Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G12342g8.321ON77477440340.0
Kwal_56.239098.321ON77677425210.0
SAKL0H15598g8.321ON78776018620.0
Suva_10.2208.321ON85481913701e-177
TDEL0F044708.321ON80978013651e-177
Skud_12.1968.321ON85481913661e-177
YLR127C (APC2)8.321ON85381713611e-176
ZYRO0F10340g8.321ON81879013441e-174
Smik_12.1908.321ON85081213441e-173
TPHA0C008308.321ON84281310841e-135
CAGL0M04235g8.321ON78376110231e-127
AGL193W8.321ON7096839871e-122
TBLA0A039208.321ON7327009861e-122
Ecym_42528.321ON6896659811e-121
NCAS0C032808.321ON8117999131e-110
KAFR0H022808.321ON8178258401e-99
KNAG0G024308.321ON7977968346e-99
Kpol_YGOB_Anc_8.3218.321ON5115095854e-66
NDAI0G026008.321ON9118956055e-66
KLLA0D16324g8.321ON6976815553e-60
KAFR0B011507.296ON811153930.016
KLLA0F05467g7.296ON812238890.055
KLTH0H11176g1.343ON77483830.28
TDEL0D031404.138ON754224810.46
KLLA0C18282g4.138ON735138800.62
YJL047C (RTT101)1.343ON842131771.6
Kpol_1039.152.235ON138579771.6
TPHA0P008507.296ON823157762.0
NCAS0A090701.343ON770120752.7
ZYRO0C09438g7.296ON819158709.1
Skud_4.1227.296ON815227709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G12342g
         (774 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...  1558   0.0  
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   975   0.0  
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   721   0.0  
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...   532   e-177
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   530   e-177
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...   530   e-177
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...   528   e-176
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   522   e-174
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...   522   e-173
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   422   e-135
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   398   e-127
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   384   e-122
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   384   e-122
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   382   e-121
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   356   e-110
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   328   1e-99
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   325   6e-99
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   229   4e-66
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   237   5e-66
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   218   3e-60
KAFR0B01150 Chr2 (217323..219758) [2436 bp, 811 aa] {ON} Anc_7.2...    40   0.016
KLLA0F05467g Chr6 (537921..540359) [2439 bp, 812 aa] {ON} simila...    39   0.055
KLTH0H11176g Chr8 complement(957667..959991) [2325 bp, 774 aa] {...    37   0.28 
TDEL0D03140 Chr4 complement(583221..585485) [2265 bp, 754 aa] {O...    36   0.46 
KLLA0C18282g Chr3 complement(1614045..1616252) [2208 bp, 735 aa]...    35   0.62 
YJL047C Chr10 complement(349580..352108) [2529 bp, 842 aa] {ON} ...    34   1.6  
Kpol_1039.15 s1039 (41383..45540) [4158 bp, 1385 aa] {ON} (41383...    34   1.6  
TPHA0P00850 Chr16 complement(172533..175004) [2472 bp, 823 aa] {...    34   2.0  
NCAS0A09070 Chr1 (1794111..1796423) [2313 bp, 770 aa] {ON}             33   2.7  
ZYRO0C09438g Chr3 complement(715107..717566) [2460 bp, 819 aa] {...    32   9.1  
Skud_4.122 Chr4 (219928..222375) [2448 bp, 815 aa] {ON} YDL132W ...    32   9.6  

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score = 1558 bits (4034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 757/774 (97%), Positives = 757/774 (97%)

Query: 1   MTLSDEGRELSEQXXXXXXXXXXXXXXXXXGILTWVNPNEPGSNHQMRPPSLRVKSAIKS 60
           MTLSDEGRELSEQ                 GILTWVNPNEPGSNHQMRPPSLRVKSAIKS
Sbjct: 1   MTLSDEGRELSEQLHSLLHDVDSSLEDDLEGILTWVNPNEPGSNHQMRPPSLRVKSAIKS 60

Query: 61  LLNGVVTSESFIDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSE 120
           LLNGVVTSESFIDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSE
Sbjct: 61  LLNGVVTSESFIDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSE 120

Query: 121 EWCDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLPEILV 180
           EWCDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLPEILV
Sbjct: 121 EWCDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLPEILV 180

Query: 181 DVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRC 240
           DVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRC
Sbjct: 181 DVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRC 240

Query: 241 FEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPS 300
           FEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPS
Sbjct: 241 FEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPS 300

Query: 301 ITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDL 360
           ITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDL
Sbjct: 301 ITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDL 360

Query: 361 SSKNSTSTHMSIASQLSAELRGSHQPISSSTAERGNLPHGKHALSMNPYEPAYQQIIDYY 420
           SSKNSTSTHMSIASQLSAELRGSHQPISSSTAERGNLPHGKHALSMNPYEPAYQQIIDYY
Sbjct: 361 SSKNSTSTHMSIASQLSAELRGSHQPISSSTAERGNLPHGKHALSMNPYEPAYQQIIDYY 420

Query: 421 LHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLES 480
           LHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLES
Sbjct: 421 LHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLES 480

Query: 481 NWVQSLKVVKKKLDFKTYSSAQEFSNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPK 540
           NWVQSLKVVKKKLDFKTYSSAQEFSNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPK
Sbjct: 481 NWVQSLKVVKKKLDFKTYSSAQEFSNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPK 540

Query: 541 FVSYLFWNAHSDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLR 600
           FVSYLFWNAHSDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLR
Sbjct: 541 FVSYLFWNAHSDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLR 600

Query: 601 LADGRDLNYEVTLDEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILRYS 660
           LADGRDLNYEVTLDEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILRYS
Sbjct: 601 LADGRDLNYEVTLDEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILRYS 660

Query: 661 TETSRYSVEERQNVDVKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNL 720
           TETSRYSVEERQNVDVKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNL
Sbjct: 661 TETSRYSVEERQNVDVKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNL 720

Query: 721 GSLKADKIHSFLKMAVPKEIGYSATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774
           GSLKADKIHSFLKMAVPKEIGYSATPSQLQLYLNALVEESKLVKTPNGAFRLAK
Sbjct: 721 GSLKADKIHSFLKMAVPKEIGYSATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/774 (60%), Positives = 587/774 (75%), Gaps = 1/774 (0%)

Query: 1   MTLSDEGRELSEQXXXXXXXXXXXXXXXXXGILTWVNPNEPGSNHQMRPPSLRVKSAIKS 60
           M   DEG  LSEQ                  +LTW+NPNEP SNHQ+RPPSLR+KSAIK 
Sbjct: 1   MIQRDEGHVLSEQLHELLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKI 60

Query: 61  LLNGVVTSESFIDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSE 120
           L+N      +  D+L +Y+IFQTRKHFF +Y SL +FKDVQKLERYYEFP R+V +F+ E
Sbjct: 61  LINENGNGPALTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNRE 120

Query: 121 EWCDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLPEILV 180
           EW +E++GLRNYLI +N     N +LRL QLV EDDF+MACK+YEWLC+AEGRLL  +LV
Sbjct: 121 EWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLTHLLV 180

Query: 181 DVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRC 240
           D +LSKVK FA K+M  AW++RF  +E YNLF++ YWS   +MLQC EDDH++TNEIYRC
Sbjct: 181 DAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRC 240

Query: 241 FEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPS 300
           FEEEFIRIRT Q F IFVTG+P ++PTLLELRSVLKT  KYT+L+TE L QFE++MLNPS
Sbjct: 241 FEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNPS 300

Query: 301 ITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDL 360
           ITTAEILLSYV+AIKSIL +DVSFRYFQLLT+FVRP+LMER DTV TFLYAMLGLDAS+ 
Sbjct: 301 ITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASET 360

Query: 361 SSKNSTSTHMSIASQLSAELRGSHQPISSSTAERGNLPHGKHALSMNPYEPAYQQIIDYY 420
                T  H SIASQLSAEL+ SHQPI  S  ++          S+NP EP YQQ+I++Y
Sbjct: 361 RGPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINFY 420

Query: 421 LHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLES 480
           LHW PEP+DSIQANN   L++K LFDIIVELFDSKD+I+ EFL LFT KLL L+GY+LE 
Sbjct: 421 LHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIGEFLTLFTDKLLDLKGYRLEQ 480

Query: 481 NWVQSLKVVKKKLDFKTYSSAQEFSNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPK 540
           NWV+SLK++K + DFK YS+AQ  SNINNIDVMLRDVKHSEELC+ MH    +S  +IP 
Sbjct: 481 NWVKSLKILKNRFDFKNYSNAQGVSNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPM 540

Query: 541 FVSYLFWNAHSDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLR 600
           F+SYLFWNA S FS LPKD  LP +LE++I  YK  Y  +K GRKLRLH EQS V LQL 
Sbjct: 541 FISYLFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLH 600

Query: 601 LADGRDLNYEVTLDEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILRYS 660
            AD R +++EV++D++ VL+ ++     + ++IV+ T L+ +QV+++L+FW+ +S+LR+ 
Sbjct: 601 FADKRVMDFEVSMDKSSVLACVAETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFD 660

Query: 661 TETSRYSVEERQNVDVKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNL 720
           ++TS YS  ERQ+ D     E Q  +E   A  + D QQQQF++SM+KV PFI+GMLTNL
Sbjct: 661 SKTSLYSSLERQDTDNASEREAQMRAED-QARSAFDSQQQQFVESMEKVWPFIRGMLTNL 719

Query: 721 GSLKADKIHSFLKMAVPKEIGYSATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774
           G+LK +KIHSFLK+AVPKEIG++AT +QL+ YL  LV+E+KLV + N AF+L K
Sbjct: 720 GTLKVEKIHSFLKVAVPKEIGFNATTAQLEAYLRLLVDENKLVCSANNAFKLVK 773

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/760 (47%), Positives = 507/760 (66%), Gaps = 19/760 (2%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFIDLLGKYMIFQTRKHFFLN 90
           G+LTW+NPNEP SNHQ+RPPSLR+K+ IK ++N       F+ LL ++++ QTR HFF N
Sbjct: 31  GVLTWLNPNEPNSNHQLRPPSLRLKNGIKLVVNNEDVPPGFVHLLRQFVLLQTRIHFFSN 90

Query: 91  YQSLLYFKDVQKLERYYEFPTRYVNIFSSEEWCDEMSGLRNYLIRQNSGLKNNIQLRLEQ 150
           + S+  FKD+Q+LE+YYEFP +Y+NIF+ +EW  EM+G R+YL+ +N    +NI+ R+ Q
Sbjct: 91  FNSITSFKDIQRLEKYYEFPLKYINIFTPDEWFIEMNGFRHYLMSKNRIFGDNIKHRVRQ 150

Query: 151 LVHEDDFDMACKIYEWLCQAEGRLLPEILVDVLLSKVKLFASKNMNSAWTQRFTIMEAYN 210
           L+ EDDFDMA KIY WL +  G  L  +L+++L+ K+  F+ +NM   WTQRF +ME +N
Sbjct: 151 LIMEDDFDMAWKIYTWLTETMGHQLVSLLLEILMDKIADFSKQNMMGKWTQRFLVMETFN 210

Query: 211 LFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTLLE 270
            F+T YWS F + L+C EDDHEIT EI+ CFE+EF++IRTS++++I V  +P +KP LLE
Sbjct: 211 TFITKYWSTFAQALRCPEDDHEITTEIFHCFEKEFVKIRTSEIYEICVLEYPHSKPALLE 270

Query: 271 LRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQLL 330
           LR+V+KTS  Y++L+ EFL +FESK++NPS+TT EILLSY+R IKS L VD + RY Q +
Sbjct: 271 LRNVMKTSADYSKLMIEFLSKFESKLMNPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSV 330

Query: 331 TNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSIASQLSAELRGSHQPI--S 388
           T +++PYL ER DTV   LYAML LD S++   N  S +M I ++LS EL+     I  +
Sbjct: 331 TAYIKPYLRERRDTVVHLLYAMLELDESEIDDAN-VSLNMPILTELSKELKDPDFGIEDA 389

