Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G12320g8.322ON25424213090.0
Kwal_56.239148.322ON2652438171e-110
SAKL0H15576g8.322ON2822445191e-64
TDEL0F044808.322ON2602434943e-61
TPHA0C008208.322ON2662514711e-57
Ecym_42538.322ON2582444702e-57
KLLA0D16346g8.322ON3012434696e-57
AGL194C8.322ON2562374641e-56
Kpol_1036.688.322ON2562414465e-54
ZYRO0F10362g8.322ON2512394361e-52
KAFR0H022708.322ON2682534338e-52
KNAG0G024408.322ON2652554171e-49
NDAI0G025908.322ON2862734043e-47
YLR128W (DCN1)8.322ON2692463911e-45
TBLA0A039308.322ON2662523805e-44
CAGL0M04257g8.322ON2732533693e-42
NCAS0C032708.322ON1841723327e-38
Suva_10.2218.322ON1781713004e-33
Skud_12.1978.322ON1791712822e-30
Smik_12.1918.322ON1251171762e-15
ABR211C7.377ON38943800.097
SAKL0F12078g7.377ON38539760.33
KAFR0L016607.377ON37938721.1
KLLA0E20043g7.377ON40043711.4
TBLA0I008407.450ON469123701.9
AFR517C8.50ON87181702.5
KLTH0F07766g7.450ON465145684.0
CAGL0M08602g5.636ON101262684.3
TDEL0C031407.450ON469143665.9
Kwal_YGOB_Anc_7.3777.377ON38449666.0
NCAS0E026907.377ON39848666.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G12320g
         (254 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   508   0.0  
Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   319   e-110
SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   204   1e-64
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   194   3e-61
TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   186   1e-57
Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   185   2e-57
KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   185   6e-57
AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   183   1e-56
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   176   5e-54
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   172   1e-52
KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   171   8e-52
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   165   1e-49
NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   160   3e-47
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   155   1e-45
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   150   5e-44
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   146   3e-42
NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   132   7e-38
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   120   4e-33
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   113   2e-30
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...    72   2e-15
ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON} S...    35   0.097
SAKL0F12078g Chr6 complement(940018..941082,941150..941242) [115...    34   0.33 
KAFR0L01660 Chr12 complement(300456..301595) [1140 bp, 379 aa] {...    32   1.1  
KLLA0E20043g Chr5 complement(1784051..1785253) [1203 bp, 400 aa]...    32   1.4  
TBLA0I00840 Chr9 complement(157646..159055) [1410 bp, 469 aa] {O...    32   1.9  
AFR517C Chr6 complement(1361712..1364281,1364349..1364394) [2616...    32   2.5  
KLTH0F07766g Chr6 complement(669046..670443) [1398 bp, 465 aa] {...    31   4.0  
CAGL0M08602g Chr13 complement(856349..859387) [3039 bp, 1012 aa]...    31   4.3  
TDEL0C03140 Chr3 (561569..562978) [1410 bp, 469 aa] {ON} Anc_7.4...    30   5.9  
Kwal_YGOB_Anc_7.377 s27 (549860..549952,550053..551114) [1155 bp...    30   6.0  
NCAS0E02690 Chr5 (537047..538243) [1197 bp, 398 aa] {ON} Anc_7.3...    30   6.4  

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/242 (100%), Positives = 242/242 (100%)

Query: 1   MRNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPPPPQLLTLFN 60
           MRNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPPPPQLLTLFN
Sbjct: 1   MRNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPPPPQLLTLFN 60

Query: 61  EYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNL 120
           EYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNL
Sbjct: 61  EYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNL 120

Query: 121 CENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTD 180
           CENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTD
Sbjct: 121 CENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTD 180

Query: 181 GAYAIQIPQKRLCSWTAFLTRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVL 240
           GAYAIQIPQKRLCSWTAFLTRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVL
Sbjct: 181 GAYAIQIPQKRLCSWTAFLTRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVL 240

Query: 241 ID 242
           ID
Sbjct: 241 ID 242

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  319 bits (817), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 143/243 (58%), Positives = 192/243 (79%), Gaps = 2/243 (0%)

