Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G12298g8.323ON50050022630.0
Kwal_56.239168.323ON49949818550.0
SAKL0H15554g8.323ON53647411931e-159
AGL195C8.323ON55447011731e-156
Ecym_42548.323ON52949411261e-149
KLLA0D16368g8.323ON51151210171e-133
TDEL0F044908.323ON5105009681e-125
KAFR0B057208.323ON4844519351e-121
Smik_4.3898.323ON5255058951e-114
Skud_4.4048.323ON5354918861e-113
YDR145W (TAF12)8.323ON5394958811e-112
NCAS0B035708.323ON5194898411e-106
CAGL0E01397g8.323ON5755497782e-96
ZYRO0F10384g8.323ON5581676161e-72
Suva_2.3068.323ON5411646106e-72
Kpol_543.638.323ON5852135989e-70
NDAI0J010208.323ON6381675581e-63
TPHA0A015608.323ON5401685382e-61
TBLA0A039408.323ON7521645361e-59
KNAG0I008908.323ON5081675188e-59
TBLA0H012808.323ON4051122901e-27
AFR310C3.492ON623142722.9
Kwal_47.171404.297ON12350683.5
KLTH0D15554g4.297ON12347683.5
Kwal_33.145252.88ON30042695.1
KLLA0A08129g1.497ON126999706.8
CAGL0M05357g8.539ON55783697.6
KAFR0E028208.470ON562121689.6
KNAG0C012701.216ON410751689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G12298g
         (500 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   876   0.0  
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   719   0.0  
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   464   e-159
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   456   e-156
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   438   e-149
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   396   e-133
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   377   e-125
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   364   e-121
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   349   e-114
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   345   e-113
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   343   e-112
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   328   e-106
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   304   2e-96
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   241   1e-72
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   239   6e-72
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   234   9e-70
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   219   1e-63
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   211   2e-61
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   211   1e-59
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   204   8e-59
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   116   1e-27
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    32   2.9  
Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {O...    31   3.5  
KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} simil...    31   3.5  
Kwal_33.14525 s33 complement(706024..706926) [903 bp, 300 aa] {O...    31   5.1  
KLLA0A08129g Chr1 (722217..726026) [3810 bp, 1269 aa] {ON} simil...    32   6.8  
CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} simil...    31   7.6  
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    31   9.6  
KNAG0C01270 Chr3 (245114..257437) [12324 bp, 4107 aa] {ON} Anc_1...    31   9.8  

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/500 (87%), Positives = 437/500 (87%)

Query: 1   MSSNPNSGQPAQSGNNQQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQ 60
           MSSNPNSGQPAQSGNNQQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQ
Sbjct: 1   MSSNPNSGQPAQSGNNQQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQ 60

Query: 61  ASRIKAMYDAYRQRQQSAQGFEQGGATSNTGDNTAGTPTNARSPNGTPNNNMSSNIQNLL 120
           ASRIKAMYDAYRQRQQSAQGFEQGGATSNTGDNTAGTPTNARSPNGTPNNNMSSNIQNLL
Sbjct: 61  ASRIKAMYDAYRQRQQSAQGFEQGGATSNTGDNTAGTPTNARSPNGTPNNNMSSNIQNLL 120

Query: 121 TPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEI 180
           TPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEI
Sbjct: 121 TPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEI 180

Query: 181 LNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSTASQNASPL 240
           LNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSTASQNASPL
Sbjct: 181 LNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSTASQNASPL 240

Query: 241 PAATGANQASSPIQQTGAPSQVQQQTATPSQPRSGVNSRSPTQVTSVXXXXXXXXXXXXX 300
           PAATGANQASSPIQQTGAPSQVQQQTATPSQPRSGVNSRSPTQVTSV             
Sbjct: 241 PAATGANQASSPIQQTGAPSQVQQQTATPSQPRSGVNSRSPTQVTSVNAAAHLANNATSA 300

Query: 301 XRQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEV 360
            RQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEV
Sbjct: 301 ARQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEV 360

Query: 361 DNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRK 420
           DNERVMSKRKLRELVKSV                         FITNVTSFACRLAKHRK
Sbjct: 361 DNERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRK 420

Query: 421 SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGIXXXXXXXXXXXX 480
           SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI            
Sbjct: 421 SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGINSAKVTKTTSAA 480

Query: 481 XXXXXXXXXXXXDSKNQPAS 500
                       DSKNQPAS
Sbjct: 481 QAAAAQAVSSNADSKNQPAS 500

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/498 (73%), Positives = 391/498 (78%)

Query: 1   MSSNPNSGQPAQSGNNQQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQ 60
           MS+N NSGQP Q  NN QG+PAQR TPES+QQMAYKF+QCFNEAKR+GLQTPQGQELLKQ
Sbjct: 1   MSANSNSGQPIQGNNNVQGSPAQRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQ 60

Query: 61  ASRIKAMYDAYRQRQQSAQGFEQGGATSNTGDNTAGTPTNARSPNGTPNNNMSSNIQNLL 120
           AS IKA+YDAYRQRQQ+AQGF+Q    +++  +T+G+P  AR+PNGT  N +SSNIQNLL
Sbjct: 61  ASHIKAVYDAYRQRQQAAQGFDQNAPGASSAGSTSGSPATARAPNGTATNTISSNIQNLL 120

Query: 121 TPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEI 180
           TPQQNEAYGRLIQ+SNENGEKIKGEYTYLK+QIEILDGEIKKR+GDPATVKQLE NK EI
Sbjct: 121 TPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEI 180

Query: 181 LNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSTASQNASPL 240
           LNKL+GFSASY+ALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANS  SQNASPL
Sbjct: 181 LNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSATSQNASPL 240

Query: 241 PAATGANQASSPIQQTGAPSQVQQQTATPSQPRSGVNSRSPTQVTSVXXXXXXXXXXXXX 300
           P  +  NQ SSP QQ  A      Q  TP Q RS  +SRSPTQVTSV             
Sbjct: 241 PTNSNGNQTSSPAQQQAAVQVPPPQNGTPGQTRSAASSRSPTQVTSVNAAAHLANNATSA 300

Query: 301 XRQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEV 360
            R+AIFKQPNPSVPVSETITQ+MPT +V+RSNRPTITGGSAMNAAALTTPVMTKLPPYEV
Sbjct: 301 ARRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEV 360

Query: 361 DNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRK 420
           DNERVMSKRKLRELVKSV                         FITNVTSFACRLAKHRK
Sbjct: 361 DNERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRK 420

Query: 421 SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGIXXXXXXXXXXXX 480
           SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPT SYNQKLQGI            
Sbjct: 421 SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVSKTASAA 480

Query: 481 XXXXXXXXXXXXDSKNQP 498
                       DSKNQP
Sbjct: 481 QAAAAHAVTGNNDSKNQP 498

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  464 bits (1193), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 262/474 (55%), Positives = 313/474 (66%), Gaps = 29/474 (6%)

Query: 21  PAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY-RQRQQSAQ 79
           P Q++T  S+QQ+A +F+  F EA R+G+ T +G+ELLKQA++IKA+YDAY +Q+QQ+AQ
Sbjct: 21  PLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNKQKQQAAQ 80

Query: 80  GFEQGGATSNTGDNTAGTPTNARSPN------GTPNNNMSSNIQNLLTPQQNEAYGRLIQ 133
            F   G T+N     A       + N          NN SSNI+ LLTP+Q+EAY +L +
Sbjct: 81  AF---GQTNNRPPAPAAGNPPQVAQNTQQRQNSNSANNPSSNIRTLLTPEQSEAYNKLTK 137

Query: 134 TSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASYLA 193
           T  ++ + I+GE  YL+K IE+LD EIK R+ +P  V++LE+ K E++ KLRG  AS+ A
Sbjct: 138 TFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQA 197

Query: 194 LNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSTASQNASPLPAATGANQAS-SP 252
           L QK  E KKKFYIECAA+NPNLKRFLQASTQQQ+      Q        T   Q S SP
Sbjct: 198 LPQKFHEAKKKFYIECAASNPNLKRFLQASTQQQQQQQQQQQQQQQQKVNTNQGQISVSP 257

Query: 253 I-QQT-----------------GAPSQVQQQTATPSQPRSGVNSRSPTQVTSVXXXXXXX 294
           + QQT                 GA +  QQQ   P+Q  S   SRSPTQVTSV       
Sbjct: 258 VVQQTSSQPAAAASASMAATTPGASTPSQQQQKKPTQGNSTSTSRSPTQVTSVNAAALLA 317

