21%), Positives = 148/378 (39%), Gaps = 40/378 (10%)

Query: 17  AMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSA 76
           A+QD  +++ G   N  E+Q    D +    +G T K  ++   +R       +      
Sbjct: 12  ALQDDHSEIDG-KTNVAEKQ---CDKDATHQHGLTDKLQMT---KRIVIRKTELMANQYD 64

Query: 77  EFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSST 136
            ++L S    + +FS F+  F   LD  I +  +T+  + +++    S ++   L  S+ 
Sbjct: 65  NWFLKS----LFLFSAFICAFSYGLDSIIRNIYMTYAMNSYSTHSLLSTVSVISLTISAV 120

Query: 137 CQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLAT 196
            Q  +  LSD  GR  + + +   + +G +I   +  +    AG     IG  G     T
Sbjct: 121 AQIFFAGLSDVFGRLSMFIVAIMFYVVGTIIQSQAYDVQRYAAGSIFYYIGLVGSMFEIT 180

Query: 197 MIMSDLVPLRDRAVYQGLCNFVFGLGTA--SGGLVGAY--FRDWR-----LAFILQCPIS 247
           +I+SD   L+ R  Y  +  +   L T   SG +V       +W       AFI      
Sbjct: 181 LILSDCSSLKWRLFYSFVPAWP-ALVTVWISGNVVSVANPLENWSWGIAMWAFIFPASCL 239

Query: 248 VLSGILIVV---------YLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTS 298
            + G L+ +         ++EL    +          L++L W     ++  L   + T 
Sbjct: 240 PIIGCLLHMRWKLRNNPEWIELQEEKTYFQTHGLVQTLKQLFW--KLDVVGVLLFSISTG 297

Query: 299 SM-------GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLG 351
            +       GG+S  + S    A      +   VF+Y E ++A  P+ P   L+DR +  
Sbjct: 298 CILVPLTLAGGASTQWRSAKVIAPFVLGFLLVPVFIYWESKLALVPLAPFKMLKDRGIWA 357

Query: 352 SSLANWF-CMMSMMTTNF 368
             +  +  C + MM   +
Sbjct: 358 PLVITFLICYIYMMAAGY 375

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 54/109 (49%), Gaps = 7/109 (6%)

Query: 142 GKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIW-AVVAGRFISGIGGCGLTSLATMIMS 200
           GKL D  GR+  L+F  ++F +G +I   S S W     GR I+GIG   +  L+ M++S
Sbjct: 142 GKLGDLYGRRWGLIFGTSIFVVGVIIQIASVSKWFQYFIGRIIAGIGMGVIAVLSPMLIS 201

Query: 201 DLVPLRDR----AVYQGLCNFVFGLGTASGGLVGAY--FRDWRLAFILQ 243
           ++ P   R    + YQ +  F   LG        +Y   + WR+A  LQ
Sbjct: 202 EVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYQNSKQWRIAVGLQ 250

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 123/293 (41%), Gaps = 38/293 (12%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLS---SSTCQPLYGK 143
           I++FS FL  +   LDG   S    + G   NS  + S ++T  +++   S+  Q +Y +
Sbjct: 64  ILLFSAFLCGYGYGLDG---SVRYIYTGYATNSYAEHSLLSTIAVINAVISAAAQIVYAR 120

Query: 144 LSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV 203
           L+D  GR  L + +   + +G +I   +  +    AG      G  G+  +  +I+SD  
Sbjct: 121 LADVFGRLYLFITAVIFYVVGTIIQSQAYDVQRYAAGAVFYNTGYVGVVLVLLLILSDFS 180

Query: 204 PLRDRAVYQGLCNFVFGLGTASGGLVGAYF---RDWR-----LAFILQCPISVLSGILIV 255
            L+ R  YQ +  + F + T   G + +      +W       AFI   P+S L  I  +
Sbjct: 181 SLKWRLFYQFVPTWPFIINTWIAGDITSRANPQENWSWDISMWAFIF--PLSALPIICCM 238

Query: 256 VYLELPPRAS------ASNKDCWSAR---------LRRLDWAGATSLIAFLFLFMLTSSM 300
           +++ +  R +      +  K  +              +LD  G   +   L   ++  ++
Sbjct: 239 LHMRIKARKTPEWQVLSEEKSFYQTHGFIQTLVQLFWKLDVIGVLIMTVSLGCILVPLTL 298

Query: 301 GGSSVAYGSRLFAAMCAATLVFGAV----FVYVELRVAADPVLPVTFLRDRSV 349
            G    Y S+   +     +V G V    ++Y E + A +P+ P   L+DR V
Sbjct: 299 AG---GYSSKWQNSQIIGPIVLGFVLIPMYIYWESKWAKEPMAPFKLLKDRGV 348

>Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W -
           Hypothetical ORF [contig 5] FULL
          Length = 529

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 83/186 (44%), Gaps = 9/186 (4%)

Query: 81  PSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQP 139
           P  + ++++     G F + + G I    L  I  +F+ S +  +     Y L       
Sbjct: 16  PREKFVLVLVCASTG-FFSTIAGAIYYPALNTIEGQFHISTELVNVSIVLYFLFQGLSPT 74

Query: 140 LYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIM 199
           L G L+D  GR+P++++S A++   C+    S +   ++  R +   G   + ++ + IM
Sbjct: 75  LMGGLADSFGRRPVVLWSVALYMAACIGIACSKTYAQILVLRCLQSAGISPVIAVNSGIM 134

Query: 200 SDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGI-LIV 255
            D+     R  Y GL      +G+A G L+G        WR  F     +++ SG  L+V
Sbjct: 135 GDVTTREQRGGYVGLTAGFQVIGSAFGALIGGGIVSTWSWRAVFWF---LAIASGFSLVV 191

Query: 256 VYLELP 261
            ++ LP
Sbjct: 192 TFIMLP 197

>KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 563

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 88/214 (41%), Gaps = 22/214 (10%)

Query: 31  NQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMF 90
           NQ +Q D + D+             +       D G    +  GS E      +++++  
Sbjct: 7   NQGKQADPVPDLPH-----------MKPNMPDHDQGAVPYSRFGSNE------KLVLVAI 49

Query: 91  SMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLG 149
               GIF + + G I    LT I ++F+ S +  +     Y L       L G L+D  G
Sbjct: 50  CAASGIF-STIAGPIYYPALTTIENQFHISTELVNVSVVLYFLFQGLAPTLMGGLADSFG 108

Query: 150 RKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRA 209
           R+P++++S A++   C+    S +   ++  R +   G   + ++ + IM D+     R 
Sbjct: 109 RRPIVMWSIALYLAACIGIACSRTYAQILVLRCLQSAGISPVIAVNSGIMGDVTTRAQRG 168

Query: 210 VYQGLCNFVFGLGTASGGLVGAYFRD---WRLAF 240
            Y GL      LG+A G L+G        WR  F
Sbjct: 169 GYVGLTAGFQVLGSAFGALIGGGIVSTWGWRAIF 202

>KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 107/240 (44%), Gaps = 20/240 (8%)

Query: 34  EQQD-HLLDIEQ-----GRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILI 87
           +Q D H L +E+     G+   S  ++  +  NE   A     +  G+       S++ +
Sbjct: 30  QQSDVHPLTLERDEKNLGKPDLSLVRTQSNQVNEPNVADYVPYSRFGT------KSKMGL 83

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSD 146
           +M   F G F + +  +I   +L  +  +F+ S ++ +     Y +  +    L G L+D
Sbjct: 84  VMQCAFTG-FFSTIAASIYFPVLGVVQRKFHISEEQVNMTVVVYYIFQALSPTLMGGLAD 142

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
            LGR+P+++ S  ++   C+     N+   ++A R +   G   + ++ + +M D+    
Sbjct: 143 SLGRRPVVLSSVIIYFCACVGLARCNTYAQIIALRCVQAAGISPVIAINSGMMGDVTTKA 202

Query: 207 DRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLELPPR 263
           +R  Y G  +    +GTA+G + GA       WR  F     +++ SG   +V L L P 
Sbjct: 203 ERGGYVGYVSGFQVVGTATGAVFGALLSSRWGWRSIFWF---LAIGSGACSIVSLLLLPE 259

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 56/118 (47%), Gaps = 6/118 (5%)

Query: 97  FLAALDGTIVSTLLTHIGSEFN----SLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKP 152
           F+   D   +S  L  +G + +    S  +   I  +  L +       G L+D  GRKP
Sbjct: 90  FMFGYDTGYISAALVSLGKDLDNKYLSYGEKEIITAATSLGALITSLFAGTLADIFGRKP 149

Query: 153 LLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIG-GCGLTSLATMIMSDLVPLRDRA 209
           + + SN +F IG ++   + S W + AGR + G G G G + L+ + +S++ P   R 
Sbjct: 150 VTMSSNVMFLIGAILQACTRSFWQMAAGRLLMGFGIGIG-SLLSPLFISEIAPSEYRG 206

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 93/215 (43%), Gaps = 16/215 (7%)

Query: 30  ANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIM 89
           +N+I+  D     +  +     +K S ++ N  +       +  G +E      + ++ +
Sbjct: 35  SNEIQCTD-----DNQKVIEQISKPSSANPNNEKTCQEPPYSRFGKSE------KSILAV 83

Query: 90  FSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRL 148
                G+F + +   I    LT I  +FN S +  +     Y +       L G L+D++
Sbjct: 84  LCASAGLF-STISAPIYYPALTIIEEDFNISQEMVNITVVVYFILQGLAPMLMGGLADKV 142

Query: 149 GRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDR 208
           GR+P+++ S A++A+ C+    + +   V+  R +   G   + ++   I+ D+    +R
Sbjct: 143 GRRPIVLCSIALYAVACIGLASAQNYGEVLFLRCLQSAGISPVVAVNNGIIGDITTKAER 202

Query: 209 AVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAF 240
             Y GL      +G+A G L+GA       WR  F
Sbjct: 203 GGYLGLMAGTQVIGSAFGALIGAGITARWGWRAIF 237

>Kpol_534.27 s534 (61814..63322) [1509 bp, 502 aa] {ON}
           (61814..63322) [1509 nt, 503 aa]
          Length = 502

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 60/136 (44%), Gaps = 4/136 (2%)

Query: 144 LSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV 203
           +S   GRK     +N + AIG  I   SNS  +++ GR I G+G       A + +S++ 
Sbjct: 115 ISKSYGRKKTAFIANIINAIGSYILFASNSYTSLIIGRLIVGLGSGIFIVNAPLFISEVT 174

Query: 204 PLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAFILQCPISVLSGILIVVYLEL 260
           PL  + +   +      LG         +F +   WR    +   +S+ + +L+ VY+  
Sbjct: 175 PLSLKGLMGSMNQVSINLGIILTQFCALFFANAYQWRWILFVAFIVSICNMVLL-VYIRE 233

Query: 261 PPRASASNKDCWSARL 276
            P+    N D  +A L
Sbjct: 234 SPKWLVQNHDLTNAEL 249

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 136/342 (39%), Gaps = 55/342 (16%)

Query: 122 KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLS----NSIWAV 177
           K+SW+  S+ L S +   + G+L D  G K +L+       I  LICGLS    N  + +
Sbjct: 101 KSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFI 160

Query: 178 VAGRFISGIG-GCGLTSLATMIMSDLVP-LRDRAVYQGLCNFVFGLGTASGGLVGAYF-- 233
            + R   G+G    L +L  ++ +   P  R + +   L      +G   GGL       
Sbjct: 161 TS-RAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVI 219

Query: 234 ---RDWRLAFILQCPISVLSGILIVVYLELPPRASAS-NKDCWSARLRRLDWAGATSLIA 289
               DW  AF      + L+   I+ Y  +P     + NK         +DW G+   ++
Sbjct: 220 RKDSDWPWAFYAYTIAAFLT--TIISYFVIPNSIPVNVNKFA-------MDWIGSALGVS 270

Query: 290 FLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRS- 348
            L LF    +   + V + +    A+   ++   A+F   E++ A  P+LP      RS 
Sbjct: 271 GLVLFNFVWNQ-STVVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSI 329

Query: 349 --VLGSSLANW--------FCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVA- 397
             +L S +A W        +    ++T   Y PV+               A  +FF V+ 
Sbjct: 330 IMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVW---------------AGGTFFMVSI 374

Query: 398 ---FGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITP 436
                +L  G  +KR G     LL F ++A      I+ +TP
Sbjct: 375 VGCIAALTVGFSIKRVGPAV--LLFFSMIAFTCGSIILSVTP 414

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 71/160 (44%), Gaps = 7/160 (4%)

Query: 97  FLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLV 155
           F ++L   I    L  +  EF+ +  + +     YLL         G L+DR GR+P+++
Sbjct: 124 FWSSLGSPIYYPALRQLEKEFHLNESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIIL 183

Query: 156 FSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLC 215
               V+ +  +    + S   +V  R +  IG     ++++ ++SD    R+R  + G  
Sbjct: 184 GGMLVYVVASIGLARAPSYGVIVFLRIVQSIGISPTIAISSGVVSDYTLKRERGTFVGAT 243