Query: 389 SSTAERGNLPHGKHALSMNPYEPAYQQIIDYYLHWNPEPADSIQANNDQALISKELFDII 448
            S + +  L     +      +P  +Q+++Y+L W PEP+D      +   ++K L DI+
Sbjct: 390 DSKSRKNKLMVTDSSPVFKVEKPLCEQVLNYFLQWTPEPSDVAHRKPNNTFVNKSLLDIL 449

Query: 449 VELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKLDFKTYSSA--QEFSN 506
           +++FDSKDV + EFL LFT+KLLGL+ YKLE+ W++ L+++KKK    ++     Q+ SN
Sbjct: 450 LDIFDSKDVFISEFLSLFTKKLLGLKYYKLETKWIKILRLLKKKFGHTSFPQHQFQDTSN 509

Query: 507 INNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDFSALPKDHPLPKEL 566
           INNID+MLRDVK S EL S MHE  GL DR+ PKF+SYLFWN  S   A   D  LP  L
Sbjct: 510 INNIDIMLRDVKTSYELISKMHEVAGLDDRVFPKFISYLFWN--SALEAETSDFQLPGWL 567

Query: 567 EADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYLSSNG 626
           E +I  Y + Y+ +K GR+L L+ +Q  VEL L   DGR ++ EV L++A V+S    + 
Sbjct: 568 ETEIEKYSEVYSQLKPGRRLHLYKDQGTVELDLEFKDGRKISCEVPLNKAAVISCFDQDT 627

Query: 627 ---DGTVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQNVDVKHAVERQ 683
                 VE+IV    ++ + V   L+FW K + + Y    + Y V E    +   +    
Sbjct: 628 ALKGLAVEQIVDNVKMEKALVTSILQFWCKKNAIYYDDRYNTYRVLEYYEPNSALSASTV 687

Query: 684 SSSE-----IVNATD----SVDLQQQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKM 734
            SS+      +N  D    + D QQQ+FI SM K+ PFI+GMLTNLGS+K +KIHSFLKM
Sbjct: 688 ISSKGNTNGGINPMDDQDNAGDKQQQEFIQSMSKIWPFIQGMLTNLGSMKPEKIHSFLKM 747

Query: 735 AVPKEIGYSATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774
           AVPK+IGY+AT +QL+ YLN LV+E KL   PNG+++L K
Sbjct: 748 AVPKDIGYTATVNQLESYLNVLVDEDKLAAVPNGSYKLVK 787

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  532 bits (1370), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 304/819 (37%), Positives = 456/819 (55%), Gaps = 81/819 (9%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIKSLL-NGVVTSE-------------------- 69
            +L W++P++P SNHQ+RPPSLR+K+ IK+L  N   TS                     
Sbjct: 36  SLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTN 95

Query: 70  -----SFIDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIF--SSEEW 122
                 FI    +Y IFQ R HFFL++ S+ Y KD+Q+ E YYEFP RYV+IF  +   W
Sbjct: 96  KELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSIFDLNVNGW 155

Query: 123 CDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLP-EILVD 181
             E++ LR+YL+ +N+  KNN++ RL +L+ +DDFD+A  +  WL  A G L   +++V+
Sbjct: 156 TLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANGSLSSMDLIVN 215

Query: 182 VLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCF 241
            L  K+ +F   NM+  W +RF IME +N F+  YWS F  ++ C EDDHE+T  ++ CF
Sbjct: 216 ALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCF 275

Query: 242 EEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPSI 301
           E  F+RIRT ++FDI V  +P +K TLLEL+ ++K    YT ++T FL  F+  +LNPSI
Sbjct: 276 ESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSI 335

Query: 302 TTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLS 361
           TT + LLSYV+ IK+ L++D + R    +T FV+PY  ER   V   LYA+L L   +L 
Sbjct: 336 TTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAILDLPEEELK 395

Query: 362 SKNSTSTHMSIASQLSAELRGS------HQPISSSTAERGNLPHGKHALSMNPYEPA--- 412
            K S    M     L   L  S      + P S    + G+ P   H         +   
Sbjct: 396 EKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSI 455

Query: 413 -----YQQIIDYYLHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFT 467
                Y+ I++YYL W PEP D I  N   + I   LF+++++LF+S++  + EF  L T
Sbjct: 456 TQSMLYEHILNYYLTWVPEPNDMIPGNIKSSSIKTNLFEVLLDLFESREFFISEFRNLLT 515

Query: 468 RKLLGLRGYKLESNWVQSLKVVKKKLDFKTYSSAQEF--------------------SNI 507
            +L  L+ YKL++ W + LK++++K+   T ++   +                    SNI
Sbjct: 516 DRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTTAPAADADLSNI 575

Query: 508 NNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDF-SALPKDHPLPKEL 566
           N+IDVML D+K SEELC  MHE  GL   I PKF+S L+W  + D  +A      LP  L
Sbjct: 576 NSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNL 635

Query: 567 EADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYLSSNG 626
           E ++  Y   Y+ +K GRKL+L  +Q  +E++L   DGR L  +V+L++  V++  +S  
Sbjct: 636 ENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCSVINQFNST- 694

Query: 627 DG-----TVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQNVDVKHAVE 681
           DG     ++E++ +  N+  +++   L FW++  +L  S E   YSV E    D      
Sbjct: 695 DGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVL--SEENGVYSVIEYSRTDFNQT-- 750

Query: 682 RQSSSEIVNATDSVDLQQQQFIDS-----MQKVLPFIKGMLTNLGSLKADKIHSFLKMAV 736
            Q    + N  ++ +L+ +  ++      +++ LPFI+GML NLG++K +KIHSFLK+ V
Sbjct: 751 -QIEFPMKNENNNNELRDETEVERKCELILERSLPFIEGMLANLGAMKLNKIHSFLKITV 809

Query: 737 PKEIGYS-ATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774
           PK  GY+  T  QL+ YLN L +E KL    NG++ L K
Sbjct: 810 PKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYELEK 848

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  530 bits (1365), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 295/780 (37%), Positives = 457/780 (58%), Gaps = 44/780 (5%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLN------------GVVTSESFIDL---L 75
            +LTW+NPNE  SNH MRPP LR+K AIK  +N            G +      +L   L
Sbjct: 33  ALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDGEINKGPEFELGNQL 92

Query: 76  GKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSE--EWCDEMSGLRNYL 133
            ++ I+Q R HFF ++  +  FKD+Q+LE+YY  P  Y+++F S   EW  E  GLR+YL
Sbjct: 93  RQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFESSGYEWIIERDGLRHYL 152

Query: 134 IRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLP-EILVDVLLSKVKLFAS 192
           + +N    NN++ R+E L  +DDF+   ++ +W+ +A   L   +IL+D++++KVK F  
Sbjct: 153 LNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVEKAHTSLSSKDILLDLIIAKVKQFCD 212

Query: 193 KNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQ 252
            +M   + + + +M+ +N F+  YWS F ++L C +DDH +TN +Y CFE++FIRIRT +
Sbjct: 213 DHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQE 272

Query: 253 VFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVR 312
           VFDIFV  FP +KPT++E+R ++  S  +  ++  FL  FE K+LNPS+TT + LL+YV+
Sbjct: 273 VFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLAYVK 332

Query: 313 AIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSI 372
           ++K+ L +D S RY Q + +FV+    ER D V   LYA+L L    L   +     + +
Sbjct: 333 SVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDLQLDGLVGSHIQVDPVCL 392

Query: 373 ASQLSAELRGSHQPISSSTAERGNLPHGKHALSMNPYEPA--YQQIIDYYLHWNPEPAD- 429
            + L++ELR     I +      NL +    ++   YE    Y++++  +L WNP+P D 
Sbjct: 393 KA-LASELRDPELGIENDIYPDDNLANVATGMAKLNYEGCLPYEEVMQRFLSWNPDPRDM 451

Query: 430 SIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNW-----VQ 484
           + +A + Q+     L DI++ELF+SKD  V EFL L T++LL L+ Y L+ NW     + 
Sbjct: 452 APRAISKQSPSHMSLLDILMELFESKDFFVSEFLKLLTKRLLSLKFYNLDRNWSKCLQLL 511

Query: 485 SLKVVKKKLDFKTYSSAQE--------FSNINNIDVMLRDVKHSEELCSLMHEKLGLSDR 536
             K+ +   +     + Q+        +SNIN+ DVML DVK S ELC  MH+  GL  R
Sbjct: 512 KKKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKLSYELCKQMHQVSGLDQR 571

Query: 537 IIPKFVSYLFWNAHSDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVE 596
           I PKF+SYL+WN   +      D  +P+ L ++   Y + Y+ VK GR L+L  +Q ++E
Sbjct: 572 IYPKFISYLYWNCQLESK---NDFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIE 628

Query: 597 LQLRLADGRDLNYEVTLDEALVLSYLSSNGDGT---VEEIVKQTNLDISQVEKSLKFWVK 653
           L L   DGR L  +VTL++  V+     +        E I    N++IS+V+ +L+FWV+
Sbjct: 629 LDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLMAETISLYLNMEISRVKSALQFWVE 688

Query: 654 SSILRYSTETSRYSVEERQNVDVKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFI 713
             +L Y  +    + E RQ+ ++K A +  S        +++  ++     ++  + PF+
Sbjct: 689 KGVL-YQVDAFYATQESRQDSNIKTA-KSDSVGSFFEKNETIIEEETTLSKTLNAIWPFV 746

Query: 714 KGMLTNLGSLKADKIHSFLKMAVPKEIGY-SATPSQLQLYLNALVEESKLVKTPNGAFRL 772
           +GMLTNLGSLKA KIHSFLK+ VPKE+GY   T SQL+ YLN+LVEE +L  T +G+++L
Sbjct: 747 QGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEERLACTTSGSYKL 806

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  530 bits (1366), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 298/819 (36%), Positives = 459/819 (56%), Gaps = 81/819 (9%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESF------------------- 71
            +L W++PN+P SNHQ+RPPSLR+K+ IK L    V++ S+                   
Sbjct: 36  SLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTN 95

Query: 72  -------IDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIF--SSEEW 122
                  +  L +Y +FQ R HFFL +  ++Y KD+Q+ E YYEFP RYV IF  S  +W
Sbjct: 96  KELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDW 155

Query: 123 CDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLP-EILVD 181
             E++ LR+Y++ +N   KNN+++RL +L+ +DDFD+A  +  WL  A G L   E++V+
Sbjct: 156 SLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFANGSLSSMELIVN 215

Query: 182 VLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCF 241
            L +K++ F   NM+  W +RF IME +N F+  YWS FC ++ C EDDHE+T  ++ CF
Sbjct: 216 ALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCPEDDHELTTTVFNCF 275

Query: 242 EEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPSI 301
           E  F+RIRT ++FDI V  +P +K  LLEL+ ++K    YT ++T+FL  F+  +LNPSI
Sbjct: 276 ESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSI 335

Query: 302 TTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLS 361
           TT + LL YV+ IK+ L++D + R    +  FV+PY  ER   V   LYAML L   +L 
Sbjct: 336 TTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELK 395

Query: 362 SKNSTSTHMSIASQLSAELR----GSHQPISSSTAERGNLP-------HGKHALSMNPYE 410
            K +    M     L   L     G +     S  +    P        GK   + +P  
Sbjct: 396 EKITFKVDMKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLA 455

Query: 411 PA---YQQIIDYYLHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFT 467
                Y+ ++++YL W PEP D I  +   + I   LF+I+++LF+S++  + EF  L T
Sbjct: 456 RQTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYIKTNLFEILLDLFESREFFISEFRNLLT 515

Query: 468 RKLLGLRGYKLESNWVQSLKVVKKKLDFKTYSSAQEF--------------------SNI 507
            +L  L+ YKL+  W Q LK++++++   T ++   +                    SN+
Sbjct: 516 DRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETTAPAADADQSNL 575

Query: 508 NNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDFSALPKDHP--LPKE 565
           N+IDVML D+K SEELC  MHE  GL   + PKF+S L+W  + D +  PKD    +P +
Sbjct: 576 NSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFISLLYWKHNGD-TQNPKDSKFRIPAD 634

Query: 566 LEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYLSSN 625
           LE ++  Y   Y+ +K GR+L+L  +Q  VE++L   DGR L  +V+L++  V++  +S 
Sbjct: 635 LERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNST 694