Query: 295 XXXXXXXRQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTK 354
                  RQAIFKQPNPS+PVSE +T + PT V +RSNRPTITGGSAMNAAAL TPVMTK
Sbjct: 318 NNNTAAARQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTK 377

Query: 355 LPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACR 414
           LPPYEVD+ERVMSKRKLRELVKSV                         FI+NVT FACR
Sbjct: 378 LPPYEVDSERVMSKRKLRELVKSVGVDEGDGETTIDGDVEELLLDLADDFISNVTGFACR 437

Query: 415 LAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           LAKHRKSDNLDVRDIQLHLERNWNIRIPGY+ADE+RSTRKWN TT+Y QKLQGI
Sbjct: 438 LAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGI 491

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  456 bits (1173), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 261/470 (55%), Positives = 314/470 (66%), Gaps = 24/470 (5%)

Query: 13  SGNNQQGTP-AQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY 71
           S NNQQG     +LTP S++Q+AYKF    +EA++VG++TP+G ELLK+AS IKA+Y+ Y
Sbjct: 62  SSNNQQGNGQVPQLTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETY 121

Query: 72  RQRQQSAQGFEQGGATSNTGDNTAGTPTNARSPNGTPNNNMSSNIQNLLTPQQNEAYGRL 131
             RQQ+ Q F Q    +  G   A     A +P   P ++++SNI+ LLTPQQ EAY +L
Sbjct: 122 -HRQQAQQAF-QVRNPAPAGQLAAAGTGQATAPR--PTSSVASNIKMLLTPQQREAYEKL 177

Query: 132 IQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASY 191
            QT NE+ + I GEY +LKK IE+LD EIK RQG+P TVKQLET K E+L KL G +  +
Sbjct: 178 TQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETKKNELLTKLTGLNTQF 237

Query: 192 LALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANS--TASQNASPLPAATGANQA 249
            AL +K +EDKKKFYIECAATN NLK+FLQA++QQQRA++  T + N SP     GAN  
Sbjct: 238 QALPKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRASAGNTGTTN-SPANTQLGANIG 296

Query: 250 SSPIQQ-----------TGAPSQVQQQTATPSQPRSGVNSRSPTQVTSVXXXXXXXXXXX 298
           ++               + A  Q Q+Q     +P SG N R P QVT V           
Sbjct: 297 AASAATPAAANAAPTGSSAATPQSQRQQM--QRPNSGAN-RYPAQVTPV--NAAANQNNS 351

Query: 299 XXXRQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPY 358
              R  IFKQPNPS+P+ E IT    T V +RSNRPTIT GSAMNA+ALT PVMTKLPPY
Sbjct: 352 GTARPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPY 411

Query: 359 EVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKH 418
           EVD+ERVMSKRKLRELVK+V                         FITNVTSFACRLAKH
Sbjct: 412 EVDSERVMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSFACRLAKH 471

Query: 419 RKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           RKSDNLDVRDIQLHLERNWNIRIPGYAADE+RST+KWNPT +Y+QKLQGI
Sbjct: 472 RKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGI 521

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  438 bits (1126), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 251/494 (50%), Positives = 311/494 (62%), Gaps = 41/494 (8%)

Query: 13  SGNNQQGTP-AQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY 71
           S N QQG     +LTP SLQQ+AYKF+   +EA+RVG+QTP+G ELLK+AS++KA+Y+ Y
Sbjct: 2   SNNGQQGNGQVPQLTPPSLQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKVKAIYETY 61

Query: 72  RQRQQSAQGFEQGGATSNTGDNTAGTPTNARSPNGT------------------------ 107
            +++Q AQ   +   T+ TG          +                             
Sbjct: 62  NRQRQQAQQAFRVRNTAQTGAQPQQQLPAGQPQPQQQQQQQPPPQPQPQQPQQPQQQQLK 121

Query: 108 ---PNNNMSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQ 164
              P ++++SNI+ LL PQQ EAY RL QT NE+ + IKGEY +LKK IE+LD EIK RQ
Sbjct: 122 QQRPASSVASNIKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQ 181