Query: 216 NFVFGLGTASGGLVGAYFR---DWRLAF---ILQCPISVL 249
           +    +G   G L+GA      DWR  F   ++ C  S+L
Sbjct: 244 SGFVLIGQGIGPLLGAVIAARWDWRAIFWFLVIGCGTSML 283

>TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 105/243 (43%), Gaps = 37/243 (15%)

Query: 75  SAEF---YLPSSRILIIM--FSMFLGIFLAALDGTIVS----------TLLTHIGSEFNS 119
           S EF   +   +R++I++  F+ F GI L+ +D +I+S           L  H  S  +S
Sbjct: 86  SVEFEVDFENKNRMVIMLGAFAAFAGI-LSGIDQSIISGASIGMNKMLHLTKHQASLVSS 144

Query: 120 LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVA 179
           L     +  S LL+          LS+  GRK  LV S   + +G ++C  + +   + A
Sbjct: 145 LMPWVLVGGSILLTP---------LSETFGRKKALVMSCIFYTVGAIVCAAAGNHHEMYA 195

Query: 180 GRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---- 235
           GRF+ G+G         + +++ VP   R     L  F   LG   G +VG  F D    
Sbjct: 196 GRFLIGVGVGIEGGGIGVYIAESVPSSVRGSLVSLYQFNIALGELFGYIVGVIFFDVKGG 255

Query: 236 WRLAFILQCPISVLSGILIVVYLELP--PR---ASASNKDCWSARLRRLDWAGATSLIAF 290
           WR  +++   + V S IL++  L LP  PR         + W+   R  D     + + F
Sbjct: 256 WR--YMVGSSL-VFSTILLIGLLFLPESPRWLMHKGRVGESWNVWKRLRDVTDDNNTVEF 312

Query: 291 LFL 293
           L L
Sbjct: 313 LEL 315

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 89/395 (22%), Positives = 155/395 (39%), Gaps = 36/395 (9%)

Query: 60  NEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNS 119
           + R+DAG   +     A+ Y      + + FS+FL  +   LDG +   L T+    +  
Sbjct: 23  HRRKDAGVKNIKV--YADQYNNVFYRVALFFSLFLVAYSYRLDGLVRGKLETYATDSYGH 80

Query: 120 LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVA 179
               S +     +  +     Y + SD  GR  +L  +  ++ +G ++   SN++     
Sbjct: 81  HSLLSTVNCIKTVIGAAGLIAYARASDIFGRMTMLAIAVLLYVVGTIVECQSNTVSKFAT 140

Query: 180 GRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWR- 237
           G  I  +G  G+  L  +I  D   L  R V   +      + T  SG ++ A   +W+ 
Sbjct: 141 GASIFQLGKAGIVLLLQVIAMDFSTLNWRMVALYVPALPIIINTWVSGDIIKAINGNWKW 200

Query: 238 ----LAFILQCPISVLSGILI-VVYL-------ELPPRASASNKDCWSARLR-----RLD 280
                AFIL      L G LI + YL       +L           W A L+     RLD
Sbjct: 201 GIGMWAFILPLACLPLFGCLIHMRYLAHKNCKDQLVNEWELYKNTSWPAYLKEVFFWRLD 260

Query: 281 WAGATSLIAFLFLFMLTSSMGG--SSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPV 338
             G   + A L   ++  ++ G  S     + +         V   +FV  E + A  P+
Sbjct: 261 ILGLILITAGLGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYARHPL 320

Query: 339 LPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRA-----MPSF 393
            P   L+DR V+ + +  +     +     Y+     +VL +   +  K A     + +F
Sbjct: 321 TPWRLLKDRGVISAIIIGFHIHFVVYMQADYM----YTVLVVAVNESVKSAQRITTLFNF 376

Query: 394 FSVAFGSLGAGL--YMKRTGKYYYFLLAFCVLAIA 426
            ++  G+L   +  Y+KRT K  + L   C+  +A
Sbjct: 377 VTIITGTLLGFVIAYVKRTKK--FILFGICIWFVA 409

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 72/170 (42%), Gaps = 7/170 (4%)

Query: 47  AYGSTTKSSISSENEREDAGGATVAGCG------SAEFYLPSSRILIIMFSMFLGIFLAA 100
           ++ +  K+  S E  RED   A V   G       AE+Y       +  F +FL  +   
Sbjct: 23  SHDAAAKNDFSIET-REDGDDAIVYDAGVRNIEIYAEYYTSKFSRFMYFFFLFLVAYAYG 81

Query: 101 LDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAV 160
           LD  + +T  T   S +      S +     + S+  Q  + +  D  GR  + VFS  +
Sbjct: 82  LDTRVRTTFATDATSSYKKHTLMSTVTCIKTIISAAGQIGFARSCDIFGRTSIFVFSIIL 141

Query: 161 FAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAV 210
           +A+G ++   + +I     G  +  +G  G+  ++ ++++D   L  R V
Sbjct: 142 YAVGTIVESQATTISKYAGGVVLYSLGHSGIVLVSEVLIADFSNLNWRVV 191

>Suva_14.21 Chr14 complement(34919..36544) [1626 bp, 541 aa] {ON}
           YNL318C (REAL)
          Length = 541

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 121/290 (41%), Gaps = 41/290 (14%)

Query: 17  AMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSA 76
            +Q P     G++++     ++ LD + GR Y  T K  +  ++E+E+  G    G  +A
Sbjct: 2   TVQIPYQHSSGYISHF---HNNELDPDGGRDYNVTIKY-LDDKDEKEE--GQVTKGSHNA 55

Query: 77  EFYLPSSRILIIMFSMFLGIFLAALD-GTIVS-TLLTHIGSEFNSLD-----KASWIATS 129
             ++P    LII     LG F+   D GTI   T +      F ++D     +  +I+T 
Sbjct: 56  SLHVPILLCLIIA----LGGFIFGWDIGTIGGMTNMISFQQRFGTIDIVDDGETVFISTK 111

Query: 130 YL-------------LSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWA 176
            L             +S         K+ D  GRK  + F+  V+ IG  +  LS   W 
Sbjct: 112 RLNDLQIGLIISIFNISCGVGALTLSKMGDWTGRKAGIWFALVVYCIGITVQILSCGRWY 171

Query: 177 VVA-GRFISGIGGCGLTSLATMIMSDLVPLRDR----AVYQGLCNFVFGLGTASGGLVGA 231
            +  GR ++G+G    T L  M +S+  PL+ R    ++YQ +  F   +G     +   
Sbjct: 172 FLTLGRAVTGVGVGITTVLVPMFLSENSPLKIRGSMVSMYQLVVTFGILMGNVLNFICVR 231

Query: 232 YFRD------WRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSAR 275
            ++D      W+L   L    +++ G+ +V   E     +    D  SA+
Sbjct: 232 CYKDPFQNISWQLPLFLGYIWAIIIGMSLVYVPESAQYLAKIKNDVPSAK 281

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 110/291 (37%), Gaps = 34/291 (11%)

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSD 146
           + + + F+  F   LD  I    +T+   ++      S +    L+ S+  Q  +  LSD
Sbjct: 71  VFLLAAFICSFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNVVSLMISAVGQIFFAGLSD 130

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR  L V +   + +G +I   +  +   VAG     IG  G     T+I+SD   L+
Sbjct: 131 VFGRLSLFVVAIIFYVVGTIIQSQAYDVGRYVAGSIFYNIGLVGAIFQVTIILSDCSSLK 190

Query: 207 DRAVYQGLCNFV-----FGLGTASGGL--VGAYFRDWR-----LAFILQCPISVLSGILI 254
            R  Y    NFV     F     SG +  +     +W        FI   P S L  I  
Sbjct: 191 WRLFY----NFVPAWPAFVTVWISGNVIHIANPSENWSWGIGMWGFIF--PASCLPLIAC 244

Query: 255 VVYLELPPRASASNKDCWSAR---------------LRRLDWAGATSLIAFLFLFMLTSS 299
           ++++    +     K+    +                 +LD AG   L A     ++  +
Sbjct: 245 MLHMRWKVKNDREWKELQEEKSYFQTHGVVQSLVQLFWKLDVAGVLLLTACTGCILVPLT 304

Query: 300 M-GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSV 349
           + GG S  + S    A          VF+Y E R+A  P+ P   L+DR +
Sbjct: 305 IAGGVSAQWRSAKVIAPFVLGFALVPVFLYWESRIALVPLAPFKMLKDRGI 355

>YNL318C Chr14 complement(38707..40329) [1623 bp, 540 aa] {ON}
           HXT14Protein with similarity to hexose transporter
           family members, expression is induced in low glucose and
           repressed in high glucose; the authentic, non-tagged
           protein is detected in highly purified mitochondria in
           high-throughput studies
          Length = 540

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 118/288 (40%), Gaps = 41/288 (14%)

Query: 19  QDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEF 78
           Q P     G++++     ++ LD  +GR Y  T K     +++ E+  G       +A  
Sbjct: 4   QIPYQHSSGYISHF---HNNELDAGRGRDYNVTIKYL---DDKEENIEGQAAKISHNASL 57

Query: 79  YLPSSRILIIMFSMFLGIFLAALD-GTIVS-TLLTHIGSEFNSL-----DKASWIATSYL 131
           ++P    L+I     LG F+   D GTI   T +     +F +      D+  +++T  L
Sbjct: 58  HIPVLLCLVIS----LGGFIFGWDIGTIGGMTNMVSFQEKFGTTNIIHDDETIFVSTKKL 113

Query: 132 -------------LSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVV 178
                        +S         K+ D +GRK  + F+  V+ IG  I  LS   W  +
Sbjct: 114 TDLQIGLIISIFNISCGVGALTLSKIGDWIGRKGGIWFALVVYCIGITIQILSYGRWYFL 173

Query: 179 A-GRFISGIGGCGLTSLATMIMSDLVPLRDR----AVYQGLCNFVFGLGTASGGLVGAYF 233
             GR ++GIG    T L  M +S+  PL+ R    + YQ +  F   +G     +    +
Sbjct: 174 TLGRAVTGIGVGVTTVLVPMFLSENSPLKIRGSMVSTYQLIVTFGILMGNILNFICERCY 233

Query: 234 RD------WRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSAR 275
           +D      W+L   L    +++ G+ +V   E P   +    D  SA+
Sbjct: 234 KDPTQNIAWQLPLFLGYIWAIIIGMSLVYVPESPQYLAKIKNDVPSAK 281

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 110/250 (44%), Gaps = 35/250 (14%)

Query: 35  QQDHLLDIEQGRAYGSTTKSS--------ISSENEREDAGGATVAGCGSAEFYLPSSRIL 86
           Q    +DIE+ R +G     S        I + N+ +D           + F      I+
Sbjct: 15  QDGREVDIEE-RWHGGAKPDSADGSRRIQIQAVNDEDDTSELITFNQDVSWF------IV 67

Query: 87  IIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKL-- 144
           ++ F   L  FL   D   +S+ L  +G++     + ++    Y+ S+++   L   L  
Sbjct: 68  MLTFVASLSGFLFGYDTGYISSALQSVGTDLGH--QLTYRDKEYITSATSLGALIAALGA 125

Query: 145 ---SDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLAT-MIMS 200
              +D  GR+  ++FSN +F +G ++   + + W +V GR + G  G G  SL + + +S
Sbjct: 126 GICADLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMVVGRLVMGF-GIGFGSLISPLFIS 184

Query: 201 DLVPLRDRAVYQGLCNFVFGLGTASGGLV----GAYFRDWRLAFILQCPISVLSGIL-IV 255
           ++ P     + +G    +  L    G L+    GA F+  +  + +   IS+L  +L  V
Sbjct: 185 EIAP----KMIRGRLTVINSLWLTGGQLIAYACGAGFQHVKHGWRILVGISMLPAVLQFV 240

Query: 256 VYLELP--PR 263
            ++ LP  PR
Sbjct: 241 SFIFLPDTPR 250

>KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1 Myo-inositol transporter with strong
           similarity to the minor myo-inositol transporter Itr2p,
           member of the sugar transporter superfamily; expression
           is repressed by inositol and choline via Opi1p and
           derepressed via Ino2p and Ino4p
          Length = 608

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 9/139 (6%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN----SLDKASWIATSYLLSSSTCQPL 140
           I+++ F   +  F+   D   +S+ L  IG++ +    +      I  +  L +      
Sbjct: 100 IIVLTFVASISGFMFGYDTGYISSALVSIGTDLDHRALTYGDKEIITAATSLGALISSIF 159

Query: 141 YGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIM 199
            G  +D  GRKP L+FSN +F +G ++   + S W +  GR I G  G G+ SL + + +
Sbjct: 160 AGTSADIWGRKPCLMFSNLLFTVGAVLQISARSFWQMAVGRLIMGF-GVGIGSLISPLFI 218

Query: 200 SDLVPLRDRA---VYQGLC 215
            ++ P   R    V   LC
Sbjct: 219 GEIAPKNIRGRLVVINSLC 237

>YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}
           ITR2Myo-inositol transporter with strong similarity to
           the major myo-inositol transporter Itr1p, member of the
           sugar transporter superfamily; expressed constitutively
          Length = 609