Query: 626 GDGTVEEIVKQ----TNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQNVDVKHAVE 681
            D  +   +KQ     N+  S++ + L FW++  +L  S E   YSV E  +        
Sbjct: 695 NDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVL--SEEGEVYSVIEYSDTGFSQT-- 750

Query: 682 RQSSSEIVNATDSVDLQQQQFID-----SMQKVLPFIKGMLTNLGSLKADKIHSFLKMAV 736
            Q    + N  ++ +L+ +  ++     ++Q+ LPFI+GML NLG++K +KIHSFLK+ V
Sbjct: 751 -QKDVLMKNVNNNNELRDESEVEKKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKITV 809

Query: 737 PKEIGYS-ATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774
           PK+ GY+  T  QL+ YLN L +E KL    NG++ +AK
Sbjct: 810 PKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEIAK 848

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score =  528 bits (1361), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 305/817 (37%), Positives = 461/817 (56%), Gaps = 78/817 (9%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIKSLL--NGVVTSESFIDL-------------- 74
            +LTW++PN+  SNHQ+RPPSLR+K+ IK L   N   +  S I+               
Sbjct: 36  SLLTWMSPNDAKSNHQLRPPSLRIKNIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTN 95

Query: 75  ----------LGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIF--SSEEW 122
                     L ++ IFQ R HFFL++ ++ Y KD+Q+ E YYEFP RYV IF  +  +W
Sbjct: 96  KELQLQLFSTLKEFYIFQVRYHFFLHFNNINYLKDIQRWENYYEFPLRYVPIFDVNVNDW 155

Query: 123 CDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLP-EILVD 181
             E++ LR+YL+ +N   KNN++ RL++L+ +DDFD+A  + +WL  A G L   E++V+
Sbjct: 156 ALELNSLRHYLLNRNIKFKNNLRTRLDKLIMDDDFDLADNLIQWLKSANGSLSSTELIVN 215

Query: 182 VLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCF 241
            L SK+  F   NM+  W +RF IME +N F+  YWS F +++ C EDDHE+T  ++ CF
Sbjct: 216 ALYSKINKFCEDNMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCPEDDHELTTTVFNCF 275

Query: 242 EEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPSI 301
           E  F+RIRT+++FDI V  +P +K TLLELR ++K    YT ++T FL  F+  +LNPS+
Sbjct: 276 ESNFLRIRTNEIFDICVLAYPDSKVTLLELRKIMKDFKDYTNIVTTFLSDFKKYILNPSV 335

Query: 302 TTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLS 361
           TT + LL YV+ IK+ L++D + R    +T FV+PY  ER   V   LYAML L   +L 
Sbjct: 336 TTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAMLDLPEEELK 395

Query: 362 SKNSTSTHMSIASQLSAELRGSHQPISSSTAERG---------NLP-HGKHALSMN-PYE 410
            K + +  M     L   L  S     ++  +R          NL   GK  L+ + P  
Sbjct: 396 EKINFNVDMKALLSLVDTLHDSDINQDTNITKRDKNKKSPFLWNLKVKGKRELNKDLPIR 455

Query: 411 PA--YQQIIDYYLHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTR 468
            A  Y+ I++YY+ W PEP D I  N   + I   LF+++++LF+S++  + EF  L T 
Sbjct: 456 HAMLYEHILNYYIAWVPEPNDMIPGNIKSSYIKTNLFEVLLDLFESREFFISEFRNLLTD 515

Query: 469 KLLGLRGYKLESNWVQSLKVVKKKLDFKTYSSAQEF--------------------SNIN 508
           +L  L+ Y L+  W + LK++++K+   T +S   +                    SN+N
Sbjct: 516 RLFTLKFYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTAPAADADQSNLN 575

Query: 509 NIDVMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDFSALPK-DHPLPKELE 567
           +IDVML D+K SEELC  MHE  GL   I PKF+S L+W  + D          LP +LE
Sbjct: 576 SIDVMLWDIKCSEELCRKMHEVAGLDPIIFPKFISLLYWKYNCDTQGSNDLAFHLPIDLE 635

Query: 568 ADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYLSSNGD 627
            ++  Y   Y+ +K GRKL+L  ++  VE+QL   DGR L  +V+L++  V++   S  D
Sbjct: 636 RELQKYSDIYSQLKPGRKLQLCKDKGKVEIQLAFKDGRKLVLDVSLEQCSVINQFDSPND 695

Query: 628 G----TVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQNVDVKHAVERQ 683
                ++E++ +  N+   ++   L FW++  +L    E   YSV E   +D   A ++ 
Sbjct: 696 EPICLSLEQLSESLNIAPPRLTHLLDFWIQKGVLL--KENGTYSVIEHSEMDFDQA-QKT 752

Query: 684 SSSEIVNATDSVDLQQQQFID-----SMQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPK 738
           +  EI N+  + +L     I+     ++Q+ LPFI+GMLTNLG++K  KIHSFLK+ VPK
Sbjct: 753 APMEIENS--NYELHNDSEIERKYELTLQRSLPFIEGMLTNLGAMKLHKIHSFLKITVPK 810

Query: 739 EIGYS-ATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774
           + GY+  T  QL+ YLN L +E +L    NG++ + K
Sbjct: 811 DWGYNRITLQQLEGYLNTLADEGRLKYIANGSYEIVK 847

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  522 bits (1344), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 301/790 (38%), Positives = 462/790 (58%), Gaps = 52/790 (6%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSES----------FIDLLGKYMI 80
            +LTW+NPNEP SNHQ +PP+LR+K++IK L+N     E           FI L+ ++ +
Sbjct: 35  SLLTWINPNEPQSNHQCKPPTLRLKNSIKMLVNQYYNMELREDERDTGYLFIQLVRQFYV 94

Query: 81  FQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSS--EEWCDEMSGLRNYLIRQNS 138
           +Q R HFF +  +L  FKDVQ+L +YYEFP +YV IF +  EEW  E  GL +YL+ ++ 
Sbjct: 95  YQVRLHFFASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHK 154

Query: 139 GLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLP-EILVDVLLSKVKLFASKNMNS 197
            L+ N+  RL+ LV EDDFD+A  + +WL ++   +   ++++D+++ K+  F    M  
Sbjct: 155 KLRINVVSRLKDLVMEDDFDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTG 214

Query: 198 AWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIF 257
            W  RF IME +N F+T+YWS FC +L C ED+HE+T  +Y  FE +F+++RT ++FDI 
Sbjct: 215 TWNNRFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIV 274

Query: 258 VTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSI 317
           V  +P +KPTLLELR VL  S  +T+++ EFL  FE ++LNPSI+T   LL+YV+ +K+ 
Sbjct: 275 VGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAF 334

Query: 318 LIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSIASQLS 377
           L +D + R    ++ FV+PY  ER+D V   LYA+L L + +           +  +QLS
Sbjct: 335 LTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLS 394

Query: 378 AELRGSHQPISSS--TAERGNL-----PHGKHALSMNPYEPAYQQIIDYYLHWNPEPADS 430
            EL+     I SS  T  + +L          A  ++P  P Y+ +I  +L W PEP D+
Sbjct: 395 QELKDPEFGIESSFETIPQADLLSRPASTATTAAMLDPRLP-YKSVIKNFLQWTPEPMDT 453

Query: 431 IQANNDQAL-ISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVV 489
           I  N  ++L  S+ L DI++++F+SKD  V EFL L TRKLL L+ Y L+  W   L+++
Sbjct: 454 ISKNYSKSLSASRNLLDILMDMFESKDFFVSEFLSLLTRKLLTLKLYTLDRKWSHCLRLL 513

Query: 490 KKKLDFKTYSS------------------AQEFSNINNIDVMLRDVKHSEELCSLMHEKL 531
           K K      ++                    + SNINNIDVMLRDV+ S ELC  MH+  
Sbjct: 514 KTKFGPAGAAAVVATGIGGGDGGSIDGVRGGDPSNINNIDVMLRDVRGSSELCKRMHQVA 573

Query: 532 GLSDRIIPKFVSYLFWNAHSDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPE 591
           GL  RI PKF+S L+WN   D S+      L  ++  +++ Y + Y+ +K GR L L+ +
Sbjct: 574 GLDQRIYPKFISPLYWN--RDNSSNGWTFQLDPQMALELDKYCQVYSEIKPGRALHLYKD 631

Query: 592 QSIVELQLRLADGRDLNYEVTLDEALVLSYL---SSNGDGTVEEIV-KQTNLDISQVEKS 647
           Q IV L L   DGR    E TL++  V+      ++   G  E+++  +  +D ++   +
Sbjct: 632 QGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARARAA 691

Query: 648 LKFWVKSSILRYSTET--SRYSVEERQNVDVKHAVERQSSSEIVNATDSVDLQQQQFIDS 705
           L+ WV+  +L Y      +R  ++++   ++  + +  +SS+    +   D    +    
Sbjct: 692 LQHWVQEGVLYYDGNAYKTREYLDDQPAENLPASKDSSASSQARTMSPDRD---SRLTSI 748

Query: 706 MQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPKEIGYS-ATPSQLQLYLNALVEESKLVK 764
           +++  PFI+GMLTNLG+LK  KIHSFLK+  PKE+G+S  TPSQL+ YL++LVEE +L+ 
Sbjct: 749 LEQTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEERLIC 808

Query: 765 TPNGAFRLAK 774
           T N  ++L K
Sbjct: 809 TTNDTYKLPK 818

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score =  522 bits (1344), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 297/812 (36%), Positives = 454/812 (55%), Gaps = 71/812 (8%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIK------------SLLNGVVTSESFID----- 73
            +L W +PN+P SNHQ+RPPSLR+K+ IK            S++N   TS S ++     
Sbjct: 36  SLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTN 95

Query: 74  ---------LLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSE--EW 122
                     L +Y IFQ R HFF +++++ Y KD+Q+ E YYEFP RYV IF  +   W
Sbjct: 96  KELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIFDLDINGW 155

Query: 123 CDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLP-EILVD 181
             E++ LR+YL+ +N   KNN++ RL++L+ +DDFD+A  + +WL  A+G L   E++V+
Sbjct: 156 SLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVN 215

Query: 182 VLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCF 241
            L +K+  F    M+  W +RF IME +N F+  YWS F +++ C EDDHE+T  ++ CF
Sbjct: 216 ALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCF 275

Query: 242 EEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPSI 301
           E  F+RIRT ++FDI V  +P +K TLLEL+ ++K    Y  ++T FL  F+  +LNPSI
Sbjct: 276 ESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSI 335

Query: 302 TTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLS 361
           TT + LL YV+ IK+ L++D + R    +T FV+PY  ER   V   LYAML L   +L 
Sbjct: 336 TTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVDLLLYAMLDLPEEELK 395

Query: 362 SKNSTSTHMSIASQLSAELRGSHQPISSSTAERG---------NLP-HGKHALSMNPYEP 411
            K +    +     L   L  S     ++  +R          NL   GK+  S      
Sbjct: 396 EKITFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKVKGKNGPSPTSQTM 455

Query: 412 AYQQIIDYYLHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKLL 471
            YQ I++YYL W PEP D I  +   + I   LF+++++LF+S++  + EF  L T +L 
Sbjct: 456 IYQHILNYYLTWVPEPNDMIPGSVKSSCIKTNLFEVLLDLFESREFFISEFRNLLTDRLF 515

Query: 472 GLRGYKLESNWVQSLKVVKKKL--------------------DFKTYSSAQEFSNINNID 511
            L+ YKL+  W Q LK++++K+                    +    S+  + SN+N+ID
Sbjct: 516 TLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTAPSADADQSNLNSID 575

Query: 512 VMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDF-SALPKDHPLPKELEADI 570
           VML D+K SEELC  MHE  GL   I PKF+S L+W  + D  S+      LP  L+ ++
Sbjct: 576 VMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKEL 635

Query: 571 NNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYLSSNGDG-- 628
             Y   Y+ +K GRKL+L  +Q  VE++L   DGR L  +V+L++  V++   S  +   
Sbjct: 636 QKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSI 695