Query: 2   RNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTS--RPPPPQLLTLF 59
           R++D+EEF+ALTK S+  A+ +LSNNNWAL+YALND+YDTV GGFT+  RP  P+LL +F
Sbjct: 11  RDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVF 70

Query: 60  NEYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDN 119
            +YK  ++++I+  GL RFI DLGL+LEDP TLC+A+ M C+SL + +S + F+Q WHD 
Sbjct: 71  QKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDR 130

Query: 120 LCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPT 179
           LCEN   +K  VKEL++KLR D +YFE IY++T+TLALEP +KQL LET+IAYW LLF  
Sbjct: 131 LCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSP 190

Query: 180 DGAYAIQIPQKRLCSWTAFLTRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPV 239
              YAI++PQ+RL SW  +L+  V+++H D+WKMFLKFA  FPDN+ LK+GY+EDDAWP+
Sbjct: 191 AKPYAIKVPQERLQSWIQYLSGEVAKVHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPL 250

Query: 240 LID 242
           +ID
Sbjct: 251 VID 253

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  204 bits (519), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 95/244 (38%), Positives = 158/244 (64%), Gaps = 7/244 (2%)

Query: 4   QDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPP---PPQLLTLFN 60
           + I EF++LT  ++ TA  YLS N+WAL YALN++YD  QGGF ++ P     +L+  F+
Sbjct: 28  ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHELVETFD 87

Query: 61  EYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNL 120
           +Y   +   I+ + L+++I DLG  LED  T+C+A+ + C  + + ++++ F+  W ++ 
Sbjct: 88  KYADSKR-CITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHG 146

Query: 121 CENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTD 180
           C+N+  +K ++++L+E+L +D  YF HIY++TY L +E +E+ L+++TA  YW L F  +
Sbjct: 147 CKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFH-N 205

Query: 181 GAYAIQIPQKRLCSWTAFLTRNVSR--IHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWP 238
             YA+ I   RL +W  F T+   R  +  D W MFLKF   FPD+++L +GY+E DAWP
Sbjct: 206 SHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWP 265

Query: 239 VLID 242
           ++ D
Sbjct: 266 LVFD 269

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  194 bits (494), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 142/243 (58%), Gaps = 8/243 (3%)

Query: 6   IEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPPPP-----QLLTLFN 60
           + EF++LT+    TA+ +L  N W LEYALND+YD + GGF   P  P     +LL L++
Sbjct: 8   VSEFVSLTQCESKTAKDFLRRNQWKLEYALNDYYDQMPGGFIEEPHTPVTYPEELLALYD 67

Query: 61  EYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNL 120
           +Y   +++ I  DG+I+ I DL   LED  T+C+A  +HCT L+  +SK+ F+  W+   
Sbjct: 68  KYVLEDQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQFLHNWYMQG 127

Query: 121 CENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTD 180
           C  L Q++  + +LD KL  D  Y   IY++T+ LAL+ N++ LD +TA  YW L F   
Sbjct: 128 CSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALDQNKRDLDTDTAAEYWRLFF--Q 185

Query: 181 GAYAIQIPQKRLCSWTAFL-TRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPV 239
              A+ +    L SW AFL +   + +  D WKM L+F + FP    +K  YNE DAWP 
Sbjct: 186 PGTAVHVNPALLNSWLAFLDSEQKTVVTRDTWKMLLEFFKQFPSLSAVKTSYNEADAWPY 245

Query: 240 LID 242
           +ID
Sbjct: 246 IID 248

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  186 bits (471), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 100/251 (39%), Positives = 146/251 (58%), Gaps = 16/251 (6%)

Query: 6   IEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPP---PPQLLTLFNEY 62
           + EF  LT +S   AR YLS N+W L YALN+FYD   GGF    P   P +L+ LF  Y
Sbjct: 5   VREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIELFERY 64

Query: 63  KK---------GEEDT-ISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMF 112
                       EED  I  DGLI+FI DLG +LED TTLC+A+ M C +L+  +++  F
Sbjct: 65  NNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQF 124

Query: 113 VQGWHDNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAY 172
           ++ W++  C N++ IK++++ + E LR D  YF +IY++++ L  E N K + ++TA  Y
Sbjct: 125 LEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEY 184