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 89/215 (41%), Gaps = 21/215 (9%)

Query: 14  DRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRA-----YGSTTKSSISSENEREDAGGA 68
           +   M   STD       ++  + H  +   G+        ++T    S ++E ED G  
Sbjct: 25  NSSGMGAASTDQSSTQGEELHHRKHCEEDNDGQKPKKSPVSTSTMQIKSRQDEDEDDGRI 84

Query: 69  TVAGCGSAE-------FYLPSSRILIIM-FSMFLGIFLAALDGTIVSTLLTHIGSEFNS- 119
            +      +       F    S  +I + F   +  F+   D   +S+ L  I  + ++ 
Sbjct: 85  VIKPVNDEDDTSVIITFNQSISPFIITLTFVASISGFMFGYDTGYISSALISINRDLDNK 144

Query: 120 ---LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWA 176
                +   I  +  L +       G  +D  GR+P L+FSN +F IG ++   ++  W 
Sbjct: 145 VLTYGEKELITAATSLGALITSVGAGTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQ 204

Query: 177 VVAGRFISGIGGCGLTSL-ATMIMSDLVP--LRDR 208
           + AGR I G  G G+ SL + + +S++ P  +R R
Sbjct: 205 MAAGRLIMGF-GVGIGSLISPLFISEIAPKMIRGR 238

>TBLA0H00750 Chr8 (171288..172742) [1455 bp, 484 aa] {ON} Anc_2.241
           YIL121W
          Length = 484

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 74/160 (46%), Gaps = 5/160 (3%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGK 143
           + +++   F G+F +++ G I   +L  I   F  + ++ +     Y +       + G 
Sbjct: 1   MFLVIICSFTGVF-SSVAGAIYYPVLQVIQGLFEITEEQVNITIVVYFIFQGIAPSIIGN 59

Query: 144 LSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV 203
           L+D +GR+P+++ +  ++   C+     N+   +V  R +   G   + ++ + IM D+ 
Sbjct: 60  LADSMGRRPIVIIAVTLYFCACVGLSCCNNYAQLVGLRCLQAAGISPVIAMNSGIMGDVT 119

Query: 204 PLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD---WRLAF 240
              +RA Y G  +    +GTA G L+GA       WR  F
Sbjct: 120 TRAERAGYVGYVSGFQIIGTALGALIGARLSSRWGWRGIF 159

>KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]
           {ON} similar to uniprot|P43562 Saccharomyces cerevisiae
           YFL040W Hypothetical ORF
          Length = 502

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%)

Query: 140 LYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIM 199
           L+G ++D+LGR P       ++ IG +I     ++W ++AGRFI GI     + L  + +
Sbjct: 68  LFGIMTDKLGRAPTFRVLALIWIIGSIISAAVLNVWMLIAGRFIRGIAVGSFSVLLPVYI 127

Query: 200 SDLVPLRDRAV 210
            ++VP + R +
Sbjct: 128 GEVVPEQRRGL 138

>KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {ON}
           conserved hypothetical protein
          Length = 572

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 89/201 (44%), Gaps = 24/201 (11%)

Query: 78  FYLPSSRILIIMFSMFL---GIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLS 133
           F     R ++ M   F    GI L+ +D +I+S     +    + S  +AS +++   L 
Sbjct: 90  FEFEDKRYMVYMLGAFASAAGI-LSGIDQSIISGASIGMNKALHLSAHEASMVSSLMPLG 148

Query: 134 SSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGI-----GG 188
           +     +   L++  GRK  ++ S   + +G ++C  S S   + AGRFI G+     GG
Sbjct: 149 AMAGSVIMSPLNEWFGRKSSIMISCIWYTVGAILCAASTSHHLMYAGRFILGVGVGIEGG 208

Query: 189 CGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----WRLAFILQC 244
           C       + +S+ VP   R     +  F   LG   G +VG  F D    WR  F++  
Sbjct: 209 C-----VGIYVSESVPSTVRGNLVSMYQFNIALGELFGYIVGVIFFDVHGGWR--FMVGS 261

Query: 245 PISVLSGILIVVYLELP--PR 263
            + V S IL+V    LP  PR
Sbjct: 262 SL-VFSTILLVGMFFLPESPR 281

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 83/197 (42%), Gaps = 7/197 (3%)

Query: 49  GSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIM-FSMFLGIFLAALDGTIVS 107
           G    SS  S +E+E      V G  +    L + R    M F M +  F ++L   I  
Sbjct: 54  GDDDTSSECSHDEQEQQ--HIVEGEQNYPHTLLTYRQKWFMVFLMTITGFWSSLGSPIYY 111

Query: 108 TLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCL 166
             L  +  +FN   +K +     YLL       + G L+D  GR+P+++    +F +  +
Sbjct: 112 PALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI 171

Query: 167 ICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASG 226
               + S   +V  R I  IG     ++++ ++SD    R+R  + G  + +  +G   G
Sbjct: 172 GIAKAPSYGVIVFLRCIQSIGISPTIAISSGVVSDFTVKRERGTFVGATSGLVLIGQGIG 231

Query: 227 GLVGAYFR---DWRLAF 240
            L+GA       WR  F
Sbjct: 232 PLLGAVITAALHWRAVF 248

>Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199C -
           Hypothetical ORF [contig 27] FULL
          Length = 723

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 84/187 (44%), Gaps = 36/187 (19%)

Query: 82  SSRILIIMFSMF--LGIFLAALDGTIVSTLLT--------HIGSEFNSLDKASWIATSYL 131
           + R L+   S+F  LG+FL   D  ++S ++T        H  S F   +  S +    L
Sbjct: 108 TGRALLYFTSVFVSLGVFLFGYDQGVMSGIITGPLFKDYFHDPSRFAIGNMVSILEIGAL 167

Query: 132 LSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGL 191
           +SS     + G+L ++ GR+  + + + VF IG L    +  +  ++ GR ISG+G   L
Sbjct: 168 ISSL----MVGRLGEKWGRRRTIRYGSFVFIIGGLFQTSATKLSHLIIGRVISGLGVGLL 223

Query: 192 TSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVG-----------AYFRD---WR 237
           +++  +  S++ P  +R     L    F     +G +VG           +Y  +   WR
Sbjct: 224 STIVPIYQSEISPPHNRG---KLACIEF-----TGNIVGYCSSVWVDYGCSYIPNNAAWR 275

Query: 238 LAFILQC 244
           L   +QC
Sbjct: 276 LPLFIQC 282

>TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 40/111 (36%), Gaps = 8/111 (7%)

Query: 407 MKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMI 466
           M R       L A   L   G    + I    P W   L  +    G  +    TL   I
Sbjct: 1   MSRYNCLQILLYAGVFLMALGNFLFLFIEKGSPNWLVGLFLIPANLGQGITFPATLFTFI 60

Query: 467 AAVPHEHHAATTSISYAFRSTGATLGVSVGAAV--------FRSSLTSLLD 509
            A P    A  TS  Y FRS G+  GV++   V         RS+L  LLD
Sbjct: 61  FAFPKSRQATATSTLYLFRSIGSVWGVAMSTGVIQLYFGKSLRSNLKDLLD 111

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 98/248 (39%), Gaps = 20/248 (8%)

Query: 35  QQDHLLDIEQGRAYGSTTKSSIS----SENEREDAG--GATVAGCGSAEFYLPSSRILII 88
            +D +  I   R+  +T  S  +    SENE    G   A + G    E   P  RI+I 
Sbjct: 13  DEDKISVISDVRSLKNTNDSEYTFTSDSENEVLSPGVHNAKIYGKYYTE---PYQRIMI- 68

Query: 89  MFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRL 148
            FS+FL  +   LD    +T +T   S +      S +     + S+  Q  + + SD  
Sbjct: 69  FFSLFLICYAYGLDKKTRTTYVTLATSSYKEHSLMSTVTCITKVISAAGQIWFARASDIF 128

Query: 149 GRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDR 208
           GRK +   S   + IG +I   +  I     G  + G+G  G+     +  +D   L  R
Sbjct: 129 GRKLIFGLSVIFYVIGTVIESQATEISRYAGGECLYGLGHAGIVLTTELYAADFSNLNWR 188

Query: 209 AVYQGLCNFVFGLGT-ASGGLVGAYFRDWR-----LAFILQCPISVLSGILIVVYLELPP 262
            V          + T  SG +      +W+      AFI   PIS L   LI   L +  
Sbjct: 189 VVAAAAPMLPNIINTWVSGNITADVDENWKWGIGMWAFIF--PISCLP--LIGCLLHMRY 244

Query: 263 RASASNKD 270
           +A  +N++
Sbjct: 245 KAQKNNEE 252

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 85/373 (22%), Positives = 146/373 (39%), Gaps = 59/373 (15%)

Query: 14  DRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGC 73
           DR +  D   DL      ++++    LDIE          +++SS ++  DA     AG 
Sbjct: 7   DRKSGADMQLDLDRKSDAEMQKD---LDIEP-------KLTAVSSSSD--DAESHVDAGV 54

Query: 74  GSAEFYLPSSRILIIMFSMFLGIFLAA----LDGTIVSTLLTHIGSEFNSLDKASWIATS 129
            + E Y       I  F++F  IFL A    LDG +  T  ++  S +         A  
Sbjct: 55  HNIEVYAEQYSSPIHRFALFFSIFLVAYAYGLDGQVRYTYQSYATSSY---------AQH 105

Query: 130 YLLSSSTC---------QPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAG 180
            LLS+  C         Q  Y + SD  GR  +LV     +++G +I   + ++    AG
Sbjct: 106 SLLSTVNCITTVIAAAGQICYARASDIFGRMTILVIGVIFYSMGTIIESQATNVSRFAAG 165

Query: 181 RFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWR-- 237
                +G  G+     +I +D   L  R +   +    F + T  SG +  A   +W+  
Sbjct: 166 SCFYQLGYTGIVLTLEVIAADFSNLNWRLLASFVPALPFIINTWISGNVTSAVNGNWKWG 225

Query: 238 ---LAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARL-RRLDWAGATSLI----- 288
               AFIL  P+S +     ++++    + +A ++    A L   L W      I     
Sbjct: 226 IGMWAFIL--PLSAIPLGCCLLHMRYLAKKNAGDRLLKEASLIGTLGWKKFIVEILFWRL 283

Query: 289 AFLFLFMLTSSMGGSSVAY------GSRLFAAMCAATLVFG-----AVFVYVELRVAADP 337
            F+ L ML  + G   + +       S    A      V G      +F+  E++ +  P
Sbjct: 284 DFIGLLMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEVIGWCLALPLFLLWEIKFSRHP 343

Query: 338 VLPVTFLRDRSVL 350
           + P   ++DR ++
Sbjct: 344 LTPWALIKDRGII 356

>Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 86/197 (43%), Gaps = 16/197 (8%)

Query: 14  DRDAMQ-DPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAG 72
           D D+++ D   D P     +I  + H  +I +  A     +  I   N+ +D        
Sbjct: 23  DADSVEFDNERDSPT-KTTKITLESH--EIRRASANDDEDRIQIKPVNDEDDTSVMITFN 79

Query: 73  CGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN----SLDKASWIAT 128
              + F      I+I+ F   +  F+   D   +S+ L  IG++ +    +  +   +  
Sbjct: 80  QSLSPF------IIILTFVASISGFMFGYDTGYISSALISIGTDLDNKVLTYREKEIVTA 133

Query: 129 SYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGG 188
           +  L +       G  +D  GRK  L+ SN +F IG ++   +++ W + AGR I G  G
Sbjct: 134 ATSLGALITSIFAGTAADVFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAAGRLIMGF-G 192

Query: 189 CGLTSL-ATMIMSDLVP 204
            G+ SL A + +S++ P
Sbjct: 193 VGIGSLIAPLFISEIAP 209

>KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {ON}
           Anc_5.469 YDR387C
          Length = 546

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 85/187 (45%), Gaps = 7/187 (3%)

Query: 84  RILIIMFSMFLGIFLAALDGTIVSTLLTHIG-SEFNSLDKASWIATSYLLSSSTCQPLYG 142
           R+ +I+F+  +G  L   D  ++S +L ++  ++ N  +  S +   ++ +S++    +G
Sbjct: 40  RMALILFAATIGGLLFGYDTGVISGVLINLDPADLNRTEMTS-LNEEFITASTSVGSFFG 98

Query: 143 KL-----SDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATM 197
            L     +D+ GRK  L     VF +  +   LS+S+  +V+GR I G+          +
Sbjct: 99  SLLAFPLADKAGRKFTLAACCVVFVVAAIWMALSSSLIWLVSGRMIVGVAVGAAAQCVPI 158

Query: 198 IMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRDWRLAFILQCPISVLSGILIVVY 257
            +S++ P + R     L +     G     ++  +  D R A+     IS +  I  ++ 
Sbjct: 159 YLSEISPAKVRGFILTLNSVAITGGQLLSYIIAYFLGDARHAWRYLFAISAIPAIFFLLV 218