Query: 629 --TVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQNVDVKHAVERQSSS 686
             T+E++    N+   ++   L FW++  ++  S E   YSV E    D    V +    
Sbjct: 696 SLTLEQLSDSLNITPPRLVHLLDFWIQKGVI--SKENGVYSVIENCETDFD-KVHKDIPM 752

Query: 687 EIVNATDSVDLQ---QQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPKEIGYS 743
           E  N    +  +   +++   ++Q+ LPFI+GML NLG++K +KIHSFLK+ VPK+ GY+
Sbjct: 753 ETENNNRGLRNESEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYN 812

Query: 744 -ATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774
             +  QL+ YL+AL +E +L    NG++ + K
Sbjct: 813 RVSLQQLEQYLSALADEGRLKYIANGSYEIVK 844

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  422 bits (1084), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 264/813 (32%), Positives = 422/813 (51%), Gaps = 69/813 (8%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVT------SESFIDLLGKYMIFQTR 84
            +L W+NPN+P SNHQ++PP++R+K  IK +L  V T       E+   LL  Y IFQ R
Sbjct: 30  SLLDWLNPNDPKSNHQLKPPTIRLKKVIKKILLDVNTLGDYDSIETLNSLLRYYYIFQVR 89

Query: 85  KHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSEE--WCDEMSGLRNYLIRQNSGLKN 142
            +FF N QS+ YFKD+ KLE+YYEFP  +V IF +    W  E++ +R+YL+R N   ++
Sbjct: 90  LNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRS 149

Query: 143 NIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLP--EILVDVLLSKVKLFASKNMNSAWT 200
           N+  RL++LV EDDFD+A +I +W  +A   LL   +I+++ LL K+ ++A K   +AW+
Sbjct: 150 NLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWS 209

Query: 201 QRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTG 260
           QRF IME YN F+  YWS F  +L C EDDHEIT  +Y+ FE++F+RIR+ ++FDI V  
Sbjct: 210 QRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVIS 269

Query: 261 FPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIV 320
           +P +KPT++ELR +L  S   T ++   L +F+ K+LN SI T  IL++Y++ +KS+LI+
Sbjct: 270 YPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLIL 329

Query: 321 DVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSIASQLSAEL 380
           D + RY Q  T+F  PYL ++ D +   L+A+L L   D+ +        ++   LS EL
Sbjct: 330 DPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVKVDQNLLKLLSEEL 389

Query: 381 RGSHQPIS-----SSTAERGNLPHGKHALSMNPY------EPAYQQIIDYYLHWNPEPAD 429
           R SH  I+        ++     +    +S   Y      +  Y QI++  L W PE   
Sbjct: 390 RESHFGINLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQILNRALTWLPESKL 449

Query: 430 SIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVV 489
                + + +  K L DI+  +FD  ++ ++ F+ L  +KL  ++GY LE +WVQ L++ 
Sbjct: 450 VSPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNLEESWVQCLRLF 509

Query: 490 KKKLDFKTYSSAQEFSNI------------NNIDVMLRDVKHSEELCSLMHEKLGLSDRI 537
           K K    +   A   +N+             NIDVML D++ S++L   MH    L +RI
Sbjct: 510 KTKFSPNSLDDAPTSTNLETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRI 569

Query: 538 IPKFVSYLFWNAHSDFSALPKDHPLPKELEADINN----YKKAYTNVKKGRKLRLHPEQS 593
             K +S L+W            + L  +++  + N    Y K Y+ +K GR L L  +QS
Sbjct: 570 NLKIISSLYWQYDMKNEKRKTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQS 629

Query: 594 IVELQLRLADGRDLNYEVTLDEAL-VLSYLSSNGDG--TVEEIVKQTNLDISQVEKSLKF 650
            +E+     D R +  E T +  + +  +L + G    T+EE+   T+  +  ++ SLKF
Sbjct: 630 TIEIDFNFEDNRTVTCECTFENYMSICPFLENEGTSSYTLEELSIITSFGLEDLKISLKF 689

Query: 651 WVKSSILRYSTETSR-----------YSVEERQNVDV------------------KHAVE 681
           W+   IL +  +T R               E  NV+                      ++
Sbjct: 690 WLDQKILYFDGKTYRPLEYLDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTID 749

Query: 682 RQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPKEIG 741
           R S   I   T   D         + K+  ++  +LTNLG    +K+++ L+        
Sbjct: 750 RPSQENITKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQTTSHDTAI 809

Query: 742 YSATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774
              +   L+  +  LVE  +++  PNG ++L +
Sbjct: 810 KKVSSVTLENIVTELVENGQILCLPNGLYQLPE 842

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  398 bits (1023), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 247/761 (32%), Positives = 414/761 (54%), Gaps = 30/761 (3%)

Query: 32  ILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFIDLLGKYMIFQTRKHFFLNY 91
           +L W++P     NHQ++PP+L VK+ I+ LL G       +  +  Y  +Q R +F+  Y
Sbjct: 33  LLQWLDP-AGKKNHQLKPPNLLVKTMIEKLLLGS-NDYQLLSNIQDYYCWQCRVYFYNEY 90

Query: 92  QSLLYFKDVQKLERYYEFPTRYVNIFSSEEWCD-EMSGLRNYLIRQNSGLKNNIQLRLEQ 150
           + +    +++++ER+  FP +Y+ IF      + E+    NYL++ N  + +    RL  
Sbjct: 91  KRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRN 150

Query: 151 LVHEDDFDMACKIYEWL--CQAEGRLLPEILVDVLLSKVKLFASKNMNSAWTQRFTIMEA 208
            + EDDF++A +I ++   CQ +      I++D++L K++ F   +    W +R+ IME 
Sbjct: 151 RMLEDDFELATEIVDYFDYCQTDS---TSIVLDIILDKIEQFCQLHYTRKWNKRYLIMET 207

Query: 209 YNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTL 268
           +N F++ YW     +L C ED+H ITN +Y+ FE++FI IRT+++FDI ++   + +PTL
Sbjct: 208 FNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTL 267

Query: 269 LELRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQ 328
           LELR  + T   +  ++ E L +F  K++NPSI TA+ L  Y+R IK+  I+D S RY Q
Sbjct: 268 LELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQ 327

Query: 329 LLTNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSIASQLSAELRGSHQPIS 388
            ++++V+P+  +R D V   L++MLGLD +D  +   +       + L+ EL+ +   I 
Sbjct: 328 TISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNELKDTE--IC 385

Query: 389 SSTAERGNLPHGK-HALSMNPYEPAYQQIIDYYLHWNPEPADSIQAN--NDQALISKELF 445
           S T E  ++      + S        +Q+I  Y+ W PE   S      +D  L   +LF
Sbjct: 386 SYTEESDDVVDPMIGSFSKEEDSMVLEQVIKRYMEWIPEVPTSFGKGILSDHKL---DLF 442

Query: 446 DIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKLDFKTYSSAQE-- 503
           DI++EL +SK+ +V EF  L T+KLL LRGY L+  W + L ++KK+ D ++  +  E  
Sbjct: 443 DILLELLESKETLVIEFKNLLTKKLLDLRGYTLDKKWSKFLSLLKKRFDNRSTETMDEED 502

Query: 504 FSNINNIDVMLRDVKHSEELCSLMHEKLGLSD-RIIPKFVSYLFWNAHSDFSALPKDHPL 562
            +NIN ID+MLRD+  S ++ + M   L  ++ ++ PK VS L+W+ +SD  +   D  +
Sbjct: 503 LNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDFEM 562

Query: 563 PKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYL 622
             ELE  +  Y + Y+  + G+KL L  +   V L L   DGR ++ + +L +  VL+  
Sbjct: 563 DGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLF 622

Query: 623 SSNGDG--------TVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQNV 674
            S            T+ E+  ++ +   Q+   L++WV   +L +S    R     R   
Sbjct: 623 KSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWKG 682

Query: 675 DVKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKM 734
           D  +A       E V    S    +Q+  + +++ LP+IK +L NLG+LK DK+H+ L+ 
Sbjct: 683 DSTYAAIPDVLEESVVERSSQHEDKQE--NHVERALPYIKDILLNLGTLKIDKLHALLQS 740

Query: 735 AVPKEIGYSAT-PSQLQLYLNALVEESKLVKTPNGAFRLAK 774
           A+PK+  YS     QLQ YL+ LVEE  L    N +++L +
Sbjct: 741 AMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLPQ 781

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  384 bits (987), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 225/683 (32%), Positives = 377/683 (55%), Gaps = 41/683 (6%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFIDLLGKYMIFQTRKHFFLN 90
            +L W++PN+  +NHQMRPPSLR+K++I+ L  G     + + LL +  + Q R+HFF +
Sbjct: 31  AVLEWMDPNDDHNNHQMRPPSLRIKNSIRLLRLGEQAPGTTVGLLRQCAVSQMRQHFFRH 90

Query: 91  YQSLLYFKDVQKLERYYEFPTRYVNIFSSEEWCDEMSGLRNYLIRQNSGLKNNIQLRLEQ 150
           ++ L  + D+ KLERYYEFP RYV +F+ +E   E+ GLR YL+  N G + N++ R+  
Sbjct: 91  WERLEQYTDMVKLERYYEFPLRYVAVFTEDEVAAELVGLRKYLLNGNPGFRANMEARIRA 150

Query: 151 LV-HEDDFDMACKIYEWLCQAEGRLLPEILVDVLLSKVKLFASKNMNSAWTQRFTIMEAY 209
           L+  +DDF+ A ++Y+W+ Q  G  + + +++VL  K+ LF    M+    QR+ IME +
Sbjct: 151 LILQDDDFETAARLYKWIVQGLGHPMVKFVIEVLTQKIALFCRNRMDGNVDQRYLIMEVF 210

Query: 210 NLFVTNYWSVFCRMLQ-CMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTL 268
           N F+   W+ F ++LQ    DD E+ N IYRCFE++FI ++T ++F   +  FP +KP L
Sbjct: 211 NSFIARCWAQFIQLLQFPTADDPELNNLIYRCFEKKFIELKTQELFHQIIPKFPMSKPAL 270

Query: 269 LELRSVLKT-SVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYF 327
           LE++SV+K  + +   L+ +    F  ++L PS+TT EILL YV+ IK +++VD + R  
Sbjct: 271 LEMKSVIKGDTAELDRLVAQIYNDFHKELLVPSVTTVEILLYYVKTIKCLMVVDPTGRSM 330

Query: 328 QLLTNFVRPYLMERHDTVATFLYAMLGLDASDLS---SKNSTSTHMSIASQLSAELRGSH 384
              T+ ++P + ER D + + L A+L LD+ ++    SKN+ + +  + SQLS EL+ S 
Sbjct: 331 NRFTSKLKPKIKERSDLIISVLCAILELDSDEIHEVISKNTLTENPQLLSQLSKELKNS- 389

Query: 385 QPISSSTAERGNLPHGKHALSMNPYEPAYQQIIDYYLHWNPEP-------ADSIQANNDQ 437
              ++ T    +   GK A+    +E    Q++  +L W PEP       A ++ +++D 
Sbjct: 390 ---TALTFHSMSTSKGKAAIYSVAFE-RQDQLVKQFLEWTPEPGPFTADDAKALNSDDDG 445

Query: 438 A---LISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKL- 493
           A    + K++ +++ ++FDS +V++ EF+ L T  +L + GY L + W Q LK V KK  
Sbjct: 446 AETLELPKDVLEVVFQVFDSPEVLINEFIQLVTNHMLQMDGYVLNAKWSQLLKTVMKKYF 505

Query: 494 --DFKTYSSAQEFSNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFW---- 547
             + +   S  E SN+ N+ VM  D++ S    +   +   +   + PK +SYL+W    
Sbjct: 506 KNNKQVLKSMCEESNLVNVFVMWSDLEKSATFQTWSTKLQLVPPNVYPKIISYLYWKIGR 565

Query: 548 -NAHSDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRD 606
            + + D++  P        L A  +  +KA+     GRKLR   +Q  V+LQL   DGR 
Sbjct: 566 RSPYGDYAVAPG-------LAAIFDQMEKAFETRSPGRKLRFQKDQGSVDLQLVFEDGRH 618