Query: 165 GDPATVKQLETNKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQAST 224
            +P TV+QLE+ K E+L KL   +  +  L +K +EDKKKFYIECAATN NLK+FLQA++
Sbjct: 182 SEPITVRQLESKKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATNMNLKKFLQATS 241

Query: 225 QQQRANS-TASQNASPLP----AATGANQASSPIQ----QTG-APSQVQQQTATPSQPRS 274
           QQQRAN+      +SP P     + G   ++ P+      TG   +  Q +     +  S
Sbjct: 242 QQQRANTGNTGTTSSPAPTQPSGSVGTPNSAVPVSTNSVNTGNTATPQQSKQQPQQRSNS 301

Query: 275 GVNSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSVPVSETITQRMPTPVVHRSNRP 334
           G+ SRSPTQVT V              R  IFKQPNPS+P+ E+++    T V +RSNRP
Sbjct: 302 GI-SRSPTQVTPV--NAAANQNSNGAARPVIFKQPNPSIPIPESVSPISTTSVSYRSNRP 358

Query: 335 TITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXX 394
           TITGGSAMNAAALTTPVMTKLPPYEVD+ERVMSKRKLRELVKSV                
Sbjct: 359 TITGGSAMNAAALTTPVMTKLPPYEVDSERVMSKRKLRELVKSVGIDDGDGETTIDGDVE 418

Query: 395 XXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRK 454
                    FITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIR PGY+ADE+RST+K
Sbjct: 419 ELLLDLADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRTPGYSADEIRSTKK 478

Query: 455 WNPTTSYNQKLQGI 468
           WN T +Y QK+Q I
Sbjct: 479 WNSTPAYGQKMQVI 492

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  396 bits (1017), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/512 (45%), Positives = 300/512 (58%), Gaps = 70/512 (13%)

Query: 11  AQSGNNQQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDA 70
            Q+GN Q     Q LTP S+QQ+A +     NEAKR+G+ T +G+ELL+QA+RIKA+Y+A
Sbjct: 3   GQAGNVQ----LQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEA 58

Query: 71  Y-RQRQQSAQGFEQGGATSNTGDNTAGTPTNARSPNG--------------TPNNNMSSN 115
           Y +QRQQ AQ         N   N A   TN +S +                 +NN+++N
Sbjct: 59  YSKQRQQQAQAQAGAQGAVN---NNA---TNVKSMDQQQQQQQQQQQQQATASSNNVTNN 112

Query: 116 IQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLET 175
           I+ LLTPQQ EAY RL+Q   ++G+ IKGE+ +LK+ I +LD EI+ R+G+  +V+QLE 
Sbjct: 113 IKVLLTPQQREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEV 172

Query: 176 NKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRA----NS 231
           N+ E+L K+R  SA Y  L QK +ED++KFYIEC+ TN +L+R+LQA  Q+  A     +
Sbjct: 173 NRNELLMKIRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYLQAQQQKANAAKSQGT 232

Query: 232 TASQNASPLPAATGANQASSPIQQTGAPSQVQQQTATPSQPRSGVNSR------------ 279
            A+   +P P A      S+P   TG P       A+   P + +  R            
Sbjct: 233 VAANAGTPGPQAG----VSTPGTNTGTPIPTSLNKASSGSPPNAMAQRQNIPIQKTAATT 288

Query: 280 -----------------------SPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSVPVS 316
                                  SP QVT+V              R  IFKQPNPS+P+S
Sbjct: 289 ATATNANPSSAAAAPNNTASDKSSPMQVTTVNAAANQTAQSNT--RPPIFKQPNPSIPIS 346

Query: 317 ETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVK 376
           E +T      V +RSNRPTITGGS MNA ALTTPVMTKLPPYEVD ERVMSKRKLRELVK
Sbjct: 347 ENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTERVMSKRKLRELVK 406

Query: 377 SVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERN 436
           +V                         FITNVT+FAC+LAKHRKSD+LDVRDIQ+HLERN
Sbjct: 407 TVGIDEGDGETTIDGDVEELLLDLADDFITNVTNFACKLAKHRKSDSLDVRDIQMHLERN 466