Query: 258 LELPPRA 264
           L+  P +
Sbjct: 219 LDFVPES 225

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 96/219 (43%), Gaps = 14/219 (6%)

Query: 95  GIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPL 153
           G+ LA++   IV  L+T I + FN S  ++ W  TSY+++ +     +G++ D +G   +
Sbjct: 33  GLDLASVGAMIV--LVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIM 90

Query: 154 LVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQG 213
           +   + +F I  L+C +  +  A    R   G+ G G+   A  +++ +    +   Y  
Sbjct: 91  MCVFSVIFGIFSLLCAVVPNFIAFTVFRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFS 150

Query: 214 LCNFVF----GLGTASGGLVGAYFRDWRLAFILQCPISVLSGILIVVYLELPP----RAS 265
           + + V     G+G   GG  G     ++  F      S+ +  +I V +  P     R S
Sbjct: 151 ILSSVISAMAGVGFIIGGAFGETALGYKSFFYFLFAASLATAAVICVLIGYPELLLNRHS 210

Query: 266 ASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSS 304
              K     R+ +LD  G    I+   L ++  + GG S
Sbjct: 211 YKEK---FQRVYKLDVIGCLLFISGSILLVVGLTQGGES 246

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 79/179 (44%), Gaps = 8/179 (4%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSD 146
           ++F + +  F ++L   I    L  +  EFN   +K +     YLL       + G L+D
Sbjct: 103 MVFLLVMCGFWSSLGSPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLAD 162

Query: 147 RLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLR 206
             GR+P+++    ++ +  +    + S   +   R I  IG     ++++ ++ D     
Sbjct: 163 VFGRRPIILGGMVIYVVASIGLACAPSYGVICFLRCIQSIGISPTIAISSGVVGDFTLKH 222

Query: 207 DRAVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAFILQCPISVLSGI-LIVVYLELP 261
           +R  + G  + +  LG   G L+GA      DWR  F     +++ SG+ LIV    LP
Sbjct: 223 ERGTFVGATSGLVLLGQCFGSLIGAVLTARWDWRAIFWF---LAIGSGVALIVAAFTLP 278

>Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W
           (REAL)
          Length = 611

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 4/70 (5%)

Query: 142 GKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIMS 200
           G  +D  GR+P L+FSN +F IG ++   ++  W + AGR I G  G G+ SL + + +S
Sbjct: 172 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMGF-GVGIGSLISPLFIS 230

Query: 201 DLVP--LRDR 208
           ++ P  +R R
Sbjct: 231 EIAPKMIRGR 240

>Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {ON}
           YOL103W (REAL)
          Length = 587

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 4/70 (5%)

Query: 142 GKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIMS 200
           G  +D  GR+P L+FSN +F IG ++   ++  W + AGR I G  G G+ SL + + +S
Sbjct: 178 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMGF-GVGIGSLISPLFIS 236

Query: 201 DLVP--LRDR 208
           ++ P  +R R
Sbjct: 237 EIAPKMIRGR 246

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 100/247 (40%), Gaps = 36/247 (14%)

Query: 122 KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAV---V 178
           + +W+  S+ L S +   + GK+ D  G K  L+   AV  I  LICGLS+    V   +
Sbjct: 88  QQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFI 147

Query: 179 AGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFG-----------LGTASGG 227
             R   G+G   +    T I+ ++     +A      N VF            LG    G
Sbjct: 148 VARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMIGACAPIGATLGCLFSG 202

Query: 228 LVGAYFRDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGA--- 284
           L+G     W   F     ++ L+G  ++ +  +P           +    ++DW G+   
Sbjct: 203 LIGTESEAWAWTFYAYTIVAALNG--LIAWYVIPDNIPT------NVHKFKMDWLGSFLG 254

Query: 285 -TSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTF 343
              LI F F++    + G     + S     +   +++   +F+  E R A +P+LP   
Sbjct: 255 VCGLIMFNFVWNQAPTDG-----WDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAV 309

Query: 344 LRDRSVL 350
           L +R ++
Sbjct: 310 LFNRKLM 316

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 128/311 (41%), Gaps = 38/311 (12%)

Query: 6   HSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDA 65
           H  +  P+ ++  +DP+        ++  +   L + +          + +    +RE +
Sbjct: 20  HVEIDKPITKEIYEDPTQKKFDLDDDEAGKTSSLFNPDLNLEEEVRGLNELGDSFKRERS 79

Query: 66  -GGATVAGCGSAEFYLPSSRILII-MFSMFLGIFLAALDGTIVS----------TLLTHI 113
             G   A     +F    + +L++  F+ F GI L+ +D +I+S           L TH 
Sbjct: 80  FWGKMKALEFEVDFENKKNMVLMLGTFAAFAGI-LSGIDQSIISGASIGMNKMLHLSTHE 138

Query: 114 GSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNS 173
            S  +SL     +A S LL+           S+  GRK  L  S   + +G ++C  +++
Sbjct: 139 ASLVSSLMPLGAVAGSILLTP---------FSEYFGRKKSLAISCVFYTVGAIVCAAASN 189

Query: 174 IWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYF 233
              + AGRF+ GIG         + +++ VP   R     L  F   LG   G +VG  F
Sbjct: 190 HHEMYAGRFLIGIGVGLEGGGIGVYIAESVPSSVRGSLVSLYQFNIALGELFGYIVGVIF 249

Query: 234 RD----WRLAFILQCPISVLSGILIVVYLELP--PR---ASASNKDCWS--ARLRRLDWA 282
            D    WR  +++   + V S  L +  L LP  PR         + W+   RLR ++  
Sbjct: 250 FDVKGGWR--YMVGSSL-VFSTTLFIGLLFLPESPRWLMHKGRVGESWNVWKRLRDVNEE 306

Query: 283 GATSLIAFLFL 293
           G  + I FL L
Sbjct: 307 G--NKIEFLEL 315

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 113/280 (40%), Gaps = 34/280 (12%)

Query: 89  MFSMFLGIFLAALDGTIVSTLLTHIGSEFNS-LDKASWIATSYLLSSSTCQPLYGKLSDR 147
           +F+  +G  L     T   +++  I  +F S   K +W+  S+ L S +   + G+  D 
Sbjct: 81  IFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDI 140

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSI----WAVVAGRFISGIGGCGLTSLATMIMSDLV 203
            G K +L+   A+  I  +ICGL++      + +VA  F     G G++ +   I+  + 
Sbjct: 141 YGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAF----QGLGVSFILPNIIGLVG 196

Query: 204 PLRDRAVYQGLCNFVF-----GLGTASGGLVGAYF-----RDWRLAFILQCPISVLSGIL 253
            + +    +      F      LG   GGL          ++W   F     +S L G  
Sbjct: 197 TIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVG-- 254

Query: 254 IVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLT---SSMGGSSVAYGSR 310
           +  Y  +P     +  +       ++DW G+   +  L LF      + M G   AY   
Sbjct: 255 VTCYFFVPDNVPTNTNNL------KMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY--- 305

Query: 311 LFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVL 350
           +   +  + ++  A F+Y E+  A  P+LP     +R ++
Sbjct: 306 IIVLLVISVILIIAFFIY-EINYAEVPLLPKAITGNRHII 344

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 110/266 (41%), Gaps = 31/266 (11%)

Query: 110 LTHIGSEF--NSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLI 167
           L  IG  F   +  + SW A+++ L+  T   + G+L D  G K   V     +A+  ++
Sbjct: 54  LQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSIL 113

Query: 168 CGL---SNSIWAVVAGRFISGIG-GCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT 223
            G    SN I+     R   GIG    L +   +I     P R     Q +   +FG   
Sbjct: 114 AGFSVYSNQIFFDCC-RAFQGIGPAFTLPNAIAIIARTYRPGRK----QNMIFSLFGACA 168

Query: 224 ASGGLVGAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNKDCWS 273
            SG +VGA F         W  A+ +    C +  ++G L++      P     + D   
Sbjct: 169 PSGFVVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVI------PHHPPIHPDEKC 222

Query: 274 ARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRV 333
           + + R+D AG+ + +  L LF    +  G  V + +    A+      F A F ++E R 
Sbjct: 223 SLVERIDVAGSVTGVVGLILFNFAWNQ-GPVVGWETSYTYALLIVGSAFLAAFGFIESR- 280

Query: 334 AADPVLPVTFLRDRS--VLGSSLANW 357
           A  P+LPV  L   +  V+G   A W
Sbjct: 281 AKHPLLPVRKLSSDTIFVMGCIAAGW 306

>KLLA0A03223g Chr1 (290002..292035) [2034 bp, 677 aa] {ON} similar
           to uniprot|P39932 Saccharomyces cerevisiae YDR536W STL1
           Glycerol proton symporter of the plasma membrane,
           subject to glucose-induced inactivation, strongly but
           transiently induced when cells are subjected to osmotic
           shock
          Length = 677

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 93/199 (46%), Gaps = 26/199 (13%)

Query: 82  SSRILIIMFSMF--LGIFLAALDGTIVSTLLT--HIGSEFNSLDKA------SWIATSYL 131
           + R L+   S+F  LG+FL   D  ++S ++T  +  + FN+   A      S +    L
Sbjct: 111 TGRTLLYFTSIFVSLGVFLFGYDQGVMSGIITGPYFKTYFNNPTAATIGTMVSILEIGAL 170

Query: 132 LSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGL 191
           +SS     L   + ++ GR+  + + + +F +G L+   S  +  ++ GR ISGIG   L
Sbjct: 171 VSSL----LVSNIGEKFGRRFTIKYGSLIFILGGLVQTFSWEMGHMIFGRIISGIGVGLL 226

Query: 192 TSLATMIMSDLVPLRDR---AVYQGLCNFVFGLGTASGGLVG---AYFR---DWRLAFIL 242
           +++  +  S++ P  +R   A  +   N V   G AS   V    +Y      WRL   +
Sbjct: 227 STIVPIYQSEISPPHNRGKLACIEFTGNIV---GYASSVWVDYACSYIESDTSWRLPLFI 283

Query: 243 QCPISVLSGILIVVYLELP 261
           QC + +L  +   V +E P
Sbjct: 284 QCVMGLLLFLGSFVIVETP 302

>TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432
          Length = 554

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 65/142 (45%), Gaps = 7/142 (4%)

Query: 143 KLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDL 202
           K SD  GR+  L    A + IG +I   S ++  +VAGR ISGIG    +S A +  S++
Sbjct: 91  KFSDAFGRRVSLHLCAAFWIIGAIIQCASQNVGMLVAGRVISGIGIGFGSSTAPVYCSEV 150

Query: 203 VPLRDRAVYQGLCNFVFGLGTASGGLV--GAYFRDWRLAFILQCPISVLSGILIVVYLEL 260
            P + R    G+  F   LG      +  G +F     AF +   + ++ G++++++   
Sbjct: 151 SPPKIRGTIAGIFQFSVTLGIMILFYIGYGCHFIQSDAAFRVTWGLQLVPGVILLIFTFF 210

Query: 261 PPRASASNKDCWSARLRRLDWA 282
            P +       W A   R D A
Sbjct: 211 LPESPR-----WLATHDRFDEA 227

>Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W
           (REAL)
          Length = 609

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 142 GKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIMS 200
           G  +D  GR+P L+FSN +F IG ++   ++  W + AGR + G  G G+ SL + + +S
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLVMGF-GVGIGSLISPLFIS 228

Query: 201 DLVP 204
           ++ P
Sbjct: 229 EIAP 232

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 1/129 (0%)

Query: 84  RILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYG 142
           +++I M  +FLG     L+   V +++  +G  +      ASW  TSY ++ +      G
Sbjct: 29  QLIINMALIFLGCTFDLLNVAGVISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMG 88

Query: 143 KLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDL 202
           +L D +G   L   S   F++ CL+C +  +  A    R + GI   GL      ++  L
Sbjct: 89  RLGDIIGNSVLFTISGFFFSLFCLLCAVVTNFPAFAVLRALQGIAAAGLVPCGYALIPTL 148

Query: 203 VPLRDRAVY 211
               D  ++
Sbjct: 149 ADPEDVQLF 157

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 115/272 (42%), Gaps = 17/272 (6%)

Query: 3   QSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENE- 61
           +SE   +   VD D  ++P+          +E+   + DI +        K      +E 
Sbjct: 11  ESEVQEVSNSVD-DVYENPAVKKDEECVEDLEKVSDV-DISRRANIDEQLKELNRKGDEF 68

Query: 62  REDAGGATVAGCGSAEFYLPSSRILIIM---FSMFLGIFLAALDGTIVSTLLTHIGSEFN 118
           + D G          E    + + +++M   F+ F GI L+ +D +I+S     +    +
Sbjct: 69  KRDHGFFNNMKNLEFETNFKNKKHMVLMLGVFASFAGI-LSGIDQSIISGASIEMNKMLH 127

Query: 119 -SLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAV 177
            S  +AS +++   L +     L    S+ LGRK  LV S   + +G +IC  + ++  +
Sbjct: 128 LSSHEASLVSSLMPLGAVAGSILLTPFSEMLGRKTSLVISCGFYTMGAIICAAALNVQTM 187