Query: 173 WHLLFPTDGAYAIQIPQKRLCSWTAFLTRNVSR-IHHDIWKMFLKFARMFPDNKTLKQGY 231
           W L F  DG   + I +++L +W  FLT +  + I  D WKM L+F + FP     K  Y
Sbjct: 185 WKLFFG-DGT-PLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKDEY 242

Query: 232 NEDDAWPVLID 242
           +  D WP ++D
Sbjct: 243 DPMDPWPYIMD 253

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  185 bits (470), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 148/244 (60%), Gaps = 5/244 (2%)

Query: 2   RNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGF-TSRPPPPQLLTLFN 60
           + + I++F+++T  +R+TA  +L++N W+L+YAL+D Y        T R    +L + F 
Sbjct: 7   QRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQ 66

Query: 61  EYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNL 120
            Y   E   + TD LI+++ DLG  LEDP T+C+A  +   +L+  + +E F+  W D  
Sbjct: 67  NYA-SENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLG 125

Query: 121 CENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTD 180
           C NL  + E +  LD KL  D  YF+ IYS+T+++A++   +QL ++TAI+YW LLF  D
Sbjct: 126 CSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLF-LD 184

Query: 181 GAYAIQIPQKRLCSWTAFL--TRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWP 238
            ++A +IP+ RL SW  FL    + + +  D W M  KFA  FPD+KTL   Y+E  AWP
Sbjct: 185 HSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWP 244

Query: 239 VLID 242
           +++D
Sbjct: 245 LIMD 248

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  185 bits (469), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 146/243 (60%), Gaps = 8/243 (3%)

Query: 7   EEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQG-GFTSRPPPPQLLTLFNEYKKG 65
           +EF+ LT  + S A+ YL  N   +EYALND+YD V   G   +   P L+ +F +Y  G
Sbjct: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYSNG 107

Query: 66  EEDT-ISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNLCENL 124
              T   + GLIRFI DLG+ +EDP TLC++  +    L++ VS+E F+  W D  C+ L
Sbjct: 108 VSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTL 167

Query: 125 QQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAYA 184
           +++K  +  L+E+L  D  YF+ IYS+T+ L  +   + L  + AI YW++ F  D  YA
Sbjct: 168 RKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFF-KDNKYA 226

Query: 185 IQIPQKRLCSWTAFLTRNVS-----RIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPV 239
           ++I ++RL SW  F+  + S      I +DIW MF KF   +P++++LKQ Y+E  AWP+
Sbjct: 227 LKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPL 286

Query: 240 LID 242
           LID
Sbjct: 287 LID 289

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  183 bits (464), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 140/237 (59%), Gaps = 3/237 (1%)

Query: 6   IEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPPPPQLLTLFNEYKKG 65
           I EF+A+T A+ + A  YL  N+W+L++AL+DFY    GG  +     +L+  F  Y  G
Sbjct: 11  IREFLAVTSATSAAAETYLERNHWSLDHALDDFYTQSGGGGRAEQYSAELVATFERYAAG 70

Query: 66  EEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNLCENLQ 125
               + T+ L+R++GDLG  LED  TLC+A  +    L+  +S+  F+  WH   C +L 
Sbjct: 71  --GAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSLP 128

Query: 126 QIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAYAI 185
            ++  V  L+ +LR D+AYF  +Y++T+ L L+   ++L +ETAIAYW L F  D  YA+
Sbjct: 129 DMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFF-LDHTYAV 187

Query: 186 QIPQKRLCSWTAFLTRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLID 242
            +P  RL SW  FL      +  D W MF +FA+ FPD+  L + YNE  +WP++ID
Sbjct: 188 TVPAPRLRSWFEFLRAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVID 244

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  176 bits (446), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 137/241 (56%), Gaps = 7/241 (2%)

Query: 7   EEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGF----TSRPPPPQLLTLFNEY 62
           EEFI LT   +  A  YL  NNW L YALN++YD   G F         P +L+ +F +Y
Sbjct: 6   EEFIGLTNCDKKVATKYLKRNNWNLNYALNEYYDKEVGSFLVEEEVIEYPEELIQIFKKY 65

Query: 63  KKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNLCE 122
                ++I TDG I+ I DL   LED  T+C+A+ MHC SLS  ++K+ F+  W++  C 
Sbjct: 66  SNDNGESIDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQFLSTWYEQGCS 125