Query: 437 WNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           WNIRIPG+A DE+RST+KWNPT SYNQ +  I
Sbjct: 467 WNIRIPGFANDEIRSTKKWNPTPSYNQMVNAI 498

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  377 bits (968), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/500 (45%), Positives = 294/500 (58%), Gaps = 43/500 (8%)

Query: 1   MSSNPNSGQPAQSGNNQQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQ 60
           MS + ++      G+  QG   Q+     L ++  KF    NEAK VG  TP+G+ELL +
Sbjct: 1   MSYDGDTANSTAEGSASQGIGGQQ---RQLLELTTKFRALVNEAKSVGENTPRGKELLIK 57

Query: 61  ASRIKAMYDAY-RQRQQSAQGFEQG--GATSNTGDNTAGTPTNARSPNGTPNNN------ 111
           AS+IKA+YD Y RQRQQ+AQ F QG  G T      ++G+  +  + N   +++      
Sbjct: 58  ASKIKAIYDNYNRQRQQAAQAFVQGRNGGTPGANPASSGSTGSVGAVNAAGSSSSGSSQQ 117

Query: 112 -------MSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQ 164
                  +++ I+ +LTP+QN+ +  L Q        I+ ++T+LK+ IE L+ E+ K Q
Sbjct: 118 SRSSGSQLANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSK-Q 176

Query: 165 GDPATVKQLETNKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQAST 224
            D +  KQLE  KTE+ N L+  +  Y AL Q+ +  KKKFY+ECA  NP L+R LQ ST
Sbjct: 177 TDASAKKQLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPALQRLLQRST 236

Query: 225 QQQRA----------NSTASQNASPLPAATGANQASSPIQQTGAPSQV------QQQTAT 268
           QQQR            S A +  SP     GA   S+  QQ G P+ +      QQ    
Sbjct: 237 QQQRMAQQQQVQPSEGSPAGEAGSP-----GAAGNSAKAQQ-GTPANITTQKLPQQNQVR 290

Query: 269 PSQPRSGVNSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSVPVSETITQRMPTPVV 328
                S   SR+ +QVT+V              + AIFKQ +P VP+SET+T + P+PV 
Sbjct: 291 SQSTSSNTGSRAQSQVTNVNAAASMAYNNGAN-KSAIFKQSDPLVPISETVTAKTPSPVT 349

Query: 329 HRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXX 388
           +++NRPT+TGG+AMNAAAL TP MTKLPPYEVD ERVMSKRKLRELVK+V          
Sbjct: 350 YKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETV 409

Query: 389 XXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADE 448
                          F++NVT FACRLAKHRKSDNLD RDIQLHLERNWNIRIPGY+ADE
Sbjct: 410 IDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADE 469

Query: 449 VRSTRKWNPTTSYNQKLQGI 468
           +RSTRKWNP  SYNQK+Q I
Sbjct: 470 IRSTRKWNPKPSYNQKMQAI 489

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  364 bits (935), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/451 (46%), Positives = 272/451 (60%), Gaps = 29/451 (6%)

Query: 30  LQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAYRQRQQSAQGFEQGGATSN 89
           L +++ +F     EAK+VG  TP+G+EL+ QAS++KA+YD Y +++Q A    Q    + 
Sbjct: 28  LMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNKQKQEAMAQAQARNNNA 87

Query: 90  TGDNTAGTPTNARSPNGTPNNNMSSN-----IQNLLTPQQNEAYGRLIQTSNENGEKIKG 144
              N   + +   +   T   + SS      I+  LTP+QN+ Y +L+Q        IK 
Sbjct: 88  NTANVNSSSSANSTEANTSGRSGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKD 147

Query: 145 EYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASYLALNQKLREDKKK 204
           ++T+LK+ I+ L  EI+K Q D A  KQL+  + E++  L+  S  Y  L Q+    KK 
Sbjct: 148 KHTFLKQNIDRLVQEIEK-QTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKA 206

Query: 205 FYIECAATNPNLKRFLQASTQ--QQRANSTASQNASPLPAATGANQASSPIQQTGAPSQV 262
           FYIECA  NP+L+R LQ STQ  QQ+A   AS NA   P          P++    P   
Sbjct: 207 FYIECAKKNPDLQRLLQKSTQRVQQQA---ASPNAQQQP----------PVKTEAQPQPQ 253

