Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13442g8.273ON74742883e-35
Kwal_YGOB_YDR119W-A8.273ON74742172e-24
SAKL0H16786g8.273ON74751452e-13
TDEL0F040008.273ON62401154e-09
KLLA0F19371g8.273ON80311071e-07
TBLA0F030308.273ON7529949e-06
Ecym_42978.273ON7476904e-05
Kpol_YGOB_YDR119W-A8.273ON7530887e-05
CAGL0B01875g8.273ON7438843e-04
Suva_2.2808.273ON6630833e-04
YDR119W-A (COX26)8.273ON6630800.001
Smik_4.3648.273ON6530780.002
Skud_4.3808.273ON6633750.005
TPHA0A017408.273ON7941730.015
NDAI0J012908.273ON7531690.050
KAFR0G009807.460ON84330700.10
KNAG0H031708.273ON7127630.42
KLLA0F19382gsingletonON7533630.48
KAFR0B054408.273ON6627620.57
ZYRO0D06908g8.273ON7738601.0
NOTE: 2 genes in the same pillar as KLTH0G13442g were not hit in these BLAST results
LIST: NCAS0B03770 KAFR0B02760

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13442g
         (74 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...   115   3e-35
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    88   2e-24
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    60   2e-13
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    49   4e-09
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    46   1e-07
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    41   9e-06
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    39   4e-05
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    39   7e-05
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    37   3e-04
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    37   3e-04
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    35   0.001
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    35   0.002
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    33   0.005
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    33   0.015
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    31   0.050
KAFR0G00980 Chr7 complement(231219..233750) [2532 bp, 843 aa] {O...    32   0.10 
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    29   0.42 
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    29   0.48 
KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...    28   0.57 
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    28   1.0  

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score =  115 bits (288), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 60/74 (81%)

Query: 1  MLSSQILKSVATLQGXXXXXXXXXXXXXXLKGPSSRARKWAVIEAKRLVPAIGMWGAFMG 60
          MLSSQILKSVATLQG              LKGPSSRARKWAVIEAKRLVPAIGMWGAFMG
Sbjct: 1  MLSSQILKSVATLQGVAASQVSRSASRVVLKGPSSRARKWAVIEAKRLVPAIGMWGAFMG 60

Query: 61 AVLGWPFAVRALVH 74
          AVLGWPFAVRALVH
Sbjct: 61 AVLGWPFAVRALVH 74

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 88.2 bits (217), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 49/74 (66%)

Query: 1  MLSSQILKSVATLQGXXXXXXXXXXXXXXLKGPSSRARKWAVIEAKRLVPAIGMWGAFMG 60
          MLSSQIL+SVA LQG               K PSSRAR+WAVIEAKR+VP + MW   M 
Sbjct: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60

Query: 61 AVLGWPFAVRALVH 74
           +LGWPF VRA+VH
Sbjct: 61 IMLGWPFGVRAIVH 74

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 60.5 bits (145), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 1  MLSSQILKSVATLQGXXXXXXXXXXXXXXLKGPSSR-ARKWAVIEAKRLVPAIGMWGAFM 59
          M SSQ+L+S A +                L+    R    WA+ EAKRLVP I +WGA M
Sbjct: 1  MFSSQVLRSTAAIS--RSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASM 58

Query: 60 GAVLGWPFAVRALVH 74
           AVLGWPFAV+ +VH
Sbjct: 59 AAVLGWPFAVKKIVH 73

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 48.9 bits (115), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (67%)

Query: 34 SSRARKWAVIEAKRLVPAIGMWGAFMGAVLGWPFAVRALV 73
          +  ++ WAV EAKRL PAI  WG F+   LGWPFA++  +
Sbjct: 20 NHNSQSWAVSEAKRLTPAILGWGGFLAGCLGWPFAIKHFM 59

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 45.8 bits (107), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 24/31 (77%)

Query: 40 WAVIEAKRLVPAIGMWGAFMGAVLGWPFAVR 70
          WAV EA+RL P I M+G F+ +VLGWPF VR
Sbjct: 37 WAVTEARRLGPTILMYGTFIVSVLGWPFLVR 67

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 40.8 bits (94), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 40 WAVIEAKRLVPAIGMWGAFMGAVLGWPFA 68
          WAV E KR+VP I  W   +   LGWPF 
Sbjct: 31 WAVTEVKRIVPNIAFWATLLSVSLGWPFC 59

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 39.3 bits (90), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 1  MLSSQILKSVATLQGXXXXXXXXXXXXXXLKGPSSR--ARKWAVIEAKRLVPAIGMWGAF 58
          ML S+ILK+V+T+                 +  +S+     W V E KRLVP I +WG  
Sbjct: 1  MLYSRILKAVSTIPKSPMSNIGAR------RAATSKHIGEPWMVTETKRLVPTILIWGGT 54