Query: 123 NLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGA 182
            L+ +K  + +LD KL+ D  Y+ HIY +++ L  + NEK ++ + AI YW L F +   
Sbjct: 126 QLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRDSNEKCIEKDMAIEYWKLFFSSKC- 184

Query: 183 YAIQIPQKRLCSWTAFLTRN-VSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLI 241
             I I + +L SW  F+  N +  I  D+W+  L++ + +P  + L + YNE D WP ++
Sbjct: 185 -PITINELQLNSWIEFINVNEIESITRDVWERLLEYFKKYPTLEILSKNYNELDPWPYIM 243

Query: 242 D 242
           D
Sbjct: 244 D 244

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  172 bits (436), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 136/239 (56%), Gaps = 6/239 (2%)

Query: 6   IEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPPPPQLLTLFNEYKKG 65
           +  F +L + S  TAR YL+ +NW +  ALND+YD+       +   P+L  LF +Y   
Sbjct: 5   VATFKSLAQCSDRTARDYLNTHNWDVNQALNDYYDSEHD--QDQSYSPELPQLFRKYAVV 62

Query: 66  EED--TISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNLCEN 123
                 + TDGLIR+IGDLG ++++  T+C+A  +HC  L+  +++  F   W  N C +
Sbjct: 63  TPHGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQFSYNWQQNGCTS 122

Query: 124 LQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAY 183
           L Q+ + V+ LD KLR D  Y   IY++T+ LAL+P  K L+  TA+ YW L F T G Y
Sbjct: 123 LHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALDPGAKTLETHTAVQYWTLFFAT-GQY 181

Query: 184 AIQIPQKRLCSWTAFLTRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLID 242
            + + Q+    W +F+ +  S I  D W+M   F   F + ++++  YNE DAWP +ID
Sbjct: 182 PVIVEQQFFQLWISFVQQEQS-ISRDTWRMLFPFFNRFSNLQSVRDNYNEADAWPYIID 239

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  171 bits (433), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 141/253 (55%), Gaps = 12/253 (4%)

Query: 1   MRNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPP--------P 52
           M  + I  FI  T+   + AR YLS N W + YALNDFYD+  GGFT            P
Sbjct: 5   MEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVYP 64

Query: 53  PQLLTLFNEYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMF 112
            +L+ LF +Y   E+  I   G+I+ I D GL +ED  T+C+A  +H  +L   + ++ F
Sbjct: 65  KELVQLFRDYC-SEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDF 123

Query: 113 VQGWHDNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQ--LDLETAI 170
           +Q   +  C  +  IK  +K+L+EKL  D  YF  IY+F++ L L+ + +   +D++ AI
Sbjct: 124 LQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAI 183

Query: 171 AYWHLLFPTDGAYAIQIPQKRLCSWTAFLT-RNVSRIHHDIWKMFLKFARMFPDNKTLKQ 229
            YW L F  +   +++I  + L  W  FL      ++  DIW+M L+F R F D ++LK+
Sbjct: 184 EYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKE 243

Query: 230 GYNEDDAWPVLID 242
            Y+E+D WP +ID
Sbjct: 244 SYDENDPWPFVID 256

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  165 bits (417), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/255 (35%), Positives = 141/255 (55%), Gaps = 16/255 (6%)

Query: 1   MRNQDIEEFIALTKA-SRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPP-------- 51
           M    I +FI LT+   R  A  YL  ++W + YALNDFYD   G F S           
Sbjct: 1   MEEDAIHDFIELTQCRDRKKAERYLRESHWNVNYALNDFYDKEVGNFFSTYKDVPQDNVV 60

Query: 52  -PPQLLTLFNEYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKE 110
            PP+L+ +F++Y   E   I+ +G+I +IGDL L ++D  T+C+A  +   +L   +++E
Sbjct: 61  YPPELIHVFDQY--SEAGVITFEGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITRE 118

Query: 111 MFVQGWHDNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAI 170
            F+  W    C  + ++K  + +L+ KL +D  YF+ IY +T+ L +EP++ +LD  + I
Sbjct: 119 QFLAQWFLQGCSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVEPDQNKLDAASTI 178

Query: 171 AYWHLLFPTDGAYAIQIPQKRLCSWTAFL---TRNVSRIHHDIWKMFLKFARMFPDNKTL 227
            YW L F  +  Y + I Q+ L  W  +L   + N+S +  DIWKM  +F   F     +
Sbjct: 179 EYWKLFFDQEKKYPMIIDQELLDPWFVYLGEQSENMS-VTEDIWKMVYQFFNRFRSLGDV 237

Query: 228 KQGYNEDDAWPVLID 242
           KQGY+E  AWP+LID
Sbjct: 238 KQGYDEMAAWPILID 252

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  160 bits (404), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/273 (31%), Positives = 137/273 (50%), Gaps = 50/273 (18%)

Query: 20  ARAYLSNNNWALEYALNDFYDTVQGGFTS---------------RPPPPQLLTLFNEYKK 64
           A+ YLS NNW L YALN++YD   G F                    P +L+ LF +Y  
Sbjct: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKKYSS 61

Query: 65  GEEDT----ISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNL 120
              D+    I  DGLI +I DL  +LED  T+C+A  +HC +L   ++K+ F+  W+   
Sbjct: 62  KNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQG 121

Query: 121 CENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPN-------------------- 160
           C  L+Q++  + +LD KL +D++YF  IY++T+ L ++ +                    
Sbjct: 122 CSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSND 181

Query: 161 ----------EKQLDLETAIAYWHLLFPTDGAYAIQIPQKRLCSWTAFLTRNVSR-IHHD 209
                     +  LD+ETAIAYW + F  +  Y +++ ++ L  W  FL     + I  D
Sbjct: 182 TSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITKD 241

Query: 210 IWKMFLKFARMFPDNKTLKQGYNEDDAWPVLID 242
            W+M L+F + F + + +KQ Y+E  AWP +ID
Sbjct: 242 QWQMLLEFFKKFSNLEMMKQNYDETAAWPYMID 274

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  155 bits (391), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 86/246 (34%), Positives = 128/246 (52%), Gaps = 13/246 (5%)

Query: 6   IEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFT------SRPP--PPQLLT 57
           IE F +LTK     +R YL  N+W + YALND+YD   G FT      + PP  P +L  
Sbjct: 18  IESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVYPKELTQ 77

Query: 58  LFNEYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWH 117
           +F  Y     +    D L++FI +LG +LED  TLC+A  +    L + + +E F+  W 
Sbjct: 78  VFEHYINN--NLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWF 135

Query: 118 DNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLF 177
              C  +  ++E +K LD KL  D  YF  IY++ + L L+PN K +D +  I YW L F
Sbjct: 136 MQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFF 195

Query: 178 PTDGAYAIQIPQKRLCSWTAFLT-RNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDA 236
             +  Y +++    L +W  FL     + I  D W+M L F + +P  + +   Y+E  A
Sbjct: 196 QPE--YPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAA 253

Query: 237 WPVLID 242
           WP +ID
Sbjct: 254 WPFIID 259

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  150 bits (380), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 127/252 (50%), Gaps = 14/252 (5%)

Query: 3   NQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPPPPQ-------- 54
           +Q ++EF++L  +  STA+ YL  N W LEYALNDFYD   G F  +             
Sbjct: 5   DQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEY 64

Query: 55  ---LLTLFNEYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEM 111
              L  L+N Y   +   + T+GL++ + DLG  ++   TLC+A  + C   +  +    
Sbjct: 65  VRPLTELYNHYAI-DSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSN 123

Query: 112 FVQGWHDNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIA 171
           F+     N C +L+ IK  + E D KL+ +  Y+  IY   + L LE  +K +D ETA  
Sbjct: 124 FIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQE 183

Query: 172 YWHLLFPTDGAYAIQIPQKRLCSWTAFLTR-NVSRIHHDIWKMFLKFARMFPDNKTLKQG 230
           YW L F     Y I++   +   W  +L+  N+  I  D W M L+F + FP    L++ 
Sbjct: 184 YWDLFFACQN-YPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRK 242

Query: 231 YNEDDAWPVLID 242
           Y+ED AWP + D
Sbjct: 243 YSEDSAWPYIFD 254

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  146 bits (369), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 137/253 (54%), Gaps = 17/253 (6%)