Query: 607 LNYEVTLDEALVLSYLSSNGDG-TVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSR 665
            +  V+L +  V+          +V +I   TN+    VE  ++FW    +L  + +   
Sbjct: 619 WSSRVSLPKYTVIDLFQRQACPLSVTDIAAHTNMSPRLVEDIIQFWCHEHVLHLN-KNDL 677

Query: 666 YSVEERQNVDVKHAVERQSSSEI 688
           Y + E  N  +     RQS + +
Sbjct: 678 YEILENHNSAI---ASRQSQASV 697

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  384 bits (986), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 222/700 (31%), Positives = 378/700 (54%), Gaps = 66/700 (9%)

Query: 32  ILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFID-----------LLGKYMI 80
           +L W++PN+P SNH + PP+L++K+ IK +     +S+ + D            L  + +
Sbjct: 36  LLIWLDPNDPNSNHHLHPPTLQLKTIIKQI---TPSSDIYKDPSNSIKNNIQNWLKLFYV 92

Query: 81  FQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSEEWCDEMSGLRNYLIRQNSGL 140
           +Q R +FF    ++  +KD+ KLE+YY+FP +++ +F+ +EWC E+  LR+Y++ QN   
Sbjct: 93  YQVRTYFFKKIDNIRQYKDMIKLEKYYQFPLQFIPLFTFQEWCFELLSLRHYILHQNKEF 152

Query: 141 KNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLPE-ILVDVLLSKVKLFASKNMNSAW 199
              I L L QL+ E+DF+ +  I  W+ + +  LL E  ++D+LL K+ L+  + M   W
Sbjct: 153 TQKIILELRQLIKEEDFETSLDIVTWIREVDSNLLSENFILDILLEKITLYCEQTMKGNW 212

Query: 200 TQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVT 259
           T+R+ +ME YN F+ NYW  F ++L C ED+H+ITN +++ FE++FI+IR  ++F I + 
Sbjct: 213 TRRYLVMETYNTFMMNYWLNFTQLLNCKEDNHKITNILFKYFEKQFIKIRIQEIFKICIL 272

Query: 260 GFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILI 319
            +P TKPTLLELR++L T   + +L+  FL  FE  +L P+I T + LL+Y+R +KS  I
Sbjct: 273 SYPDTKPTLLELRNLLVTYNFFQKLVVNFLSAFERIVLTPTINTIDCLLAYIRTVKSFQI 332

Query: 320 VDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSIASQLSA- 378
           +D S RY   +TN++ P+  ER       L+A+L L   DL +        SI+ +L   
Sbjct: 333 LDPSGRYLYSITNYINPHFRERKMLAPILLHAILALPKIDLENAIYPIKVSSISLKLIIN 392

Query: 379 ELRGSHQPISSSTAERGNLPHGKHALS--------MNPYEP---------------AYQQ 415
           EL      I +++ ++ ++      LS         + Y P                 Q+
Sbjct: 393 ELEDPELGIENTSTKKNSIKKFNEILSPKRFNNHNSSEYLPDLLQNTSSEDSNSTLLVQK 452

Query: 416 IIDYYLHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRG 475
           ++  +L W P P D    +  +   S  L DI++ +F+SK+ ++ EF  L +++LL  + 
Sbjct: 453 VVKQFLTWVPIPNDIATNDTKKLYSSTNLLDILLNIFESKEFLLTEFSKLLSKRLLITKN 512

Query: 476 YKLESNWVQSLKVVKKKL----DFKTYSSAQEFSN--------INNIDVMLRDVKHSEEL 523
           YKLE  W   L++++K+     D  T ++  +  N        I N++VML D+ +S EL
Sbjct: 513 YKLEGKWGACLQLLRKRFSSGSDNYTNTNLADTDNLVNGENLKITNMNVMLSDLNYSSEL 572

Query: 524 CSLMHEKLGLSDRIIPKFVSYLFWNAHSD--FSALPKDHP----LPKELEADINNYKKAY 577
           C + H   G++ R+ PKF+S  +W    D   S  P +      +P  L      Y K Y
Sbjct: 573 CKIFHHANGVNTRVYPKFISSHYWVDLDDENVSNGPNEETNHFQIPPSLLGYFEEYAKLY 632

Query: 578 TNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSY-------LSSNGDGTV 630
            ++ +GRK+ + P + ++E++L   DGR L  + TL +  +L Y       + +N   TV
Sbjct: 633 EDLNEGRKVDIWPNEGVIEIKLSFEDGRVLEIDATLPQYALLQYIQEKNAIMQNNQGFTV 692

Query: 631 EEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEE 670
            E+    NL +  V + + FW+K ++L+   +  +YS+ E
Sbjct: 693 NELSVPLNLSLQNVTELVDFWLKKNVLKKVDD--KYSILE 730

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  382 bits (981), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 227/665 (34%), Positives = 375/665 (56%), Gaps = 29/665 (4%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFIDLLGKYMIFQTRKHFFLN 90
            +LTW+NPN+  +NHQMR PSLR+K++IK L          + LL ++ + Q R HFF N
Sbjct: 31  NLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVFLLQLLRQWTLSQLRYHFFHN 90

Query: 91  YQSLLYFKDVQKLERYYEFPTRYVNIFSSEEWCDEMSGLRNYLIRQNSGLKNNIQLRLEQ 150
           ++SL+ +KD+ +LERYYEFP +YV +F++EE  +E+ GLR YL+ +NS  +NN++ R+  
Sbjct: 91  WESLMQYKDMLRLERYYEFPLKYVGLFTAEELSNELIGLRKYLLNRNSTFRNNMESRIRV 150

Query: 151 LV-HEDDFDMACKIYEWLCQAEGRLLPEILVDVLLSKVKLFASKNMNSAWTQRFTIMEAY 209
           L+  EDDF+M+ K+Y+W+ Q  G  + + ++D+L +K++LF    M     Q+  I E +
Sbjct: 151 LILEEDDFEMSSKLYKWMVQGLGHPMVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVF 210

Query: 210 NLFVTNYWSVFCRMLQC-MEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTL 268
           N F+   W+ F ++LQ   EDD E+ N IYRCFE +FI ++T ++FD  +  FP +KP+L
Sbjct: 211 NAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSL 270

Query: 269 LELRSVLKTSVKYTE-LITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYF 327
           LE++SV+K + +  + L+ +    F S++L PS+TT EILL YV+AIK +++VD + R  
Sbjct: 271 LEMKSVIKGATEELDRLVAQICNDFHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSM 330

Query: 328 QLLTNFVRPYLMERHDTVATFLYAMLGLDASDLS---SKNSTSTHMSIASQLSAELRGSH 384
              T  ++P + ER D + T L A+L L   ++    SKN+ + +  +  QLS EL+ S 
Sbjct: 331 NRFTFKLKPKIKERSDLITTVLCAILELTKDEIHEVISKNTLTENPQLLDQLSKELKNS- 389

Query: 385 QPISSSTAERGNLPHGKHALSMNPYEPAYQQIIDYYLHWNPEPAD-----SIQANND--- 436
             ++  +          ++++     P  +Q    +L W PEP       S   NND   
Sbjct: 390 TALNFHSVTTIKSKAAIYSVAQERQNPLVKQ----FLEWTPEPGPFNEDISKLGNNDTDD 445

Query: 437 --QAL-ISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKL 493
             + L + K++ +++ ++FDS ++++ EF+ L T  +L + GY L + W Q LK + KK 
Sbjct: 446 TTETLELPKDVLEVVFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKKY 505

Query: 494 ---DFKTYSSAQEFSNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAH 550
              + +   S  E SN+ N+ VM  D++ S    +   +   +   + PK +SYL+W   
Sbjct: 506 FKNNKQVLKSICEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYWKIS 565

Query: 551 SDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYE 610
               +L  D+ +   L       +KA+     GRKLR   +Q  VE+ L   DGR  + +
Sbjct: 566 R--KSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRHWSNK 623

Query: 611 VTLDEALVLSYLSSNGDG-TVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVE 669
           V+L +  V+        G    +IV+QT++    VE  +++W +  +L YST    Y + 
Sbjct: 624 VSLPKYTVIELFQKVPRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVL-YSTGDDCYRIL 682

Query: 670 ERQNV 674
           ER +V
Sbjct: 683 ERADV 687

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  356 bits (913), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 242/799 (30%), Positives = 401/799 (50%), Gaps = 75/799 (9%)

Query: 31  GILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFIDLLGKYMIFQTRKHFFLN 90
            +L W++PN      Q +PP+L +K  I  L  G    E F   L +Y ++  + HF  N
Sbjct: 28  SLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQDEKFKMWLREYYLYVVKFHFMKN 87

Query: 91  YQSLLYFKDVQKLERYYEFPTRYVNIFSSEEWCDEMSGLRNYLIRQNSGLKNNIQLRLE- 149
              +   KD + LE  Y +P +++++  S +  + +   ++YLI +N   + N+  + + 
Sbjct: 88  VDEISVLKDFKLLEMIYIYPLQFMDLVDSTDISNLVKSFKHYLIDKNVTFRKNLITKFKD 147

Query: 150 ------QLVHEDDFDMACKIYEWLCQAEGRL-LPEILVDVLLSKVKLFASKNMNSAWTQR 202
                 Q   E +F    +I  W+  +EG L   ++++D  L+K+++FA + M     Q+
Sbjct: 148 CFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQK 207

Query: 203 FTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFP 262
           F +ME +N F+  YW    +++  +EDDH++TN IY+ FE +FI+IR  ++  I V  +P
Sbjct: 208 FIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYP 267

Query: 263 TTKPTLLELRSVLKTSVKYT---------------ELITEFLYQFESKMLNPSITTAEIL 307
            TKPT+LEL+S+L      T               +L+ +FL  F+ + LNP I T ++L
Sbjct: 268 QTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVL 327

Query: 308 LSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERH-DTVATFLYAMLGLDASDLSSKNS- 365
            +YV+A KS L++D S      +  FV+PYL     + V   LYA+L L + DL   N  
Sbjct: 328 NAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCE 387

Query: 366 -TSTHMSIASQLSAELRGSHQPISSSTAERGNLPHGKHAL--SMNPYEPAYQQIIDYYLH 422
            T+  M     LS EL   H   +     +   P G +    S  PYE  Y      +L+
Sbjct: 388 KTTYDMRSIELLSKELSNDHSKHAGDVDYKKFSPEGTNEFENSTLPYEQVYTD----FLN 443

Query: 423 WNPEPADSIQANNDQ--ALISKEL--FDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKL 478
           W P      +++ND   A + K +   D +    +SKD ++ EFL L T KLL ++GY++
Sbjct: 444 WKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKLLHMKGYEV 503

Query: 479 ESNWVQSLKVVKKKL--DFKTYSSAQEFSNINNIDVMLRDVKHSEELCSLMHEKLGLSD- 535
           E  W + LK+++ K+  D    +     S+IN I +ML D+  S+E  +    +   S  
Sbjct: 504 EDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIMLHDISISKESSNEKISEFQNSSE 563

Query: 536 -RIIPKFVSYLFW--NAHSDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQ 592
            ++ PKF+S L+W     S++       PL  +L   ++ Y K+Y +   G KL+L    
Sbjct: 564 MQLFPKFISKLYWKFKRQSEYQ-----FPLDSKLRKKLSKYMKSYHHSHPGMKLKLVNGT 618

Query: 593 SIVELQLRLADGRDLNYEVTLDEALVLSYLSSNGDG-----TVEEIVKQTNLDISQVEKS 647
            I  L L   DGR L+ + T ++  VLS   ++ D      ++ ++     +D  +V   
Sbjct: 619 GICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLSINQLSTMLKMDPERVRAH 678

Query: 648 LKFWVKSSILRYSTETSRYSVEERQNVDVKHAVERQSSSEIVNATDSVDLQQQQFI---- 703
           L+FW+   +L +  +   Y+++E  N       +  SS   V  +  + L Q++      
Sbjct: 679 LQFWINKKVLCH--QNDYYTIQEYLN------NQELSSGPTVITSSILPLSQERMPFKRS 730