Query: 59 MGAVLGWPFAVRALVH 74
          M  +L WP   R  + 
Sbjct: 55 MTGILLWPIIFRVYIE 70

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 38.5 bits (88), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 40 WAVIEAKRLVPAIGMWGAFMGAVLGWPFAV 69
          WAV EAKR+ P I  WG  + A+L WPF +
Sbjct: 38 WAVTEAKRVFPTIIGWGTTLTAILSWPFII 67

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 37.0 bits (84), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 32 GPSSRARKWAVIEAKRLVPAIGMWGAFMGAVLGWPFAV 69
          GPS     W + E KRL P +  W +F+   LGWPF +
Sbjct: 35 GPS-----WTIAEIKRLTPTLIGWASFLTVTLGWPFGI 67

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 36.6 bits (83), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 40 WAVIEAKRLVPAIGMWGAFMGAVLGWPFAV 69
          W + E++RL+P +  WGA +   LGWP AV
Sbjct: 28 WMITESRRLIPEVFQWGAVICTCLGWPGAV 57

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 35.4 bits (80), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 40 WAVIEAKRLVPAIGMWGAFMGAVLGWPFAV 69
          W + E +RL+P I  W A +   LGWP AV
Sbjct: 28 WVITEGRRLIPEIFQWSAVLSVCLGWPGAV 57

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 34.7 bits (78), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 40 WAVIEAKRLVPAIGMWGAFMGAVLGWPFAV 69
          W + E +RL+P +  W A +   LGWP AV
Sbjct: 28 WVITEGRRLIPEVFQWSATLSICLGWPSAV 57

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 33.5 bits (75), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 40 WAVIEAKRLVPAIGMWGAFMGAVLGWPFAVRAL 72
          W + E +RL+P +  W A +   LGWP AV  L
Sbjct: 28 WVITEGRRLIPEVLQWSAALSICLGWPGAVYFL 60

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 32.7 bits (73), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 32 GPSSRARKWAVIEAKRLVPAIGMWGAFMGAVLGWPFAVRAL 72
          G S     W + EAKR+ P +  WG+ M  VL WP  ++  
Sbjct: 30 GSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYF 70

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 31.2 bits (69), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 36 RARKWAVIEAKRLVPAIGMWGAFMGAVLGWP 66
          R   W   E +R+ P I  W  F+  VLGWP
Sbjct: 32 RGLPWVSSEIQRVAPTILRWSTFLVVVLGWP 62

>KAFR0G00980 Chr7 complement(231219..233750) [2532 bp, 843 aa] {ON}
           Anc_7.460 YJR089W Added two N bases to correct the
           frameshfit but its position is not clear.
          Length = 843

 Score = 31.6 bits (70), Expect = 0.10,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 39  KWAVIEAKRLVPAIGMWGAFMGAVLGWPFA 68
           KW ++  KR  P +  WG+   +V  WPF+
Sbjct: 106 KWKILNDKRFNPGVSNWGS--DSVFKWPFS 133

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 28.9 bits (63), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 44 EAKRLVPAIGMWGAFMGAVLGWPFAVR 70
          E KR +P + +WG+ +  VL WPF  +
Sbjct: 36 EIKRRIPQVALWGSGLFLVLEWPFFFK 62

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 28.9 bits (63), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 40 WAVIEAKRLVPAIGMWGAFMGAVLGWPFAVRAL 72
          W   E +RL P +  +  F+G ++ WP+ V+  
Sbjct: 31 WTKSETRRLAPNLITYALFIGTMVTWPYWVKEY 63

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score = 28.5 bits (62), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 40 WAVIEAKRLVPAIGMWGAFMGAVLGWP 66
          +  ++AK+ V  I  WG F+   LGWP
Sbjct: 31 YLYLKAKQDVKTIAAWGTFLLVALGWP 57

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 27.7 bits (60), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 19/38 (50%)

Query: 32 GPSSRARKWAVIEAKRLVPAIGMWGAFMGAVLGWPFAV 69
            SS   +W ++EA+RL      W   +  +L WP A+
Sbjct: 23 SKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.134    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,193,322
Number of extensions: 84750
Number of successful extensions: 279
Number of sequences better than 10.0: 20
Number of HSP's gapped: 279
Number of HSP's successfully gapped: 20
Length of query: 74
Length of database: 53,481,399
Length adjustment: 46
Effective length of query: 28
Effective length of database: 48,206,763
Effective search space: 1349789364
Effective search space used: 1349789364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)