Query: 6   IEEFIALTKAS-RSTARAYLSNNNWALEYALNDFYDTVQGGFTSR-------PPPPQLLT 57
           ++ F +LT  +    A+ YLS NNW + YALN++YD   GGFT           P +L++
Sbjct: 10  MKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYDKEVGGFTEDHMIRHQFKYPDELVS 69

Query: 58  LFNEYKK-GEED---TISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFV 113
           LF  Y    EED   +I+ DGLI +I DLG +LED  T+ +A  + C +L   ++++ F+
Sbjct: 70  LFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENPITEKQFL 129

Query: 114 QGWHDNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYW 173
             W++  C  L+Q++  +++ + KL  D  YF  IY++++ L     +  ++ + AI YW
Sbjct: 130 YFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDLN-ASKQGVVETDIAIEYW 188

Query: 174 HLLFP---TDGAYAIQIPQKRLCSWTAFLTRNVSR-IHHDIWKMFLKFARMFPDNKTLKQ 229
            L F    T  +  I++ Q  L  W  FL     + IH D W+M L F + FP    +K 
Sbjct: 189 KLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEHKKLIHKDTWQMLLLFFKKFPSLDAIKT 248

Query: 230 GYNEDDAWPVLID 242
            YNE DAWP  ID
Sbjct: 249 EYNEADAWPYTID 261

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  132 bits (332), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 104/172 (60%), Gaps = 3/172 (1%)

Query: 73  DGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNLCENLQQIKEKVK 132
           DGL+ ++ DLGLDLED  T+C+   +HC ++   ++++ F+  W    C ++ Q+K+ + 
Sbjct: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61

Query: 133 ELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLF-PTDGAYAIQIPQKR 191
           +L++KL  D  YF  IY++T+ L  +P +K L++ETA+AYW L   P +G + +++    
Sbjct: 62  DLNDKLHSDKQYFIDIYNYTFGLITDP-DKDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120

Query: 192 LCSWTAFL-TRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLID 242
           L  W  FL   N   I  D W M + F + FP+   +K+GY+E  AWP +ID
Sbjct: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIID 172

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  120 bits (300), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 92/171 (53%), Gaps = 3/171 (1%)

Query: 73  DGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNLCENLQQIKEKVK 132
           D LI+FI DLG +LED  TLC+   +    L + + +E F+  W    C  L  +K+ VK
Sbjct: 2   DSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCVK 61

Query: 133 ELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAYAIQIPQKRL 192
            LD KL  D  YF  IY +T+ L L+ N K +D E AI YW LLF  +  Y I +    L
Sbjct: 62  GLDAKLHEDLQYFTEIYDYTFHLILDTNRKDIDTEEAIQYWTLLFQPE--YPIHMEPGLL 119

Query: 193 CSWTAFLTRNVSR-IHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLID 242
            +W  FL     R I  D W M L+F + +P  +++   Y+E  AWP +ID
Sbjct: 120 EAWFRFLHDEGKRTITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIID 170

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  113 bits (282), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 89/171 (52%), Gaps = 3/171 (1%)

Query: 73  DGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNLCENLQQIKEKVK 132
           D L++FI DLG  LED  TLC+ D +   +L + + +E F+  W    C  L  ++  +K
Sbjct: 2   DSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCIK 61

Query: 133 ELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAYAIQIPQKRL 192
            LD KL  D  Y+  +Y + + L L+ N K +D++ AI YW L F     Y + I    L
Sbjct: 62  RLDVKLHEDLQYYTQVYDYAFRLILDSNRKNIDIDDAIQYWTLFFQP--VYPVHIESNLL 119

Query: 193 CSWTAFLT-RNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLID 242
            SW  FL     + I  D W M L F + +   +++  GY+E  AWP +ID
Sbjct: 120 ESWFHFLRDEGKTLISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIID 170

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score = 72.4 bits (176), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 63/117 (53%), Gaps = 3/117 (2%)

Query: 127 IKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAYAIQ 186
           ++E +K LD KLR++  YF  IY++T+ L L+   K +D+   I YW L F  +  Y + 
Sbjct: 1   MQECMKRLDIKLRQNLQYFTLIYNYTFHLLLDSYRKDIDINECIQYWKLFFRPE--YPVS 58