Query: 704 ----------DSMQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPKEIGYS-ATPSQLQLY 752
                     + + +V P+I  M TNLGSLK DKIHSFL M+VP+ + YS  T +QL+ Y
Sbjct: 731 VPTNVLNDPKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAY 790

Query: 753 LNALVEESKLVKTPNGAFR 771
           L+ LVEE +L+  P+G+F+
Sbjct: 791 LDQLVEEEQLIVLPDGSFK 809

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  328 bits (840), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 234/825 (28%), Positives = 398/825 (48%), Gaps = 116/825 (14%)

Query: 32  ILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFIDLLGKYMIFQTRKHFFLNY 91
           +L W++P E    HQ +PPSLR+K +I+ +      S  F + L K  I   R  F ++Y
Sbjct: 23  LLLWLSPAE----HQCKPPSLRIKKSIQRIRECFQLSSDFTNCLVKLYIDLIRFEF-ISY 77

Query: 92  Q----SLLYFKDVQKLERYYEFPTRYVNIFSSEEWCDEMSGLRNYLIRQNSGLKNNIQLR 147
                + L F DV KLE   E P  ++     E +   +  LR+YL+  +   K  +   
Sbjct: 78  MKENANCLKFNDVLKLENRIEHPRLFIPELEFE-YFKNLHMLRHYLLDSDKSFKTALCTS 136

Query: 148 LEQLVHEDDFDMACKIYEWLCQAEG-RLLPEILV-DVLLSKVKLFASKNMNSAWTQRFTI 205
           +E L+ EDDF  A  I +W+  A    L P+ LV D+L+ K+    S ++  +WT+RF +
Sbjct: 137 IENLIMEDDFYSATIILDWIDSAYSIDLSPKDLVLDMLVKKIAGICSGSIRGSWTRRFIV 196

Query: 206 MEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTK 265
           +E +N F+  YWS F ++L+C E+DHE+T  +++CFE EFI IR +++F+IF + +P +K
Sbjct: 197 IETFNDFIEVYWSHFAQLLKCPENDHELTKTVFKCFEREFINIRINEIFEIFTSAYPESK 256

Query: 266 PTLLELRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFR 325
           PT+LELR V+K       L   FL  F+ +MLNP +TT + L SY++AIK  L++D + R
Sbjct: 257 PTILELRKVMKAPKDLQRLTYTFLDTFKDEMLNPCVTTIDALTSYLKAIKGFLLLDPAGR 316

Query: 326 YFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSIASQLSAELR---- 381
           Y  L+T FV+PY  ++ D +   LYA+L L   D    N   +++   ++LS ++R    
Sbjct: 317 YLNLVTTFVKPYFQDKSDLINILLYAILDLKPKDFEDLN--ISYIPGLNKLSLDMREDPE 374

Query: 382 -----------GSHQPISSSTAERGNLPHGKHALSMNPYEPAYQQIIDYYLHWNPEP--- 427
                         + + +  +   N  H K  L  +        I+  ++ W PEP   
Sbjct: 375 FSIENVEPNDNNYKRTVPNLESIGANSLHDKGTLIQD-------HIMKQFMMWVPEPNMN 427

Query: 428 ---------ADSIQANNDQALISK-----ELFDIIVELFDSKDVIVREFLGLFTRKLLGL 473
                     D  + NND   ++       L DI+++LF+SK++ + +F+ L T K   L
Sbjct: 428 NLENDHDNGNDFEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIFIGKFVNLLTIKFFKL 487

Query: 474 RGYKLESNWVQSLKVVKKKLDFKTYSSAQEFS---------------------------- 505
           + Y+++ NW + L+++  K +    S  ++                              
Sbjct: 488 QNYRVDPNWQKCLELINSKFNSSNISMDEKMEEDVAIGTVNPTNENYVDEKRKTNASNDM 547

Query: 506 -----NINNIDVMLRDVKHSEELCSLMHEKL---GLSDR---IIPKFVSYLFWNAHSD-- 552
                ++N I+VML D++HSE+    +  +L   GL      I PKF+S L+W+   +  
Sbjct: 548 EEIQISLNKIEVMLNDIRHSEKFSFQISSELNRYGLRSNNVGIKPKFISPLYWDYEDNEL 607

Query: 553 -FSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEV 611
             +   K++   +E    I  Y   Y ++ KG  L     + ++E+++   DG    + V
Sbjct: 608 GVNNFLKENVFDEECTKAILQYASEYCSINKGFALHYCKGKEMIEVEISFNDGAIKGFLV 667

Query: 612 TLDEALVLS-YLSSNGDGTVEEIVKQTNLDISQVE--KSLKFWVKSSILRYSTETSRYSV 668
              +  VL+ + + N   T+E I+       S+ E   +LKFWV+ ++L Y  E   Y  
Sbjct: 668 NASQYYVLTLFDTGNEKLTIESILTAGEAKRSKNEIIDALKFWVEKNVLVY--EGGYYYS 725

Query: 669 EERQNVDVKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNLGSLKADKI 728
            +       H++E    +      D +          +++ LP+IK ML + G+L A +I
Sbjct: 726 RDL------HSIENSKGNTTTRTDDLL----------VKEALPYIKTMLESFGNLSASRI 769

Query: 729 HSFLKMAVPKEIGYSATPSQLQLYLNALVEESKLVKTPNGAFRLA 773
            +FLK  +P         + +   L+ LV +  L K  +G+++LA
Sbjct: 770 QNFLKATLPAAQDSDHIITDIHSVLDTLVSDGILFKNSSGSYKLA 814

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  325 bits (834), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 236/796 (29%), Positives = 394/796 (49%), Gaps = 80/796 (10%)

Query: 32  ILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFIDLLGKYMIFQTRKHFFLNY 91
           ++ W++P      H   PPSLR+K AI+S+L       S +D   K       K  +L  
Sbjct: 28  VMGWIHPQA----HACHPPSLRMKKAIRSVLGKA----SELDRQFKIYYIDVIKQEYLCD 79

Query: 92  QSLLYFKDVQKLERYYEFPTRYVNIFS-SEEWCDE--MSGLRNYLIRQNSGLKNNIQLRL 148
           Q    FK +Q LE    +P  Y+   S S++   E  +  LR+YL+  +  L+N++    
Sbjct: 80  QVKREFKHIQVLESKLVYPVTYLPFLSISDQLAIEQTICSLRHYLVDNDDNLRNSLVAEF 139

Query: 149 EQLVHEDDFDMACKIYEWLCQAEGRLLP--EILVDVLLSKVKLFASKNMNSAWTQRFTIM 206
           E L+ +DDF+   +I EWL  A  +LL    + +D ++SK+       M   W  +F +M
Sbjct: 140 ETLMQDDDFESGYQIIEWLYTANAKLLRPWNLALDTIVSKISTLCDNEMRRNWEAKFLVM 199

Query: 207 EAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKP 266
             +N F+  YWS   + L   ED+H+ T  +Y+CFE+EF+RIRT ++F+I V  +   K 
Sbjct: 200 NTFNKFINLYWSHLAKFLHLSEDNHDFTKVLYKCFEKEFVRIRTEEIFEIVVESYQAAKT 259

Query: 267 TLLELRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRY 326
           T+LELR+ +    + ++L+ +FL QF+ K+LNPS+ T E L++++R++K  +I+D   R+
Sbjct: 260 TILELRTFMSGYERLSKLVNQFLKQFKIKVLNPSVNTVEALVAFIRSVKCFVILDPRARH 319

Query: 327 FQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSIASQLSAELR----- 381
              +TNFV+P+  +R D V   LYA+  LD  D+  +    + +   S+LS ELR     
Sbjct: 320 MHTITNFVKPFFHQRGDAVQIILYAI--LDLRDVDFEKMGVSPVKGLSELSHELREDPYV 377

Query: 382 --GSHQPISSSTAERGNLPHGKHALSMN--------PYEPAYQQIIDYYL-----HWNPE 426
              +     + +  + + PH   + SM+          +  Y+Q+++ +        N  
Sbjct: 378 NINAKCQTPTPSPSKISSPHLNDSSSMDVDDKLDDGTTDLVYKQVLNQFXXRGHHETNQG 437

Query: 427 PADSIQANN--DQALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQ 484
             D +  N    Q      L D + ELFD KD ++  FL L T KL  L GY LE NW +
Sbjct: 438 TRDYVGVNVKFSQRSNRTNLLDPLFELFDKKDELLSCFLKLLTLKLFKLSGYTLEPNWNE 497

Query: 485 SLKVVKKKLDFKTYSSAQEFS-----------------NINNIDVMLRDVKHSEELCSLM 527
             +++K+K+           S                 ++N IDVML D++ + ++   +
Sbjct: 498 CYQLIKRKVTKGDVGDGGPLSRDTADAPVSSNNEQVLLSLNKIDVMLHDLRENAKITRRL 557

Query: 528 HEKLGLSDRIIPKFVSYLFWNAHSD--FSALPKDH-PLPKELEADINNYKKAYTNVKKGR 584
           H    L+  + PKF+S  +W+   D    A  +D   +   LE DI  Y   +  +K GR
Sbjct: 558 HRTSMLNGNVFPKFISSQYWSYRDDTFTKAGNRDQIKIDPVLETDILQYGGRFCELKYGR 617

Query: 585 KLRLHPEQSIVELQLRLADGRDLN-YEVTLDEALVLSYLSSNGDG---TVEEIVKQTNLD 640
            +RL  E++I E++L + DG     ++V   +  V+   ++ G     T  E+ +   +D
Sbjct: 618 MVRLCKEKTIFEIELTVNDGEVPQVFKVDAMKYSVIEKYATGGPRAGYTPTELCELCGMD 677

Query: 641 ISQVEKSLKFWVKSSILRYSTETSRYSVEERQNVDVKHAVERQSSSEIVNATDSVDLQQQ 700
           I+ V+ SL +WV + +LR S+     S  E              +    N    ++   +
Sbjct: 678 IADVQTSLTYWVNAGLLRLSSSGYYESTSE--------------TGPPPNRGTPLEASTR 723

Query: 701 QFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPKEIGYSATPSQLQL--YLNALVE 758
           +F+D +  V  FI+GML +LG+L   +IH +L   VP  I Y  T + LQL  YL+  V+
Sbjct: 724 EFLDGV--VWTFIRGMLESLGTLSCAEIHEYLAATVPATIRYQETVTMLQLQGYLDYNVQ 781

Query: 759 ESKLV-KTPNGAFRLA 773
            + L+ +TP G ++L+
Sbjct: 782 STHLLQQTPEGEYKLS 797

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  229 bits (585), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 168/509 (33%), Positives = 272/509 (53%), Gaps = 37/509 (7%)

Query: 297 LNPSITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLD 356
           +NPSITT + L++YV+ +KS L +D S +Y   ++ FV PYL ER+D V+  LYA+L L 
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERNDLVSVLLYAILDLQ 60

Query: 357 ASDLSSKNSTSTHMSIASQLSAELRGSHQPISSSTAERGNLPHGKHALSMNPYEPA---- 412
           + +   +            LS ELR     I        N+   K+ L+  P   +    
Sbjct: 61  SENFQEEAQNILDADSLVILSDELRDPEFGIEGEL----NIDLDKNELTGQPSNKSGDSS 116

Query: 413 --YQQIIDYYLHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKL 470
             Y+Q+I   L+W PE +           + K L DI++E+F++ +V + EFL L T+KL
Sbjct: 117 LLYRQVITQMLNWVPESSKIDSKRQKMIGLRKNLLDILLEIFENNEVFIAEFLKLLTKKL 176

Query: 471 LGLRGYKLESNWVQSLKVVKKKLDFKTYSSAQEFSN-----------INNIDVMLRDVKH 519
           L L+ YKL+S W + LK++K+K    +  +    +N           INNIDVML D+K 
Sbjct: 177 LKLKYYKLDSRWSKCLKLLKEKFKGNSAGTTSISTNIGNVTGSDLVYINNIDVMLWDLKT 236

Query: 520 SEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDFSAL---PKDHPLPKELEADINNYKKA 576
           S +L S MH+  GL  RI PKF+S L+W+   +  +     K   +   L   +  Y + 
Sbjct: 237 SGDLTSRMHQIEGLDRRIQPKFISSLYWDQAKESKSKGNNAKQTQIDPLLSTQLEKYIRV 296