Query: 178 VAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD-- 235
            AGRF  G+G         + +++ VP   R     L  F   LG   G +VG  F +  
Sbjct: 188 YAGRFFIGVGVGLEGGGIGVYIAECVPSTVRGRLVSLYQFNIALGELFGYIVGVIFFEVH 247

Query: 236 --WRLAFILQCPISVLSGILIVVYLELP--PR 263
             WR  F++   + + S +L +  L LP  PR
Sbjct: 248 GGWR--FMVGSSL-IFSTLLFIGLLFLPESPR 276

>ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {ON}
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively and similar to YDR497C uniprot|P30605
           Saccharomyces cerevisiae YDR497C ITR1 Myo-inositol
           transporter with strong similarity to the minor myo-
           inositol transporter Itr2p, member of the sugar
           transporter superfamily; expression is repressed by
           inositol and choline via Opi1p and derepressed via Ino2p
           and Ino4p
          Length = 593

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 69/152 (45%), Gaps = 25/152 (16%)

Query: 142 GKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-ATMIMS 200
           G ++D +GRKP ++ SN +F +G ++   ++  W + AGR I G  G G+ SL A + + 
Sbjct: 155 GIVADIIGRKPSIMASNVMFLVGIVLQVCAHKYWQMAAGRLIMGF-GVGVGSLVAPLFIG 213

Query: 201 DLVP--LRDR-AVYQGLCNFVFGLGTASGGLVGAY---------FRDWRLAFILQCPISV 248
           ++ P  +R R  V   LC         +GG + AY            WR+   L   I V
Sbjct: 214 EIAPSMIRGRLTVINSLC--------VTGGQLVAYACGAGLTHVNNGWRVLVGLAL-IPV 264

Query: 249 LSGILIVVYLELPPRASASNKDCWSAR--LRR 278
                  ++L   PR      D  SAR  LRR
Sbjct: 265 ALQFAFFMFLPDTPRYYVMKNDVESARKVLRR 296

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 113/278 (40%), Gaps = 23/278 (8%)

Query: 3   QSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQ-DHLLDIEQGRAYG-STTKSSISSEN 60
            S  S ++  V++   + PS  +       IE++    L IE+  A   ST ++S+ S N
Sbjct: 65  HSSDSQIVKLVNKPLQKVPSPIIES--EEDIEKKSKEELKIEKRIATATSTEETSLKSAN 122

Query: 61  EREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSL 120
             ++    T         +    R++I +  +++G FL  L G I    L  +   FN  
Sbjct: 123 RSKEPPPYTA--------FSKKQRLIIFLVIIYVG-FLGPLSGNIYIPALPLLQESFNVS 173

Query: 121 DKASWIATSYLLSSSTCQPLYGKL-SDRLGRKPLLVFSNAV-FAIGCLICGLSNSIWAVV 178
                   S  ++  +  PL+  L +D  GRK L + S  +   +  L+  +  +I A+ 
Sbjct: 174 ATTINATVSVFMAVFSVGPLFWALFADFGGRKFLYIVSLLLTIIVNILLSAVPTNIGALF 233

Query: 179 AGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFG------LGTASGGLVGAY 232
             R     G   + SL    +SD+ P + R   + +  F+ G      L     GL+   
Sbjct: 234 FLRIAQAFGSSSVMSLGIGTVSDITPPKSRG--RAVSYFMLGPNMGPILAPIIAGLILMS 291

Query: 233 FRDWRLAFILQCPISVLSGILIVVYLELPPRASASNKD 270
             +WR  F   C IS ++  L+V+ L    R    N D
Sbjct: 292 SNNWRWLFGFICIISGIALFLVVLLLPETLRCIVGNGD 329

>SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]
           {ON} similar to uniprot|Q12407 Saccharomyces cerevisiae
           YDL199C Hypothetical ORF
          Length = 730

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 89/194 (45%), Gaps = 24/194 (12%)

Query: 82  SSRILIIMFSMF--LGIFLAALDGTIVSTLLTHIGSEFNS-LDKASWIATSYLLS----- 133
           + R L+   S+F  LG+FL   D  ++S ++T  G  F     + S +A   ++S     
Sbjct: 114 TGRALLYFTSIFVSLGVFLFGYDQGVMSGIIT--GPYFKQHFHEPSRVAIGNMVSILEVG 171

Query: 134 SSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTS 193
           +     + G+L ++ GR+  + + + +F  G  I   ++ +  ++ GR +SG+G   L++
Sbjct: 172 ALVSSLMVGRLGEKWGRRRTIKYGSLIFVFGGAIQTFASRMSDLIIGRIVSGLGVGLLST 231

Query: 194 LATMIMSDLVPLRDRAVYQ------GLCNFVFGLGTASGGLVGAYFR---DWRLAFILQC 244
           +  +  S++ P  +R           +C +   +    G    +YF     WR+   +QC
Sbjct: 232 IVPIYQSEISPPHNRGKLACIEFTGNICGYASSVWVDYG---CSYFESNASWRVPLFIQC 288

Query: 245 --PISVLSGILIVV 256
              + + +G  I+V
Sbjct: 289 ILGLGLFTGSFIIV 302

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 77/394 (19%), Positives = 158/394 (40%), Gaps = 41/394 (10%)

Query: 124 SWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFI 183
           +W+  S+ L+S +   + G++ D  G K   +  N +F I  ++CG+S     V      
Sbjct: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172

Query: 184 SGIGGCGLTSLATMIMS------DLVPLRDRAVYQGL-CNFVFG--LGTASGGLVGAYFR 234
               G G+  +   +M       ++  +R   V   + C    G   G   GGL+    +
Sbjct: 173 RAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNK 232

Query: 235 DWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLF 294
           D          I+V   +++ +Y  +P     +  +       ++DW G  SL+  + L 
Sbjct: 233 DQWPWIFFATAIAVFINLIMGIY-SIPNHVPTNIYNL------KMDWIG--SLLGVIGLI 283

Query: 295 MLT-----SSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSV 349
           ++      + + G S AY   +   +  A     A F+Y EL+ A  P+LP    ++R +
Sbjct: 284 LMNFVWNQAPISGWSKAY---IIVILIVAVFFLVAFFIY-ELKKAESPLLPPEVTKNRHI 339

Query: 350 LGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGA---GLY 406
           +   ++ +    +     FY   Y++  L ++           F  + FGSL A      
Sbjct: 340 VTIIISLFLGWGAFGIWTFY---YYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFT 396

Query: 407 MKRTGKYYYFLLAFCVLAIA---GQVQIVLITPQMPVWRQYL-LQVVPGFGVSVLITVTL 462
           + + G      + FC+ +I    G +   + +P    WR  L +Q++   G+ +    + 
Sbjct: 397 INKVGPS----VLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSS 452

Query: 463 LAMIAAVPHEHHAATTSISYAFRSTGATLGVSVG 496
           + +   +P ++   + S+     +   +L + +G
Sbjct: 453 IILSDLLPMQYQGMSGSLVNTITNYATSLCLGMG 486

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 111/499 (22%), Positives = 194/499 (38%), Gaps = 62/499 (12%)

Query: 50  STTKSSISSENEREDAGGATVAGCGSAEFYLPS----SRILIIMFSMFLGIFLAALDGTI 105
            T  S +SS    EDAG    AG  + E +          L++ FS+FL  +   LD  I
Sbjct: 13  ETANSELSSHTH-EDAGEEKDAGVHNIEVFTAQYDHIGYRLMLFFSIFLISYAYGLDQNI 71

Query: 106 VSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQP---LYGKLSDRLGRKPLLVFSNAVFA 162
             TL T+     NS  + S +AT   + +    P    + + +D  GR  +L+ +   + 
Sbjct: 72  RYTLQTYAT---NSYSQHSLLATVNCIIAVIAAPGQVCFARAADIFGRFTVLIVAVIFYV 128

Query: 163 IGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLG 222
           +G +I   + ++    AG     +G  GL  +  +I  D   L  R +   +    F + 
Sbjct: 129 MGTIIESQATNVSRFAAGACFYRLGITGLMLMMEVIAMDFSNLNWRLLASFVPALPFIIN 188

Query: 223 T-ASGGLVGAYFRDWR-----LAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARL 276
           T  SG ++ A   +W+      AFIL  P+S +   L    L +   A  + KD   +  
Sbjct: 189 TWISGNVLTAIGTNWKWGIGMWAFIL--PLSCIP--LGFCMLHMRYLAHKNAKDQLRSEF 244

Query: 277 R-----------------RLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAAT 319
           +                 RLD+ G   +       ++  ++GG       +   A     
Sbjct: 245 KLFKTMSWYEYIVEVFFWRLDFPGLILICVTFGCILIPFTLGG---GLNEKWKTAGIIVP 301

Query: 320 LVFGAV-----FVYVELRVAADPVLPVTFLRDRSVLGSSLAN------WFCMMSMMTTNF 368
            V G V     ++  E + A  P+ P   ++DR +  + +        W+     M T  
Sbjct: 302 EVIGWVVALPLYMIWESKYARHPLTPWKLIKDRGIFSALIIAFHINFIWYMQGDYMFTVL 361

Query: 369 YLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMK--RTGKYYYFLLAFCVLAIA 426
            + V  S+    + T     ++ SF SV  G+L   + +K  RT K+  F +    ++  
Sbjct: 362 RVAVNESNSSAQRIT-----SLYSFVSVITGTLLGLVIVKVRRTKKFILFGIVCWFISFG 416

Query: 427 GQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVP-HEHHAATTSISYAFR 485
             V     +         L   + GFG       T  ++ A+   HE+ A  TS+  A  
Sbjct: 417 LLVHFRGDSSSHSGIIGSL--CLMGFGAGFFTYTTQASIQASTKHHENLAVITSLYLATY 474

Query: 486 STGATLGVSVGAAVFRSSL 504
           + G+ +G +V  A++ + L
Sbjct: 475 NIGSAVGAAVSGAIWTNVL 493

>KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly
           similar to uniprot|Q12407 Saccharomyces cerevisiae
           YDL199C Hypothetical ORF
          Length = 733

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 84/185 (45%), Gaps = 32/185 (17%)

Query: 82  SSRILIIMFSMF--LGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLS----- 133
           + R L+   S+F  LG+FL   D  ++S ++T  G  F    D  S  A   ++S     
Sbjct: 117 TGRALLYFTSVFVSLGVFLFGYDQGVMSGIIT--GPLFKLYFDDPSRAAIGNMVSILEVG 174

Query: 134 SSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTS 193
           +     + G+L ++ GR+  + + + VF +G LI   +  +  ++ GR ISG+G   L++
Sbjct: 175 ALVSSLMVGRLGEKWGRRRTIRYGSFVFILGGLIQTSATRMLHLIIGRVISGLGVGLLST 234

Query: 194 LATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVG-----------AYFRD---WRLA 239
           +  +  S++ P  +R     L    F     +G +VG           +Y  +   WRL 
Sbjct: 235 IVPIYQSEISPPHNRG---KLACIEF-----TGNIVGYCSSVWVDYGCSYINNNAAWRLP 286

Query: 240 FILQC 244
             +QC
Sbjct: 287 LFIQC 291

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 95/389 (24%), Positives = 152/389 (39%), Gaps = 40/389 (10%)

Query: 113 IGSEF--NSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170
           IG+ F  ++  + SW + +Y L+  T   + G+L D  G K L V     +++  L+ G 
Sbjct: 67  IGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGF 126

Query: 171 ---SNSIWAVVAGRFISGIGGCGL--TSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTAS 225
              SN I+     R + GIG   L   S+A +  +     R + V+      +FG  TA 
Sbjct: 127 SVYSNQIFFDCC-RALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFS-----IFG-ATAP 179

Query: 226 GGLV-GAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNKDCWSA 274
           GG V G+ F         W  A+      C +  ++GI+++      P+A     D  + 
Sbjct: 180 GGFVLGSVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVI------PQAPPPKIDISAG 233

Query: 275 RLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVA 334
            L R+D AGAT+ I  L L     +  G  V + +    A+     VF  VF  +E R A
Sbjct: 234 ILERIDAAGATTGILGLALVNFAWNQ-GPVVGWQTPYTYALLIVGFVFLLVFSLIESR-A 291

Query: 335 ADPVLPVTFLRDR--SVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPS 392
             P+LP   L      VLG   A W    S     FY   +              + +P 
Sbjct: 292 RFPLLPFAALSTDLAYVLGCIAAGW---SSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPV 348

Query: 393 FFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQ-VVPG 451
             S    +L  G  +         L+A     + G V +         W Q  +  ++  
Sbjct: 349 AISGLCAALTTGYILSHVPACAVMLIAMIAFTVGG-VLVATAPINQTYWAQTFVSLIIMP 407

Query: 452 FGVSVLITVTLLAMIAAVPHEHHAATTSI 480
           +G+ +      + +  A+PHEH     S+
Sbjct: 408 WGMDMSFPAATIMISNAMPHEHQGLAASL 436