Query: 187 IPQKRLCSWTAFL-TRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLID 242
           I Q  L +W  FL       I+ D W+M L F + +   + +   Y+E  AWP +ID
Sbjct: 59  IEQNLLEAWFRFLHDEGKMMINKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIID 115

>ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YBL058W
          (SHP1)
          Length = 389

 Score = 35.4 bits (80), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%)

Query: 1  MRNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQ 43
          M ++ I++F+ LT +S   AR YL  +   LE ALN FY   Q
Sbjct: 1  MSDEQIQQFMMLTNSSAEVARKYLGEHEDDLEDALNGFYANQQ 43

>SAKL0F12078g Chr6 complement(940018..941082,941150..941242) [1158
          bp, 385 aa] {ON} similar to uniprot|P34223
          Saccharomyces cerevisiae YBL058W SHP1 UBX (ubiquitin
          regulatory X) domain- containing protein that regulates
          Glc7p phosphatase activity and interacts with Cdc48p
          interacts with ubiquitylated proteins in vivo and is
          required for degradation of a ubiquitylated model
          substrate
          Length = 385

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 1  MRNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFY 39
          M +QDI++FIALT +S S A+ YL+     L  ALN +Y
Sbjct: 1  MSDQDIQQFIALTNSSFSVAQQYLTEFG-DLSNALNAYY 38

>KAFR0L01660 Chr12 complement(300456..301595) [1140 bp, 379 aa]
          {ON} Anc_7.377 YBL058W
          Length = 379

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 2  RNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFY 39
          ++QDIE+F++LT  S   A+ Y+      LE ALN +Y
Sbjct: 4  QSQDIEQFVSLTSTSSGVAKQYIE-AFGGLESALNAYY 40

>KLLA0E20043g Chr5 complement(1784051..1785253) [1203 bp, 400 aa]
          {ON} similar to uniprot|P34223 Saccharomyces cerevisiae
          YBL058W SHP1 UBX (ubiquitin regulatory X) domain-
          containing protein that regulates Glc7p phosphatase
          activity and interacts with Cdc48p interacts with
          ubiquitylated proteins in vivo and is required for
          degradation of a ubiquitylated model substrate
          Length = 400

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 1  MRNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQ 43
          M ++ I++F+ALT  S + A  YL N    L  ALN FY T Q
Sbjct: 1  MSDEQIQQFVALTNTSVNVASDYL-NQFGDLGEALNAFYATQQ 42

>TBLA0I00840 Chr9 complement(157646..159055) [1410 bp, 469 aa] {ON}
           Anc_7.450 YPR036W
          Length = 469

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 47/123 (38%), Gaps = 28/123 (22%)

Query: 124 LQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAY 183
           L  + E+ K  DE+LR D      I        LE   K+L              +   Y
Sbjct: 312 LNSLGERKKYSDEELREDMGVLRGI--------LEDEYKEL-------------TSFDEY 350

Query: 184 AIQIPQKRLCSWT------AFLTRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAW 237
             ++  K +C W+       F + NV +   D WK+F K  R+  D      G N+ ++ 
Sbjct: 351 VAEVDSKLMC-WSPPHVDNGFWSDNVDKFKSDNWKLFKKLIRLLVDTTRKAGGVNDKESK 409

Query: 238 PVL 240
            V+
Sbjct: 410 VVI 412

>AFR517C Chr6 complement(1361712..1364281,1364349..1364394) [2616
           bp, 871 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YLR054C (OSW2); 1-intron
          Length = 871

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 6/81 (7%)

Query: 122 ENLQQIKEKVKELDEKLRRDSAYFEHIYS--FTYTLALEPNEKQLDLETAIAYWHLLFPT 179
           +NL+ +KE+ K+ + KL +   + + + S   +  + L P+ K    E A+  WH + P 
Sbjct: 184 QNLELVKEQFKDPNSKLNK---FLQQLSSDKVSRLIKLVPSSKNTTNEMALEIWHRIIPK 240

Query: 180 DGAYAIQIPQKRLCSWTAFLT 200
              + + I  ++ C +   LT
Sbjct: 241 IAVHILSIVFQQ-CDYEKLLT 260

>KLTH0F07766g Chr6 complement(669046..670443) [1398 bp, 465 aa] {ON}
           similar to uniprot|P41807 Saccharomyces cerevisiae
           YPR036W VMA13 vacuolar ATPase V1 domain subunit H (54
           kDa)
          Length = 465