Query: 577 YTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYLS---SNGDGTVEEI 633
           Y+ +K GR L L  +   VEL+    DGR ++ + TL+++ +++Y S   S    ++E++
Sbjct: 297 YSELKPGRTLHLLKDHGTVELEFTFEDGRTISCDATLEQSNIINYFSEAVSENGLSLEQL 356

Query: 634 VKQTNLDISQVEKSLKFWVKSSILRYSTETSRY--SVEERQNV--DVKHAVERQSSSEIV 689
              + ++ + ++K L+FWV   +L +  +  R    +++ + +   + H  E     + +
Sbjct: 357 HILSGIESTGLKKILQFWVDEKVLYFDGQLYRILEYLDQPEIIVQSLTHTGEVLKEEQKL 416

Query: 690 NA-----TDSVDLQQQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPKEIGY-S 743
           N        S   Q  +  +++  V P+IKGMLTNLGSLK +KIHSFL+  VPK++ Y S
Sbjct: 417 NPLSSSSITSDIDQMNKIHETLNNVWPYIKGMLTNLGSLKLEKIHSFLRATVPKDVNYNS 476

Query: 744 ATPSQLQLYLNALVEESKLVKTPNGAFRL 772
            T S L++YLN+LVE+  L    +G++RL
Sbjct: 477 ITVSSLEVYLNSLVEDDVLELLASGSYRL 505

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  237 bits (605), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 237/895 (26%), Positives = 399/895 (44%), Gaps = 168/895 (18%)

Query: 32  ILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFIDLLGKYMIFQTRKHFFLNY 91
           +L W+NPNE  +       ++ +K+ I  +++     +    L  KY  F  + HF  + 
Sbjct: 33  MLLWLNPNETTTQSATTM-TIDLKNCINIIVSTYGKDDQIRLLFKKYYSFVIKLHFMKDN 91

Query: 92  --QSLLYFKDVQKLERYYEFPTRYV-NIFSSEEWCDEMSGLRNYLIRQNSGLKNNIQLRL 148
             +++   ++  KLE  Y  P R+  ++  + E    ++  + YLI  N   + N+   +
Sbjct: 92  RPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINNNFTFRKNVLHSM 151

Query: 149 EQL-VHEDDFDMAC------KIYEWLCQAEGRLLP-EILVDVLLSKVKLFASKNMNSAWT 200
           E L + ED F+         +I  WL  A G + P ++L+D+LL K++ F  + M   W 
Sbjct: 152 ETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIDLLLDLLLRKIEKFCQREMAGLWN 211

Query: 201 QRFTIMEAYNLFVTNYWSVFCRMLQC-------MEDDHEITNEIYRCFEEEFIRIRTSQV 253
            RF IME +NLF+  YW +  ++          +E+DH +TN IY  F ++FI+IR ++ 
Sbjct: 212 GRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRINES 271

Query: 254 FDIFVTGFPTTKPTLLELRSVLKTSV---------------------KYTEL-ITEFLYQ 291
             I V+ FP + PT++EL++VL TS                      +Y +L + +FL  
Sbjct: 272 LKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYLKLFVKKFLKD 331

Query: 292 FESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFV---RPYLMER-HDTVAT 347
           F+ K LNP I T  ++ + V+   S LI+D      QLLT  +   +P +  R  D V  
Sbjct: 332 FQRKFLNPCIPTIPLIRALVKMTNSFLILDPR---GQLLTTIILTLKPLIQRRTTDIVNI 388

Query: 348 FLYAMLGLDASDL--------------------------SSKNSTSTHMSIASQLSA--E 379
            LYAML L+  +L                           S N    + S+    +A   
Sbjct: 389 LLYAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVPYTTAGTG 448

Query: 380 LRGSHQPISSSTAERGNLPHGKHALSM------NPYEPAYQQIIDYYLHWNPEPADSIQA 433
              S++ I++      N+    +A +M       P    +  +   YL W P P + I  
Sbjct: 449 TTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVP-PMNKIYD 507

Query: 434 NNDQALI----------SKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRG-YKLESNW 482
           +  +  +          S+   D +   FDS D+++ E+L L T K +  +  Y L++NW
Sbjct: 508 STSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDLLLSEYLKLLTEKFIHSKNYYTLDNNW 567

Query: 483 VQSLKVVKKKLDFKTYSSAQEFSNINNIDVMLRDV----------KHSEELCSLMHEKLG 532
           +  L ++K+K +          S IN ID+ML D+          KH++E  +++   +G
Sbjct: 568 LWCLNLLKEKSNSSNVPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKE-NNMVQGDIG 626

Query: 533 LSDRIIPKFVSYLFW------------NAHSDFSALPK-------DHPLPKELEADINNY 573
                 PK VS L+W            N   DF  L K       +H +  +L    N  
Sbjct: 627 F----YPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNEL 682

Query: 574 KKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYE-VTLDEALVLSYLSSNGDG--TV 630
                  +KG+K+ L+ ++S++E+++   DGR+L ++ +T+++  VLS  +       T+
Sbjct: 683 G------RKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTL 736

Query: 631 E---EIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEE----------------- 670
           E   +          ++E+ ++FWV   +L    +   Y V E                 
Sbjct: 737 EKAYDFFSGLKRGKQKLEECIQFWVDKKVLYLDDDDGCYKVLERLTFLDEIKQRKKMQEE 796

Query: 671 -------RQNVD---VKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNL 720
                  R  +D   V+ A E    +      D +     +  + + ++ PFI GML NL
Sbjct: 797 TVIKSDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENL 856

Query: 721 GSLKADKIHSFLKMAVPKEIGYSATP-SQLQLYLNALVEESKLVKTPNGAFRLAK 774
           GS+K +KIHSFLKM VP++  Y+     QL+ YLN LVE+ KL  T +GAF+  K
Sbjct: 857 GSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFKKPK 911

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  218 bits (555), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 172/681 (25%), Positives = 324/681 (47%), Gaps = 57/681 (8%)

Query: 32  ILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFIDLLGKYMIFQTRKHFFLNY 91
           +L W+NP       Q + P+LR+K  +K +L        F  L+ +Y +   R HFFL +
Sbjct: 30  VLAWLNPT-----FQPQIPTLRIKQCLKVVLEQSDERTRF--LIEQYYLTLIRTHFFLQF 82

Query: 92  QSLLYFKDVQKLERYYEFPTRYVNIFSSEEWC-DEMSGLRNYLIRQNSGLKNNIQLRLEQ 150
             ++ +KD+ KLE+ Y     ++   +S  W  +EM   +  L+++N+  +  +  +LE 
Sbjct: 83  DDIVNWKDMIKLEKLYISKVEFM-FGTSVYWIKEEMISFKRLLMKKNNEFRKQLHAKLES 141

Query: 151 LVHEDDFDMACKIYEWLCQAEGRLLPEILVDVLLSKVKLFASKNMNSAWTQRFTIMEAYN 210
            + ++D     ++Y+WL  A      E  V ++  KV   + K M +    R+ +M  YN
Sbjct: 142 HILDNDLVRFDQMYQWLAPAFDGQEIEFNVRIINLKVDQMSQKLMKNKIDDRYLVMNTYN 201

Query: 211 LFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTLLE 270
            F+ ++WS F ++L  +EDDHE+T  IY+ FE+ +I+ +  + +   V  FP ++  LLE
Sbjct: 202 HFIKDFWSKFSKLL-IIEDDHELTAIIYQSFEKNYIKYKCDEFYTDIVPKFPASRKCLLE 260

Query: 271 LRSVLKTSVKY--TELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQ 328
           LRS+L   +K   T+++    + F S+ L  S+ T EIL  Y++ +K + I+D      +
Sbjct: 261 LRSILNKDIKTVGTKVLETLYHGFVSRFLTSSLLTCEILYYYIKTVKCLKIIDPMGICLR 320

Query: 329 LLTNFVRPYLMERHDTVATFLYAMLGLDASD----LSSKNSTSTHMSIASQLSAELRG-S 383
            L+  VR YL  R D + T L  +     ++     SS + +S H+    Q S E+   S
Sbjct: 321 SLSKAVRVYLNPRPDIIKTLLLGIFPFQNNERFKIASSTDGSSVHLEKLEQFSREVGDFS 380

Query: 384 HQPISSSTAERGNLPHGKHALSMNPYEPAYQQIIDYYLHWNPEP------ADSIQANNDQ 437
             P   +     N PH    L    Y+    Q++  YL+W PEP       +    N+ +
Sbjct: 381 MGPELPTALPWFNQPH----LPRCTYD-GDDQLLKQYLNWVPEPPRIKLDVEDFADNDGK 435

Query: 438 ALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKLD--- 494
            +   +L  +++++ +SK  +V + LG+ + K +    Y L+  W + + ++   L+   
Sbjct: 436 YVPPVDLIHVLLDVLESKRTLVDDLLGVVSGKFIESEEYSLDPEWQRIMDIILNHLEGTR 495

Query: 495 -FKTYSSAQEFSNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIP--KFVSYLFWNAHS 551
                S   + +++N++D+ML D++ S +  + +  K        P  K +S L+W  + 
Sbjct: 496 KGTVTSEEADLTHLNDVDIMLEDLRLSSQFRNQVAHKNNSHFENFPHIKILSKLYWRHYQ 555

Query: 552 DFSA--LPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHP-EQSIVELQLRLADGRDLN 608
           + +   +   +    E+E  I    K Y  +  GR L+      S V + +    G    
Sbjct: 556 NLNGRLVTTKYKWDSEMEPLIQKLTKVYERLNTGRTLKFDTGSSSRVSINIVTKSGERRF 615

Query: 609 YEVTLDEALVLSYLSSNGDG-------------------TVEEIVKQTNLDISQVEKSLK 649
           ++VT+++ LV+S+  +  +G                   T++++ K T++   ++   L 
Sbjct: 616 FKVTMEQYLVISHFQNETNGRNAPGMMADCNYVIPERRYTLKDLHKMTSMPRQKILDILS 675

Query: 650 FWVKSSILRYSTETSRYSVEE 670
           FW +  I+   ++ S YSV+E
Sbjct: 676 FWQQKEIVTKHSDDS-YSVQE 695

>KAFR0B01150 Chr2 (217323..219758) [2436 bp, 811 aa] {ON} Anc_7.296
           YDL132W
          Length = 811

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 12/153 (7%)

Query: 510 IDVMLRDVKHSE----ELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDFSALPKDHPLPKE 565
           I  M +DV+ S+    E   ++ + +GL     P+   ++       FS    ++ LP+E
Sbjct: 518 ITKMFQDVRLSKVLETEYDQMIKKNIGLRREKFPELQPFILAENMWPFSYQAVEYNLPEE 577

Query: 566 LEADINNYKKAYTNVKKGRKLR-LHPEQSIVELQLRLADGRD----LNYEVTLDEALVLS 620
           L       +  YTN   GR L+ L P   +   +LR   G+      N+ VTL +  +L 
Sbjct: 578 LRLSHEKLETVYTNKHNGRILKWLWP---LCRAELRANIGKPGKAPFNFTVTLFQLSILL 634

Query: 621 YLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVK 653
             ++    T+EEI + TNL I  +  ++  ++K
Sbjct: 635 QFNNKDVLTLEEIQESTNLSIQNIAAAMVPFIK 667

>KLLA0F05467g Chr6 (537921..540359) [2439 bp, 812 aa] {ON} similar
           to uniprot|Q12018 Saccharomyces cerevisiae YDL132W CDC53
           Cullin structural protein of SCF complexes (which also
           contain Skp1p Cdc34p and an F-box protein) involved in
           ubiquitination SCF promotes the G1-S transition by
           targeting G1 cyclins and the Cln-CDK inhibitor Sic1p for
           degradation
          Length = 812

 Score = 38.9 bits (89), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 109/238 (45%), Gaps = 22/238 (9%)

Query: 553 FSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLAD-GRD-LNYE 610
           FS  P +  LP  LE   N  +  YT+   GR L+     S  E++  +   G+    + 
Sbjct: 568 FSYQPTEFALPPVLEHSKNKLETMYTDKHSGRILKWLWPMSRGEIKAHIGKPGKPPFQFT 627