Query: 263 QQQTATPSQPRSGVN-----SRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSVPVSE 317
            QQ ATPSQ  S  N      RS +Q+T+V              +  IFKQ +P+VP+SE
Sbjct: 254 PQQQATPSQSSSNANLAASKPRSQSQITNVNAAASNSSSSN---KSVIFKQSDPAVPISE 310

Query: 318 TITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKS 377
           +I+ + P PV +R NRPTI+GGSAMNAAAL TP+MTKLPPYE+D ERVMSKRKLRELVK+
Sbjct: 311 SISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKT 370

Query: 378 VXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNW 437
           +                         F+TNVTSFAC+LAKHRKSDNL+ +DIQLHLERNW
Sbjct: 371 IGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNW 430

Query: 438 NIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           NIRIPGY+ADE+RSTRKWNPT SYNQKLQ I
Sbjct: 431 NIRIPGYSADEIRSTRKWNPTQSYNQKLQSI 461

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  349 bits (895), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 214/505 (42%), Positives = 282/505 (55%), Gaps = 39/505 (7%)

Query: 1   MSSNPNS-----GQPAQSGNNQQGTPAQR---LTPESLQQMAYKFSQCFNEAKRVGLQTP 52
           MSSN  +     G    +GN    T AQ+   L P  LQ+M  KF+    EA+ VG  TP
Sbjct: 1   MSSNTENTAGIGGNNTSTGNASAATAAQQNMVLQPRQLQEMTAKFTALLTEARNVGETTP 60

Query: 53  QGQELLKQASRIKAMYDAY---RQRQQSAQGFEQGG-ATSNTGDNTAGTPTNARSPNGTP 108
           +G+EL+ QA++IK +YDA    ++RQQ+AQ +       +N+  N   T +  ++ N + 
Sbjct: 61  RGKELMFQAAKIKQVYDALTLNKRRQQAAQAYRNASMGNTNSNSNNPVTMSTEKTSNSSQ 120

Query: 109 --------------NNNMSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIE 154
                         +N  SS I+ +LTP++N+ Y +L Q        IK + T+LK+ I+
Sbjct: 121 QHQQQHQQQQTRNNSNKFSSMIKQVLTPEENQEYEKLWQNFQARHTSIKEKETFLKQNID 180

Query: 155 ILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATNP 214
            L+ EI K Q +    +QL+  K E+LN  +     Y  L    +  KK FY+ECA  NP
Sbjct: 181 RLEQEINK-QTEEGAKQQLQEKKNELLNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNP 239

Query: 215 NLKRFLQASTQQQRANSTASQNASPLPAATGAN-----QASSPIQQTGAPSQVQQQTATP 269
            L +FLQ STQQQR      Q                 + SS      +  Q QQQ   P
Sbjct: 240 ALHKFLQESTQQQRVQQQRVQQQQHQGQTPTNTSTNSTEISSTTALDASKPQQQQQNTLP 299

Query: 270 --SQPRSGVNS----RSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSVPVSETITQRM 323
             + PR   N+    +S  +VT+V              + AIFKQ  P++P+SE I+ + 
Sbjct: 300 GTNTPRGNGNAPQTEQSKAKVTNVNATASMMNNVSSS-KSAIFKQTEPAIPISENISAKA 358

Query: 324 PTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXX 383
           P PV +RSNRPTITGGSAMNA+AL TP  TKLPPYE+D +RVMSKRKLRELVK+V     
Sbjct: 359 PAPVAYRSNRPTITGGSAMNASALNTPAATKLPPYEMDTQRVMSKRKLRELVKTVGIDEG 418

Query: 384 XXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPG 443
                               F+TNVT+F+CRLAKHR+SDNL+ RDIQLHLERNWNIRIPG
Sbjct: 419 DGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRRSDNLEARDIQLHLERNWNIRIPG 478

Query: 444 YAADEVRSTRKWNPTTSYNQKLQGI 468
           Y+ADE+RSTRKWNP+ SYNQKLQ I
Sbjct: 479 YSADEIRSTRKWNPSQSYNQKLQSI 503

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  345 bits (886), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 212/491 (43%), Positives = 277/491 (56%), Gaps = 57/491 (11%)