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 26/145 (17%)

Query: 87  EDPTTLCVADAMHCTSLS----QSVSKEMFVQGWHDNLCENLQQIKEKVKELDEKLRRDS 142
           E  + LC+A  ++C S      +++ +++ + G   N    LQ + E+ K  D++LR+D 
Sbjct: 275 EKLSRLCIATILNCVSPHVKGHKALIRQLLLLG---NALPILQSLSER-KYSDDELRQDL 330

Query: 143 AYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAYAIQIPQKRLCSWTAFLTRN 202
           A  + +   TY      +E + +L++ +  W      +G                F   N
Sbjct: 331 ATLKELLEQTYQELTSFDEYEAELDSKLLVWSPPHVDNG----------------FWAEN 374

Query: 203 VSRIHHDIWKMFLKFARMF--PDNK 225
           V +     WK+F K   +   P+N+
Sbjct: 375 VDKFKEQDWKLFKKLVAILASPNNE 399

>CAGL0M08602g Chr13 complement(856349..859387) [3039 bp, 1012 aa]
           {ON} similar to uniprot|P38995 Saccharomyces cerevisiae
           YDR270w CCC2
          Length = 1012

 Score = 30.8 bits (68), Expect = 4.3,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 10/62 (16%)

Query: 60  NEYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADA----------MHCTSLSQSVSK 109
           +E K   ED+++TDG+I  + D G D E      +A A          M C+S   +V+K
Sbjct: 40  SECKVVSEDSVATDGIIEAVEDCGFDCELIREKSMAPALCRGFIGIKGMTCSSCVATVTK 99

Query: 110 EM 111
           ++
Sbjct: 100 QL 101

>TDEL0C03140 Chr3 (561569..562978) [1410 bp, 469 aa] {ON} Anc_7.450
           YPR036W
          Length = 469

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 59/143 (41%), Gaps = 24/143 (16%)

Query: 87  EDPTTLCVADAMHCTSLS----QSVSKEMFVQGWHDNLCENLQQIKEKVKELDEKLRRDS 142
           E  + LC++  + CTS +    ++V K + + G   N    LQ + ++ K  DE+LR+D 
Sbjct: 276 EKISRLCISIILQCTSSNVKNNRAVIKNLLLLG---NALPVLQSLSDR-KYSDEELRQDM 331

Query: 143 AYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAYAIQIPQKRLCSWTAFLTRN 202
           A  + +    Y      +E   +L++ +  W      +G                F + N
Sbjct: 332 ATLKDVLEQEYKELTSFDEYLAELDSKLLCWSPSHVDNG----------------FWSDN 375

Query: 203 VSRIHHDIWKMFLKFARMFPDNK 225
           + +   D WK+F     +  + K
Sbjct: 376 IDKFKSDNWKLFKTLVNLLIETK 398

>Kwal_YGOB_Anc_7.377 s27 (549860..549952,550053..551114) [1155 bp,
          384 aa] {ON} ANNOTATED BY YGOB -
          Length = 384

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 1  MRNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSR 49
          M +++I++F+AL+ AS S A++YLS     L  AL+ FY    G   S+
Sbjct: 1  MSDENIQQFMALSNASLSVAQSYLS-EFPDLGDALDAFYAAQNGSEGSQ 48

>NCAS0E02690 Chr5 (537047..538243) [1197 bp, 398 aa] {ON}
          Anc_7.377 YBL058W
          Length = 398

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 5/48 (10%)

Query: 6  IEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPPPP 53
          I++F+ALT  S   A  YL   +  L  A+N F+       +S P PP
Sbjct: 9  IQQFMALTNGSHEQASQYLEQYDGDLNEAVNAFFMA-----SSNPTPP 51

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,939,343
Number of extensions: 1214820
Number of successful extensions: 3913
Number of sequences better than 10.0: 48
Number of HSP's gapped: 3964
Number of HSP's successfully gapped: 49
Length of query: 254
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 147
Effective length of database: 41,212,137
Effective search space: 6058184139
Effective search space used: 6058184139
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)