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 69/155 (44%), Gaps = 25/155 (16%)

Query: 144 LSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIG-GCGLTSLATMIMSDL 202
           +SD LGRK  L  S  ++ IGC I   S  +  +V GR I+G+G G G+ + A M   +L
Sbjct: 88  VSDALGRKCSLHVSCILWCIGCGIQSGSTGVAMLVVGRVIAGVGIGFGVAA-APMYCVEL 146

Query: 203 VPLRDRAVYQGLCNFVFGLGTASGGLV------GAYFRDWRLAFILQCPISVLSGI---L 253
            P R R    G    +F L   +G LV      G  F      F +   + ++ GI    
Sbjct: 147 APPRVRGTVVG----IFQLAVTAGILVLFFIGYGCSFLHSTAVFRVTWALQIVPGIAAFF 202

Query: 254 IVVYLELPPRASASNKDCWSARLRRLDWAGATSLI 288
           ++ ++   PR        W A  RR  W  AT +I
Sbjct: 203 LIFFIPESPR--------WLASHRR--WDDATQII 227

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 77/182 (42%), Gaps = 15/182 (8%)

Query: 97  FLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLV 155
           F ++L    V   L ++  EF  S D  +     YLL       +   L+D  GR+P+++
Sbjct: 80  FWSSLGSPAVYPALRNLQREFGVSEDLVNIAVVVYLLFQGVAPTVCSGLADTYGRRPVIL 139

Query: 156 FSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLC 215
               +F +  +    SNS   V+A R I   G   + ++ + ++ D     +R  + G  
Sbjct: 140 MGMLIFIVSSIGIACSNSFALVIALRCIQSSGISPIIAINSGVVGDFTLKSERGTFIGAV 199

Query: 216 NFVFGLGTASGGLVGAYFR---DWRLAF---ILQCPISVLSGIL--------IVVYLELP 261
           + +  LG A G L+GA      +WR  F    + C +  L+  L        IV  L L 
Sbjct: 200 SGLTLLGQAFGSLIGASLTAAYNWRAVFWFMTIGCGVCFLANFLFLPETHRCIVGNLSLK 259

Query: 262 PR 263
           P+
Sbjct: 260 PK 261

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 88/401 (21%), Positives = 162/401 (40%), Gaps = 48/401 (11%)

Query: 125 WIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLS-----NSIWAVVA 179
           W   SY+L S+    + GKL D  G K ++VF      I  LI G S     N  +   A
Sbjct: 82  WANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTA 141

Query: 180 GRFISGIGGCGL--TSLATMIMSDLVP-LRDRAVYQGLCNFVFGLGTASGGLVGAYFRD- 235
            R + GIG   +   SLA M  +   P L+   ++      +FG+ T++G ++G  F   
Sbjct: 142 -RALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFS-----IFGMMTSTGFVIGTTFSSL 195

Query: 236 -----------WRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGA 284
                      W LA +  C +  +  IL +      P  +  +K       +R D+ GA
Sbjct: 196 FAQLTKWAWNYWALACV--CVLYTVGAILFI------PPDNIVHKPNSKPLYKRFDYLGA 247

Query: 285 TSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFL 344
            + ++ L LF +  +   S++ +            ++   + ++V+ RV  DP++P+  L
Sbjct: 248 ITGVSGLVLFDVAFTQ-ASALGWSPPHTYITLIIGVILILIAMFVDWRV-DDPLVPLQHL 305

Query: 345 RDRSVLGSSLANWFCMMS-MMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGA 403
           R   V+   +  +F  +S ++  N++   Y      +   D   R       +A GS+ A
Sbjct: 306 RADVVV-ILICVYFGFLSFVIWANWFWQFY-----ELVHNDSPLRIAAKLVPLAIGSIPA 359

Query: 404 GLY----MKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQ-YLLQVVPGFGVSVLI 458
            ++    ++   K    ++   V  +   + +  +TP    W Q ++  ++  F V + +
Sbjct: 360 AIFTVTCLQLNIKAPTMMVISMVCFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITV 419

Query: 459 TVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499
               L    +V  E      S+     S   ++G S  A V
Sbjct: 420 PTATLLFSDSVRKESQGIAASLIITVISYAISIGPSYTAMV 460

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 84/374 (22%), Positives = 148/374 (39%), Gaps = 48/374 (12%)

Query: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147
           + FS+FL  +   LDG + S L  +    + +    S +     + ++     Y + SD 
Sbjct: 58  LFFSLFLIAYAYRLDGLVRSKLEAYATDSYGNHSLLSTVNCIKTVMAAGGMVAYARASDM 117

Query: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207
            GR  +L  S  +  +G ++   S+++     G  +  +G  GL  +  +I  D   L  
Sbjct: 118 FGRMEMLAISIVLVVVGTIVECQSDTVSKFATGACLYQLGKAGLALILQVIAVDFSNLNW 177

Query: 208 RAVYQGLCNFVFGLGT-----ASGGLVGAYFRDWRL-----AFILQCPISVLSGILIVVY 257
           R V      +V  L T      SG ++ A   DW       AFI+  P+S +     +V+
Sbjct: 178 RMV----ALYVPALPTIINTWVSGDVISAIGSDWEWGIGMWAFII--PLSCIPLFCCLVH 231

Query: 258 LELPPRASASNK----------DCWSARL-----RRLDWAGATSLIAFLFLFMLTSSMGG 302
           +       A  +            WS  L      RLD  G   ++  L   ++  ++ G
Sbjct: 232 MRYLAHKHAPEQLGKQRQLYSMASWSEYLIEVFFWRLDSVGLILVVGALGCVLVPFTLAG 291

Query: 303 --SSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANW--- 357
             S     +++         V   +FV  E + A  P+ P + L+DR V+ + +  +   
Sbjct: 292 GLSDKWRTAQIIVPEVIGWCVALPLFVLWEAKFARFPLTPRSVLKDRGVIAALVIAFHIH 351

Query: 358 FCMM---SMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSL--GAGLYMKRTGK 412
           FC+      M T   + V+ S     + T      + +F S+  G+L     +Y+KRT K
Sbjct: 352 FCVYMQADYMYTVLVIAVHESVKAAQRIT-----TLFNFVSIITGTLLGFVIVYVKRTKK 406

Query: 413 YYYFLLAFCVLAIA 426
             + L   CV  +A
Sbjct: 407 --FILFGVCVWFVA 418

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 84/415 (20%), Positives = 161/415 (38%), Gaps = 48/415 (11%)

Query: 123 ASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRF 182
           ASW  T+Y ++ +      G++ D +G   L V S  +F+I  LIC + N+       R 
Sbjct: 62  ASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGTFAVFRA 121

Query: 183 ISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRDWRLAF-- 240
           + GI   G+      ++  L    +   +  + +  F      G ++G  F   R+ +  
Sbjct: 122 LQGIAAAGIVPSGYALIPTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFTLTRIGYKG 181

Query: 241 ILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSM 300
           I     +V+  I I+ Y  +    SA+ K C     +   W+ A SL  F+  FM  SS 
Sbjct: 182 IFYLTFAVMLVISIISYFSI--GTSANQKPCTKDSPKTTKWSDALSL-DFIGSFMFISST 238

Query: 301 ---------GGSS---------VAYGSRLFAAMCAATLVFGAVFVYVELRVAADP----- 337
                    GG S         +  G  LF       + +G +     L+ A++P     
Sbjct: 239 ILIVVGLTEGGESWKKPSAYVTLIVGIALFVLFFIWNICYGVL--VKNLKSASNPKVYNY 296

Query: 338 ------VLPVTFLRDRSVLGSSLA---NWFCMMSMMTTNFYLPVYWSSVLGMKATDVGK- 387
                 ++P   L  ++ +  ++A   N+ C+ S    N Y+   +   +   +  +   
Sbjct: 297 FRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFS----NLYIVNQYCQYVSKNSPLLAAV 352

Query: 388 RAMPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAG--QVQIVLITPQMPVWRQYL 445
           + +P   S+   ++   +           +L F ++ I     +Q+ LIT  +  W+ + 
Sbjct: 353 KLLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIILIQLHLITDNL-YWKIFF 411

Query: 446 L-QVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499
             Q +  FG ++    +L  +I   P E+    + +   F   G  +  SV  ++
Sbjct: 412 CSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSI 466

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 118/289 (40%), Gaps = 28/289 (9%)

Query: 86  LIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLS 145
           +I++FS F+  +   L+  I      +  S +      S +     + S+  Q +Y +LS
Sbjct: 66  VILLFSAFVCGYAYGLECNIRYIYTGYATSSYAEHSLLSTVNVINAVVSAASQIIYSRLS 125

Query: 146 DRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPL 205
           D  GR  L + +  ++ +G +I   +  +    AG      G  G+  +  +I+SD   L
Sbjct: 126 DFFGRLTLFIIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGIILILLLILSDFSSL 185

Query: 206 RDRAVYQGLCNFVFGLGTASGGLVGA-----YFRDWRL---AFILQCPISVLSGILIVVY 257
           + R  YQ    + F + T   G V +         W +   AFI   P++ +  I  +++
Sbjct: 186 KWRLFYQFAPTWPFIINTWISGNVTSSANPLVHWSWDVGMWAFIF--PLACIPMIGCMIH 243

Query: 258 LELP----PRASA--SNKDCWSAR---------LRRLDWAGATSLIAFL--FLFMLTSSM 300
           ++      P   A  S K  + A            +LD  G     A L   L  LT + 
Sbjct: 244 MQWKASKTPEWHALRSEKSFYQANGFYKTMTELFWKLDIIGTLLFTACLGCILVPLTLAG 303

Query: 301 GGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSV 349
           G +S    SR+        ++   + V+ E + A DP++P   +RDR V
Sbjct: 304 GTNSKWNNSRVIGPFVLGFVLIPILGVW-EYKWARDPLIPYKLVRDRGV 351

>KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON}
           uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g frt1
           Hexose transporter
          Length = 566

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 85/186 (45%), Gaps = 11/186 (5%)

Query: 85  ILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGK 143
           I++  F+ F GI L+ +D + +S     + +    + D+ S I++   L +     L   
Sbjct: 93  IMLGFFASFAGI-LSGVDQSTISGASYGMKASLKLTSDEDSLISSLMPLGAVGGSILLTP 151

Query: 144 LSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV 203
           LS+  GRK  LV S   + IG ++C  +  +  + AGRF+ G+G         + +++ V
Sbjct: 152 LSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMYAGRFLIGVGVGIEGGGVGVYIAESV 211

Query: 204 PLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----WRLAFILQCPISVLSGILIVVYLE 259
           P   R     L  F   LG   G ++G  F D    WR  ++L   + V S IL V    
Sbjct: 212 PSTVRGSLVSLYQFNIALGELVGYVIGVIFFDVKGGWR--YMLGSSL-VFSTILFVGLFF 268

Query: 260 LP--PR 263
           LP  PR
Sbjct: 269 LPESPR 274

>Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {ON}
           YDR497C (ITR1) - myo-inositol transporter [contig 184]
           FULL
          Length = 578

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 66/142 (46%), Gaps = 9/142 (6%)

Query: 82  SSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFN----SLDKASWIATSYLLSSSTC 137
           S  I+I+ F   +  FL   D   +S+ L  IG++ +    +      I  +  L +   
Sbjct: 67  SPFIIILTFVASISGFLFGYDTGYISSALISIGTDLDNRVLTYGDKEIITAATSLGALIS 126

Query: 138 QPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSL-AT 196
               G  +D  GRKP L+ SN  F IG ++   +++ W +  GR I G  G G+ SL + 
Sbjct: 127 AVAAGTCADIWGRKPCLMISNLFFVIGAVLQVSASTFWQMAVGRLIMGF-GVGIGSLISP 185

Query: 197 MIMSDLVP--LRDR-AVYQGLC 215
           + + ++ P  +R R  V   LC
Sbjct: 186 LFIGEIAPKMIRGRLVVINSLC 207

>KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 481 SYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVH 540
           +Y    T A + ++  + +F  +L   L   + +  S+ H + +L+ I+  A  SS W+ 
Sbjct: 573 NYWKEVTAAGVAITGASILFNVALRKSLWTALEQLVSEEHPQEQLQQILHRALESSHWIQ 632

Query: 541 RSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVS 576
            SAP F + T+         A+F+   TT+ LA ++
Sbjct: 633 HSAPEFAQETIY--------ASFRHNFTTLFLAAIT 660

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {ON}
           Anc_8.272 YDR119W
          Length = 589

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 84/217 (38%), Gaps = 17/217 (7%)

Query: 347 RSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLY 406
           R  L   L N F M++++ T  YLPVY + V       +  R +P + S+        L 
Sbjct: 363 RKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSM----FAVVLI 418

Query: 407 MKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMI 466
             R  K Y   L   ++ + G  Q+  +    P W  ++   +P  GV+ +I       +
Sbjct: 419 QARYAKKYNTSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVI-------M 471

Query: 467 AAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELR 526
           A   +    A   +       G +  + +   +F  +L   L   +++  S+G  ++EL 
Sbjct: 472 ANTKNMRDFAVGIL------VGGSATIILCQGLFTRTLHDTLRDNLLKLQSEGLKKKELL 525