Query: 611 VTLDEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTE-------- 662
           VT+ +  +L+  +     T E+I ++TNL  +Q+  ++  +VK  +L  S E        
Sbjct: 628 VTIFQMAILTLFNDISTLTFEQIQERTNLKATQIASNMYPFVKMKLLIQSPEGVESMIKL 687

Query: 663 TSRYSVEE-----RQNVDVKHAVERQ-SSSEIVN--ATDSVDLQQQQFIDS--MQKVLPF 712
            ++Y++ +     + +V+   AV+   + +  VN  A D  +  +Q+  +    Q+ L F
Sbjct: 688 DTKYTLNKPYRLSKTSVNFAAAVKNDLTFTATVNGSALDETEASEQKKAEKELNQQRLMF 747

Query: 713 IKGMLTNLGSLKADKIHSFL--KMAVPKEIGYSATPSQLQLYLNALVEESKLVKTPNG 768
           ++  +  +   K    HS L  +     +  ++A  S ++  ++ L+E+  L +T +G
Sbjct: 748 LRACIVRIMKAKRKLPHSSLMNECIAESQQRFNAKVSMIKKAVDNLIEQEYLKRTDDG 805

>KLTH0H11176g Chr8 complement(957667..959991) [2325 bp, 774 aa] {ON}
           weakly similar to uniprot|P47050 Saccharomyces
           cerevisiae YJL047C RTT101 Cullin family member subunit
           of a complex containing ubiquitin ligase activity binds
           HRT1 and is modified by the ubiquitin like protein RUB1
           Regulator of Ty1 Transposition Regulator of Ty1
           Transposition
          Length = 774

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 595 VELQLRLADGRDLNYEVTLDEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKS 654
           V+   +L DGR L  E+TL +A +L   + +G+ TV +I  +  +  + +E +L  ++ +
Sbjct: 598 VQTNFKLEDGRPLMLELTLLQASILDLFNESGELTVRDIESELGVAANILEPALTSFISA 657

Query: 655 SILRYSTETSRYSVEERQNVDVK 677
            +L  +T+   + V E    D+K
Sbjct: 658 GLL--NTDGGSFIVNEEFKPDIK 678

>TDEL0D03140 Chr4 complement(583221..585485) [2265 bp, 754 aa] {ON}
           Anc_4.138 YGR003W
          Length = 754

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 93/224 (41%), Gaps = 31/224 (13%)

Query: 448 IVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKLDFKTYSSAQEFSNI 507
           + +LF  KDV +  F    +R+LL  R       W+    V + K +  T+ +++     
Sbjct: 424 LFKLFAEKDVFINTFKLQMSRRLLQHRSSTDVERWM----VKRLKEEMGTFFTSK----- 474

Query: 508 NNIDVMLRDVKHSEELCSLMHEKLGLSD-----RIIPKFVSYLFW----NAHSDFSALPK 558
             +D MLRD+  S EL  L    L  +         P+ ++   W      +SDF     
Sbjct: 475 --LDGMLRDIGTSSELLRLFRNSLDEAQWPKDLDFRPQILTMTSWPFQPPTNSDFEL--- 529

Query: 559 DHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRL-ADGRDLNYEVTLDEAL 617
              LP ELE    +++  YT     R L+       +E+  +  A   +L+  + +   +
Sbjct: 530 --QLPTELEQLKLDFESFYTRKYTERTLQWAHNLGYIEIGFQFDASYHELSMPIPI--GI 585

Query: 618 VLSYLSSNGDGTVEEIVKQTNLDISQVEK---SLKFWVKSSILR 658
           V        + T+E I +QTN+   ++ K   SL    KS IL+
Sbjct: 586 VFLMFEKYDELTIEMIEEQTNIPSQELHKHLLSLTIAPKSRILK 629

>KLLA0C18282g Chr3 complement(1614045..1616252) [2208 bp, 735 aa]
           {ON} similar to uniprot|P53202 Saccharomyces cerevisiae
           YGR003W
          Length = 735

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 61/138 (44%), Gaps = 8/138 (5%)

Query: 513 MLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDFSALPKDHPLPKELEADINN 572
           MLRD+ HS       + KL  +  I    ++ +FW      S + +D  +P    A  N 
Sbjct: 466 MLRDL-HSSNTFMQKNGKLSKTRDISVNVLTNMFWPLQG--SDMNRDVIVPDSFAAIRNE 522

Query: 573 YKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLD--EALVLSYLSSNGDGTV 630
           Y+  Y     GR L  +   S VE+  +    R+  +E+++     ++      +   T 
Sbjct: 523 YENRYAKTHSGRLLEWNYHLSTVEIAYQF---RNSYHELSMPMFSGIIFMLFKEHESLTF 579

Query: 631 EEIVKQTNLDISQVEKSL 648
           +EIV+ TNL   +V K+L
Sbjct: 580 DEIVELTNLPQQEVRKNL 597

>YJL047C Chr10 complement(349580..352108) [2529 bp, 842 aa] {ON}
           RTT101Cullin subunit of a Roc1p-dependent E3 ubiquitin
           ligase complex with a role in anaphase progression;
           implicated in Mms22-dependent DNA repair; involved with
           Mms1p in nonfunctional rRNA decay; modified by the
           ubiquitin-like protein, Rub1p
          Length = 842

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 61/131 (46%), Gaps = 10/131 (7%)

Query: 556 LPKDHPLPKELEADINNYKKAYTNVKK-----GRKLRLHPEQSI----VELQLRLADGRD 606
           + K+  LP+E++   N + + Y    K       K  L+P  ++    VE    + DG +
Sbjct: 609 VKKNFVLPQEMDDTWNQFLRNYHEQNKVEDSDASKKELYPMWNLHHCEVESPYIIQDGTN 668

Query: 607 LNYEVTLDEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRY 666
           L +E+TL +  VL+  + +   T++ I +QT L    +   LK +    IL    + + Y
Sbjct: 669 LIFELTLFQTCVLTLFNESDHLTLQVISEQTKLAYKDLALVLKSFCNYKILTRDIDNT-Y 727

Query: 667 SVEERQNVDVK 677
           S+ E    D+K
Sbjct: 728 SINESFKPDMK 738

>Kpol_1039.15 s1039 (41383..45540) [4158 bp, 1385 aa] {ON}
           (41383..45540) [4158 nt, 1386 aa]
          Length = 1385

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 7/79 (8%)

Query: 614 DEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQN 673
           DE   L  L    D  + +++KQTN  +  + ++++     +   +  E +  + EER+N
Sbjct: 420 DEEAYLKLLDQTKDTRITQLLKQTNTFLDSLSQAVRVQQNEAKALHGEEITPITDEEREN 479

Query: 674 VD-------VKHAVERQSS 685
           VD       VK  +E+QSS
Sbjct: 480 VDYYEVAHRVKEKIEKQSS 498

>TPHA0P00850 Chr16 complement(172533..175004) [2472 bp, 823 aa] {ON}
           Anc_7.296 YDL132W
          Length = 823

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 68/157 (43%), Gaps = 8/157 (5%)

Query: 510 IDVMLRDVKHS----EELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDFSALPKDHPLPKE 565
           I  M +DV+ S    EE  S + E    S    P+   ++       F     ++ +P +
Sbjct: 515 IAKMFQDVRLSKIVEEEFNSSVKELPDYSPLKYPELEPFILAETMWPFQYQESEYTVPPD 574

Query: 566 LEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRD--LNYEVTLDEA--LVLSY 621
           L+      +  Y     GR L+        ELQ  +A   +   N+ VTL +   L+L  
Sbjct: 575 LKPSFTKLEDMYITKHSGRILKWLYPLCRGELQANIAKTHNAPFNFTVTLYQMSILLLYN 634

Query: 622 LSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILR 658
            S N   T+E+I + TNL I+ +  S+  ++K  +++
Sbjct: 635 GSENNQLTLEQIQEGTNLKINNIAASMIPFIKYKLIQ 671

>NCAS0A09070 Chr1 (1794111..1796423) [2313 bp, 770 aa] {ON} 
          Length = 770

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 9/120 (7%)

Query: 542 VSYLFWNAHSDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSI----VEL 597
           V +LF     +   LPK   L    E+ +N YK+     K G   +L P  ++    V+ 
Sbjct: 534 VPHLFLENTGETVELPKG--LSARWESFVNFYKEEN---KHGSLQKLSPAYNLQHCEVDT 588

Query: 598 QLRLADGRDLNYEVTLDEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSIL 657
              L +G  L  E+TL +  VLS  +   + T +E+  Q  L ++ ++  LK ++   IL
Sbjct: 589 PYTLPNGESLTLELTLFQTCVLSLFNEISNLTFKELQNQLKLSVATLQLVLKSFIDIGIL 648

>ZYRO0C09438g Chr3 complement(715107..717566) [2460 bp, 819 aa] {ON}
           highly similar to uniprot|Q12018 Saccharomyces
           cerevisiae YDL132W CDC53 Cullin structural protein of
           SCF complexes (which also contain Skp1p Cdc34p and an
           F-box protein) involved in ubiquitination SCF promotes
           the G1-S transition by targeting G1 cyclins and the
           Cln-CDK inhibitor Sic1p for degradation
          Length = 819

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 72/158 (45%), Gaps = 12/158 (7%)

Query: 510 IDVMLRDVKHS---EELCSLMHEKL-GLSDRIIPKFVSYLFWNAHSDFSALPKDHPLPKE 565
           I  M +DV+ S   EE   +M + L   S +  P+   ++       FS    D  LP  
Sbjct: 519 ITKMFQDVRLSKVLEEDFDVMIKGLPDYSKQKYPELQPFILAETMWPFSYQDVDFKLPLV 578

Query: 566 LEADINNYKKAYTNVKKGRKLR-LHPEQSIVELQLRLADGRD----LNYEVTLDEALVLS 620
           L+      ++ Y+N   GR L+ L P   +   ++R A G+       + VTL +  +L 
Sbjct: 579 LQHSYEKLEEMYSNKHNGRVLKWLWP---LCRGEIRAAIGKQGRPPFQFTVTLFQMSILL 635

Query: 621 YLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILR 658
             + N   T+E+I + TNL +  +  ++  ++K  +++
Sbjct: 636 QFNDNDVLTLEQIQEGTNLSVQNIAAAMVPFIKFKLVQ 673

>Skud_4.122 Chr4 (219928..222375) [2448 bp, 815 aa] {ON} YDL132W
           (REAL)
          Length = 815

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 89/227 (39%), Gaps = 20/227 (8%)

Query: 440 ISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLES--NWVQSLKVVKKKLDFKT 497
           +S E    I +    KD     +  LF ++L+       E   N +Q L+          
Sbjct: 459 MSDEDIITIFKYLTDKDAFETHYRRLFAKRLIHGTSTSAEDEENIIQRLQ---------- 508

Query: 498 YSSAQEFSNINNIDVMLRDVKHS----EELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDF 553
             +A        I  M +D++ S    E+    +  +   S    P    ++       F
Sbjct: 509 --AANSMEYTGKITKMFQDIRLSKILEEDFAVNLRNEPDYSKSKYPDLQPFVLAENMWPF 566

Query: 554 SALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLAD-GR-DLNYEV 611
           S    +  LPKEL +     K++Y+    GR L+        EL+  +   GR   N+ V
Sbjct: 567 SYQEVEFKLPKELASSHEKLKESYSQKHNGRVLKWLWPLCRGELKADIGKPGRAPFNFTV 626

Query: 612 TLDEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILR 658
           TL +  +L   +     T+E I + TNL+I  +  ++  ++K  +++
Sbjct: 627 TLFQMAILLLYNDADVLTLESIQESTNLNIQHIAAAMIPFIKFKLIQ 673

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,087,561
Number of extensions: 3497828
Number of successful extensions: 12898
Number of sequences better than 10.0: 91
Number of HSP's gapped: 13185
Number of HSP's successfully gapped: 92
Length of query: 774
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 657
Effective length of database: 40,065,477
Effective search space: 26323018389
Effective search space used: 26323018389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)