Query: 527 GIIASAARSSDWVHRSAPPFVRATLLECYHFASRATF 563
            I+    ++  W    AP   R  +   +  A    F
Sbjct: 526 KILEKTIKNPQWALIDAPAITRGAITNSFALAIHQIF 562

>Ecym_2317 Chr2 (621407..623080) [1674 bp, 557 aa] {ON} similar to
           Saccharomyces cerevisiae YDR387C
          Length = 557

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 144 LSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIG 187
           L+DR GRKP+L+ S  V     +I  LSNS+  +V GR ISG+ 
Sbjct: 124 LTDRYGRKPILLSSGFVIVFSSVIMALSNSLEVLVCGRLISGVA 167

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 1/121 (0%)

Query: 92  MFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLGR 150
           +FLG  +  ++ + + +L+  + ++++ S   ASW  TSY ++ +      G+L D +G 
Sbjct: 34  IFLGCSIDLINVSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGN 93

Query: 151 KPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAV 210
             L   S   FAI  L+CGL  +  A    R + GI   GL      ++  L P      
Sbjct: 94  SRLFTVSCGCFAILSLLCGLMPNFEAFAVMRALQGIAAAGLVMCGYALIPILSPKEQVQE 153

Query: 211 Y 211
           Y
Sbjct: 154 Y 154

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/336 (20%), Positives = 137/336 (40%), Gaps = 31/336 (9%)

Query: 42  IEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAAL 101
           + +G      T S  +S+++ +DAG   +    + ++  P  R+ +  FS+FL  +   L
Sbjct: 10  VTEGSVAPKDTWSIKTSDSKGKDAGVHNIE-IYADQYKSPYYRVAL-FFSIFLVAYAYGL 67

Query: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161
           DG I  T   +  S ++     S +     + ++  Q  + + SD  GR  +L+ +   +
Sbjct: 68  DGNIRYTFQAYATSSYSQHSLISTVNCIKTVIAAAGQICFARASDVFGRLSILIIAVLFY 127

Query: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221
            +G +I   + ++    AG     +G  G+  +  +I+ D   L  R V   +    F +
Sbjct: 128 VVGTVIESQATNVSRFAAGACFYQLGLTGIILILEVIVMDFSNLNWRLVASFVPALPFII 187

Query: 222 GT-ASGGLVGAYFRDWR-----LAFILQCPISVLSGILIVVYLELPPRASASNKDCWSAR 275
            T  SG +  A   +W       AFIL  P+S +  +  ++++      +A        +
Sbjct: 188 NTWISGDVTSAIGTNWEWGIAMWAFIL--PLSCIPLVCCMLHMRYLAHKNAPENLMSEFK 245

Query: 276 L-RRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATL-------------V 321
           L +++ W  +  L+   F  +    +    V++G  L     A  L             V
Sbjct: 246 LYKQMPW--SEYLVEIFFWKLDFLGLLLLCVSFGLVLIPFTLAGGLQTKWKSASIIVPEV 303

Query: 322 FG-----AVFVYVELRVAADPVLPVTFLRDRSVLGS 352
            G      +F+  E + A +P+ P   ++DR +  +
Sbjct: 304 LGWCLALPLFLLWEGKYARNPLTPWDLIKDRGIFSA 339

>SAKL0G03432g Chr7 complement(282042..283655) [1614 bp, 537 aa] {ON}
           similar to uniprot|Q04162 Saccharomyces cerevisiae
           YDR387C Hypothetical ORF
          Length = 537

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 78/186 (41%), Gaps = 24/186 (12%)

Query: 94  LGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKL-----SDRL 148
           +G  L   D  ++S +L  +  +   L + +      + S ++    +G L     +D  
Sbjct: 47  IGGLLFGYDTGVISGVLISLKPQDLQLTELTNFQKELITSITSAGSFFGSLLAFPTADHW 106

Query: 149 GRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDR 208
           GRK  L F   +FA+  +I  LSNSI  +V GR I G+          + +S++ P + R
Sbjct: 107 GRKYTLAFCCTIFAVAAIIMALSNSIHMLVFGRSIVGVAIGIAAQCIPVYLSEISPTKIR 166

Query: 209 AVYQGLCNFVFGLGTASGGLVGAY----------FRDWRLAFILQCPISVLSGILIVVYL 258
            V   L +        +GG V AY           + WR  F     +S +  ++ ++ L
Sbjct: 167 GVMLTLNSIAI-----TGGQVIAYCISLFLISKQTQAWRYLF----GVSAIPAVIFILLL 217

Query: 259 ELPPRA 264
           +  P +
Sbjct: 218 DFIPES 223

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 84/404 (20%), Positives = 158/404 (39%), Gaps = 36/404 (8%)

Query: 113 IGSEFNS-LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLS 171
           +   FNS   K +W+  S+ L S +   + G++ D  G K  L+    V  I  LICG +
Sbjct: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161

Query: 172 NSIWAVVAGRFISGIGGCGLTSLATMIMSDL------VPLRDRAV--YQGLCNFVFGLGT 223
           N               G G+  +   +M  +        LR   V  + G+C     +G 
Sbjct: 162 NYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA---PIGA 218

Query: 224 ASGGLVGAYF-----RDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRR 278
           A GG+          + W   F      +++  I +V+ +   P    +N   +      
Sbjct: 219 ALGGVWSGLIAHENPKQWPWIFY---AYAIVVAINMVMAIYSIPSTVPTNIHGFG----- 270

Query: 279 LDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPV 338
           +DW G+   +  + LF    + G         + A +  +  +  A F+Y E++ A  P+
Sbjct: 271 MDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY-EIKFAKSPL 329

Query: 339 LPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAF 398
           LP   +++R +    LA +    S     FY   Y++  L ++           F  V +
Sbjct: 330 LPPEVIKNRHIGMILLAVFMGWGSFGIWTFY---YYAFQLNLRHYSAVWAGGTFFMFVIW 386

Query: 399 GSLGA---GLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITP-QMPVWRQYL-LQVVPGFG 453
           G++ A    L +KR G     LL F +        ++ +TP     W+  L +Q++  FG
Sbjct: 387 GTIAAFLVALTIKRVGP--SVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFG 444

Query: 454 VSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGA 497
           + +    + + +   +P ++     S+     +   +L + VG+
Sbjct: 445 MDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGS 488

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 90/226 (39%), Gaps = 15/226 (6%)

Query: 30  ANQIEQQDHLLD-------IEQGRAYGSTT---KSSISSENEREDAGGATVAGCGSAEFY 79
           AN +E++ H L+        EQ      TT   K S S   E  D           A + 
Sbjct: 19  ANHLEKEVHQLNHDGNKHKYEQDAPSRVTTHEMKGSSSESIEGHDIAHDNAPLPQHAPYT 78

Query: 80  LPSSRILIIMFSMFLGI-FLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTC 137
           L S+     M ++     F ++L   I    L  +  +F+ S +  +     YL+     
Sbjct: 79  LLSNAQKWCMVALLTSAGFWSSLGSPIYYPALKQLEKQFSVSEELVNITVVVYLIFQGVA 138

Query: 138 QPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATM 197
             + G L+D  GR+P+++    ++    +    SNS   +V  R +   G   + ++ + 
Sbjct: 139 PTISGGLADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVFLRCLQSAGISPIIAINSG 198

Query: 198 IMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFR---DWRLAF 240
           ++ D    ++R  + G  +    +G A G L+GA      DWR  F
Sbjct: 199 VVGDFTVKQERGTFVGAVSGFTLMGQAFGSLIGAALTAAFDWRAIF 244

>Ecym_2054 Chr2 complement(87646..89100) [1455 bp, 484 aa] {ON}
           similar to the tandem duplicates ADL156C ADL155C
          Length = 484

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 88/215 (40%), Gaps = 38/215 (17%)

Query: 3   QSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSI--SSEN 60
            S+   L   +++  + D  +D      N +E++     +E GR   +    ++  S++N
Sbjct: 6   NSDLQMLAEDLEKQQLGDLESD-----KNSLEKK-----LETGRDGINVQHFTLVLSNDN 55

Query: 61  EREDAGGATVAGCGSAEF---YLPSS--RILIIMFSMFLGIF--------LAALDGTIVS 107
           E +D+       CG  E    Y P    +  +++F  F+GIF        L A++G I  
Sbjct: 56  EGDDSK------CGRYETDDEYYPDGGWQAWLVVFGAFMGIFPIWGMFNSLGAIEGYISK 109

Query: 108 TLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLI 167
             L  +          SWI + +L   S C    G   DR G +  ++   A++ +G   
Sbjct: 110 HQLAGVKPT-----AVSWIFSIHLTVCSACCVFSGAYFDRNGAREAVIVGGALYVLGIFF 164

Query: 168 CGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDL 202
             +   +W  +A    S + GC    L T ++S +
Sbjct: 165 MSMGTEVWHFIAS--FSIMCGCAAGILTTPLISSV 197

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 116/277 (41%), Gaps = 24/277 (8%)

Query: 104 TIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAI 163
           +I++ L    GSE NS    SW+  S+ L S +   + G+L D  G K +L+    +  I
Sbjct: 91  SIMNILSDSFGSEGNS---KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147

Query: 164 GCLICGL---SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV---PLRDRAVYQ---GL 214
             LICG+   S S    +  R   G+G   +      I+ ++      R   V      +
Sbjct: 148 WSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAM 207

Query: 215 CNFVFGLGTASGGLVGAYF-RDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWS 273
                 LG    GL+G    + W  AF      S+ + I  V+ +   P    +N   +S
Sbjct: 208 APIGATLGCLFAGLIGTEDPKQWPWAF---YAYSIAAFINFVLSIYAIPSTIPTNIHHFS 264

Query: 274 ARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVA-YGSRLFAAMCAATLVFGAVFVYVELR 332
                +DW G  S++  + L +L      + ++ +       +   +++F  VF+  E+R
Sbjct: 265 -----MDWIG--SVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIR 317

Query: 333 VAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFY 369
            A  P+LP   ++DR ++   LA +F   S     FY
Sbjct: 318 FAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFY 354

>AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL217W (JEN1)
          Length = 500

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 57/117 (48%), Gaps = 4/117 (3%)

Query: 91  SMFLGIFLAALDGTIVSTLLTHIGSEFN-SLDKASWIATSYLLSSSTCQPLYGKLSDRLG 149
           S FL + + A D  +VS  +  I  + N   D  +W  T  L++ +    +YG + DR G
Sbjct: 49  SAFLALTVEATDFYLVSLNVVSIAQDLNVREDTVTWGITVALMTRTIGAIVYGYIGDRFG 108

Query: 150 RKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGI--GGCGLTSLATMIMSDLVP 204
           ++   + +  + ++  L+ G + S    +A R   GI  GGC  T+ AT  + DL P
Sbjct: 109 QRTSFLINVGMISVLQLVTGFATSFPYFLACRAYFGIELGGCYGTA-ATQCLDDLPP 164

>TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 131/612 (21%), Positives = 241/612 (39%), Gaps = 58/612 (9%)

Query: 17  AMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGAT-VAGCG- 74
           ++ + ST  P  +++  E    L   + G    S +    + E+E +  G    + G G 
Sbjct: 3   SLDETSTATPVDISDLEEGLKALDSGKDGHTSDSNSNVPDAYEHESDCVGDKKYIKGSGV 62

Query: 75  ------SAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIAT 128
                   +++ P  ++++  FS+FL  ++ +LD  +  T      S+F   ++   +  
Sbjct: 63  INIELYKQQYHKPIYKVML-YFSIFLVAYVYSLDSLVRFTYQYQTTSKFRDKNQLRTVNC 121

Query: 129 SYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGG 188
              +  +  Q  + + SD  GR  +L FS  ++ IG +I   +  I    AG  +  +G 
Sbjct: 122 IKTVMGTAGQFGFARCSDIFGRTTVLNFSIILYIIGTIIQCKATDISKFSAGTILYQLGL 181

Query: 189 CGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD-WR-----LAFIL 242
            G+  +  +I SD   L  R     +    F +     G +     D W+      AFI+
Sbjct: 182 IGIQIMLGVIASDFSDLNWRLFASFVPALPFVINIWICGFITQLIGDRWQWGIGMFAFIM 241

Query: 243 QCP-ISVLSGILIVVYLELPP-RASASNKDCWSARLR-----------RLDWAGATSLIA 289
            C  I +   +L + YL     R    N+      L            RLD  G   L A
Sbjct: 242 PCACIPLAFCLLHMRYLAYKNCRGKVQNEFRMYRVLTFRDYIVDIFFWRLDLVGFGLLCA 301

Query: 290 FLFLFMLTSSM-GGSSVAYGS-RLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDR 347
                ++   + GGSS  + + R+        +V   +F+  E + A  P+L   F+ DR
Sbjct: 302 LFGCILIPLVLAGGSSNHWRNFRIIVPEVVGWVVVLPIFLTWEAKGAKHPLLTWDFIEDR 361

Query: 348 SVLGS-SLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLY 406
            +L +  +A +   +  +  ++   V   ++           +  SF  +  G+L  GL 
Sbjct: 362 GILAALIIAFYINFVYHLLGDYLFTVLMITLDQSVLASTRITSSYSFVCIICGTL-IGLV 420

Query: 407 M---KRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLL 463
           +   +RT  +  F +    LA+   V      P MP     L   + G G       T  
Sbjct: 421 IIRARRTKPFIIFGIGCWFLALGLLVHFFGNRPFMPGVTGSL--CLLGLGAGFFTYTTQA 478

Query: 464 AMIAAVP-HEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSE 522
           ++ AA+  H   A  T++  +  S G+ +G ++  A++    T+LL  K+ R  +  HS+
Sbjct: 479 SIQAAIKTHAKMAVVTALYLSIYSIGSAVGSAISGAIW----TNLLPRKIFR--TMNHSD 532

Query: 523 RELRGIIASAARSSDWVHRSAPPF---VRATLLECYHFASR--ATFKFCLTTMVLAGVSC 577
                  A+AA  S  +     P+    R  L E Y +  +       C    +LA  + 
Sbjct: 533 -------ATAAYDSPQLFILNNPWGSPARNGLNEAYSYVQKMLCVVALCFCVPLLA--AA 583

Query: 578 SIIKEHKLHTSI 589
             ++ HKL +++
Sbjct: 584 LFLRNHKLQSTV 595

>Skud_14.21 Chr14 complement(32206..33831) [1626 bp, 541 aa] {ON}
           YNL318C (REAL)
          Length = 541

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 111/290 (38%), Gaps = 41/290 (14%)

Query: 17  AMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSA 76
            +Q P     G++++     ++ LD + GR Y  T K     E   E   G T     + 
Sbjct: 2   TVQIPYQHSSGYISHF---HNNELDSDSGRDYNVTIKYLDVKEESEE---GHTTKSNHND 55

Query: 77  EFYLPSSRILIIMFSMFLGIFLAALD-GTIVS-TLLTHIGSEFNSLD------------- 121
             ++P    LII     LG F+   D GTI   T +      F + D             
Sbjct: 56  SLHIPILLCLIIA----LGGFIFGWDIGTIGGMTNMISFQQRFGTTDVIRDGDTVFISTK 111

Query: 122 -----KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWA 176
                +   I + + +S         K+ D  GRK  + F+  V+ IG  I  +S   W 
Sbjct: 112 QLTDLQVGLIISIFNISCGVGALTLSKIGDWTGRKSGIWFALVVYCIGITIQIVSCGKWY 171

Query: 177 VVA-GRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVG----A 231
            +A GR ++GIG    T L  M +S+  PL+ R     +   +  LG   G ++      
Sbjct: 172 FLALGRAVTGIGVGITTVLVPMFLSENSPLKIRGSMVSMYQLIVTLGILMGNILNFICER 231

Query: 232 YFRD------WRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSAR 275
           +++D      W+L   L    + + G+ +V   E     +    D  SA+
Sbjct: 232 FYKDPTQNIAWQLPLFLGYIWATIIGMSLVYVPESAQYLAKIKNDVPSAK 281

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 114/560 (20%), Positives = 211/560 (37%), Gaps = 84/560 (15%)

Query: 1   MVQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSEN 60
           M  S  S     ++   +Q+ +T+     +NQ       LD  Q  +     K+    + 
Sbjct: 1   MTSSSDSKFDGKINETVLQEQTTE----DSNQFNSSQ--LDSNQPDSNQPDLKNY---DL 51

Query: 61  EREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSL 120
             +DAG   +    + ++  P  R+++  FS+FL  +   LDG++  T      S ++  
Sbjct: 52  YHKDAGVNNIE-VYAEQYSSPIYRVML-FFSLFLVAYAYGLDGSVRYTYQAQATSSYSQH 109

Query: 121 DKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAG 180
              S +     + ++  Q  Y + SD  GR  +L+     +A+G +I   + ++     G
Sbjct: 110 SLLSTVNAITTVIAAAGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVG 169

Query: 181 RFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWRLA 239
                +G  G+     +I  D   L  R     +    F + T  SG + GA  + W+  
Sbjct: 170 SCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWG 229

Query: 240 FILQCPISVLSGI-LIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLF---- 294
             +   I  LS I L    L +   A  + KD   +  R     G  + I  +FL+    
Sbjct: 230 IGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDF 289

Query: 295 ----MLTSSMGGSSVAY------GSRLFAAMCAATLVFG-----AVFVYVELRVAADPVL 339
               +L ++ G   V +        +   A      V G      +F+  E++ +  P+ 
Sbjct: 290 IGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLT 349

Query: 340 PVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPV---YWSSVLGMKATDVGKRA-----MP 391
           P   ++DR +        F ++     NF   +   Y  +VL +   +  K A     + 
Sbjct: 350 PWALIKDRGIF-------FALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLY 402

Query: 392 SFFSVAFGSLGAGLYMK--RTGKYYYF-----LLAFCVL-----------AIAGQVQIVL 433
           SF SV  G+L   + +K  RT  +  F      +AF +L            I G + ++ 
Sbjct: 403 SFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRGSSSSHSGIVGSLCLL- 461

Query: 434 ITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVP-HEHHAATTSISYAFRSTGATLG 492
                            GFG       T  ++ A+V  H   A  T++  A  + G+ +G
Sbjct: 462 -----------------GFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIGSAVG 504

Query: 493 VSVGAAVFRSSLTSLLDAKV 512
            +V  A++ + L   +  ++
Sbjct: 505 AAVSGAIWTNVLPKQISKRI 524

>KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 91/236 (38%), Gaps = 37/236 (15%)

Query: 34  EQQD-HLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPS------SRIL 86
           EQQ    LD         +T S+  S+NE +D      AG    E  LP       S+ +
Sbjct: 4   EQQSVQELDASVSNRSQQSTVSNKVSDNEIKDESYDEQAG---QEITLPKKPISAYSKFI 60

Query: 87  IIMFSMFLGIFLAALDGTIVSTLL--THIGSEFNSLDKASWIATSYLLSSSTCQPLYG-- 142
           I+   +  G F+   D   +S  +  T     F  L+ +      Y LS+     + G  
Sbjct: 61  ILSLCVAFGGFIFGWDTGTISGFVAQTDFLQRFGELNSSG----EYYLSNVREGLIVGIF 116

Query: 143 ------------KLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIW-AVVAGRFISGIGGC 189
                       KL D  GRK  L     ++ +G +IC  S   W     GR ++G+G  
Sbjct: 117 NIGCAFGGIILSKLGDMYGRKIGLTCVTIIYIVGQVICIASVDKWYQYFIGRIVAGLGVG 176

Query: 190 GLTSLATMIMSDLVPLRDR----AVYQGLCNFVFGLGTASGGLVGAYFR--DWRLA 239
           G+  L+ M++S+  P   R    + YQ +C     LG  +      Y     WR+A
Sbjct: 177 GIAVLSPMLISETSPKHLRGTLVSCYQLMCTAGIFLGYCTNYGTSKYSNSVQWRVA 232

>KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 10/122 (8%)

Query: 143 KLSDRLGRKPLLVFSNAVFAIGCLIC--GLSNSIWAVVAGRFISGIGGCGLTSLATMIMS 200
           K+ D  GRK  ++F N ++ IG LIC   + +  +    GR ISG+   G  +L  + ++
Sbjct: 210 KIGDIYGRKIGIIFMNVIYIIGQLICITSMKHKWYQYTIGRIISGLAVGGFMTLIPIFLA 269

Query: 201 DLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD------WR--LAFILQCPISVLSGI 252
           +  P   R +   +  F+  LG   G       +D      WR  L       I + +G+
Sbjct: 270 ETAPKHLRGLAISVGMFMCTLGILLGYCANLGLKDYTTTAQWRIPLGLTFAWAILLFAGV 329

Query: 253 LI 254
           L+
Sbjct: 330 LV 331

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 4/148 (2%)

Query: 97  FLAALDGTIVSTLLTHIGSEFNSLDKASWIATS-YLLSSSTCQPLYGKLSDRLGRKPLLV 155
           F ++L   I    L  + +EF+  ++   I    YLL       + G L+D  GR+P+++
Sbjct: 93  FWSSLGSPIYYPALKELEAEFDVNEELINITVVVYLLFQGIAPTISGGLADVYGRRPIIL 152

Query: 156 FSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLC 215
               ++ I  +    S S  AVV  R +   G   + ++ + +  D     +R  + G  
Sbjct: 153 LGMLIYVIASIGLACSKSYGAVVFLRCLQSAGISPIIAINSGVAGDFTVKSERGTFVGAV 212

Query: 216 NFVFGLGTASGGLVGAYFR---DWRLAF 240
           +    +G A G L+GA      DWR  F
Sbjct: 213 SGFTLMGQAFGSLIGAALTAAYDWRAIF 240

>TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 121/301 (40%), Gaps = 42/301 (13%)

Query: 19  QDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTK-----SSISSENEREDAGGATVAGC 73
           Q  S+ +  F ++  ++  H L ++Q   +  + K     +S   ENE  D   +     
Sbjct: 95  QINSSGVSDFTSSTPQEFSHSLSLKQKNEFQVSEKERLINTSAVDENEFMDVDYSNTLPM 154

Query: 74  GSAEFY---LPSSRILIIMFS----------------------MFLGIFLAALDGTIVST 108
           G    Y   LPS  +  + F                       + L      L  +I + 
Sbjct: 155 GGDRPYPPALPSKDLYEVTFDGADDKLHPFNWSMKEKTITCAILCLDCITITLGSSIFAP 214

Query: 109 LLTHIGSEFNSLDKASWIA-TSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLI 167
            +T I  +++ +   + +  T Y+L  +    LY  LS+  GRK +LV S   FA+    
Sbjct: 215 GVTQISEQYDIITVVAILGITLYVLGFAASPVLYAPLSEIYGRKLILVISGFGFALFQFA 274

Query: 168 CGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLC---NFVFGLGTA 224
              + ++  ++  RF SG+ G    ++   + +D+     R   + +C    FVF +G  
Sbjct: 275 VATAENLQTIMICRFFSGLIGGAPMAVVPAVFADMFDTNFRG--KAICLFSAFVF-IGPI 331

Query: 225 SGGLVGAYF---RDWR-LAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLD 280
            G ++G+Y      WR L +++ C ++ L  +L+ V+++    A+         R    +
Sbjct: 332 LGPIMGSYIVQHTSWRWLNYVVGC-LASLVFVLLCVFVKESHHATILVNKARKMRKETGN 390

Query: 281 W 281
           W
Sbjct: 391 W 391

>NDAI0F02060 Chr6 complement(505217..506725) [1509 bp, 502 aa] {ON}
           Anc_6.155
          Length = 502

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 5/138 (3%)

Query: 142 GKLSDRLGRKPLLVFSNAVFAI-GCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMS 200
           G L++R GRK + + +N  FA+ G L    +N++  ++ GR + GI       + ++ ++
Sbjct: 111 GSLAERYGRKRVNLINNFCFALFGSLCMFTANNVIMLILGRVLVGIAAGVSIVVTSLYIN 170

Query: 201 DLVPLRDRAVYQGLCNFVFGLG---TASGGLVGAYFRDWRLAFILQCPISVLSGILIVVY 257
           D+ P+  R     +      LG   T +  L  A    WR  F +   ++ LS  ++   
Sbjct: 171 DIAPVEWRGALGTMNQLSINLGILLTQTVALKYADVHSWRWIFFVGAFVA-LSNFVLWFK 229

Query: 258 LELPPRASASNKDCWSAR 275
           +E  PR    ++D  SA 
Sbjct: 230 IEESPRWLLGHRDQTSAE 247

>TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {ON}
           Anc_3.84 YDR497C
          Length = 585

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 70/160 (43%), Gaps = 14/160 (8%)

Query: 56  ISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLL----T 111
           I   N+ +D         G + F      IL++     +  F+   D   +S+ L    T
Sbjct: 65  IKPANDEDDTSVMITFNQGVSPF------ILVLTLVASISGFMFGYDTGYISSALISIKT 118

Query: 112 HIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLS 171
            +G E  +      I  +  L +     + G  +D  GRK  ++FSN +F +G ++   +
Sbjct: 119 DLGGEELTYGGKEIITAATSLGALITSLMAGTAADLYGRKACIMFSNVMFLVGAILQATA 178

Query: 172 NSIWAVVAGRFISGIGGCGLTSLAT-MIMSDLVP--LRDR 208
            S W +  GR I G  G G+ SL + + +S++ P  +R R
Sbjct: 179 FSFWQMAVGRLIMGF-GVGIGSLISPLFISEIAPKMIRGR 217

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,892,136
Number of extensions: 1977467
Number of successful extensions: 7726
Number of sequences better than 10.0: 778
Number of HSP's gapped: 7468
Number of HSP's successfully gapped: 812
Length of query: 593
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 478
Effective length of database: 40,294,809
Effective search space: 19260918702
Effective search space used: 19260918702
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)