Query: 25  LTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY---RQRQQSAQGF 81
           L P  LQ+M  KF     EA+ VG  TP+G+EL+ QA++IK +YDA    ++RQQ+AQ +
Sbjct: 33  LQPRQLQEMTAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQAAQAY 92

Query: 82  E---QGGATSNTGDNTAGTPTNARSPNGTP-------------NNNMSSNIQNLLTPQQN 125
           +    G A  N   N A  PT+ ++PN +              +N  S+ I+ +LTP++N
Sbjct: 93  KNASMGNANPNPS-NLASLPTD-KAPNPSQQQQQQQQQQARNNSNKFSNMIKQVLTPEEN 150

Query: 126 EAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLR 185
           + Y +L Q        IK    +LK+ ++ L+ EI K Q D  T +QLE  K E+LN  +
Sbjct: 151 QEYEKLWQNFQVRHTSIKEREAFLKQNVDRLEQEINK-QTDEGTKQQLEEKKNELLNDWK 209

Query: 186 GFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQASTQQ------------------- 226
                Y  L    +  KK FY+ECA  NP L +FLQ STQQ                   
Sbjct: 210 VLKIEYTKLFNSYQNSKKTFYVECARHNPALHKFLQESTQQQRVQQQRAQQQQQQQQLHI 269

Query: 227 ----QRANSTASQNASPLPAATGANQASSPIQQTGA-PSQVQQQTATPSQPRSGVNS--- 278
               Q   ST +   +P  AA  A++A    QQ    P  V       + P+  +N+   
Sbjct: 270 QGQNQVKTSTTNSTETPSTAALDASKAQEQQQQQHQNPLPVT------NTPKGNINAPQT 323

Query: 279 -RSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTIT 337
            +S  +VT+V              + AIFKQ  P++P+SE I+ + P PV +RSNRPT+T
Sbjct: 324 EQSKAKVTNVNATASMMSNVSAN-KSAIFKQTEPAIPISENISTKAPAPVAYRSNRPTVT 382

Query: 338 GGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXX 397
           GGSAMNA+AL TPV TKLPPYE+D +RVMSKRKLRELVK+V                   
Sbjct: 383 GGSAMNASALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEDLL 442

Query: 398 XXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNP 457
                 F+TNVT+FACRLAKHRKSDNL+ RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP
Sbjct: 443 LDLADDFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNP 502

Query: 458 TTSYNQKLQGI 468
           + SYNQKLQ I
Sbjct: 503 SQSYNQKLQNI 513

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  343 bits (881), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/495 (42%), Positives = 275/495 (55%), Gaps = 61/495 (12%)

Query: 25  LTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY---RQRQQSAQGF 81
           L P  LQ+MA KF     EA+ VG  TP+G+EL+ QA++IK +YDA    R+RQQ+AQ +
Sbjct: 33  LQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRQQAAQAY 92

Query: 82  EQGGATSNTGD---------NTAGTPTNARSPNGTPNNNMSSNIQNLLTPQQNEAYGRLI 132
                ++++           N++      +      +N  S+ I+ +LTP++N+ Y +L 
Sbjct: 93  NNTSNSNSSNPASIPTENVPNSSQQQQQQQQQTRNNSNKFSNMIKQVLTPEENQEYEKLW 152

Query: 133 QTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASYL 192
           Q        IK + TYLK+ I+ L+ EI K Q D    +QL+  K E+LN  +     Y 
Sbjct: 153 QNFQVRHTSIKEKETYLKQNIDRLEQEINK-QTDEGPKQQLQEKKIELLNDWKVLKIEYT 211

Query: 193 ALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANS--------------------- 231
            L    +  KK FY+ECA  NP L +FLQ STQQQR                        
Sbjct: 212 KLFNNYQNSKKTFYVECARHNPALHKFLQESTQQQRVQQQRVQQQQQQQQQQQQQQQQQQ 271

Query: 232 -------------TASQNASPLPAATGANQASSPIQQTGAPSQVQQQTATPSQ-PRSGVN 277
                         +S N++ +P+ TG +   S         Q QQ T T +  PR  VN
Sbjct: 272 QQQQQRQGQNQRKISSSNSTEIPSVTGPDALKS--------QQQQQNTITATNNPRGNVN 323

Query: 278 S----RSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSVPVSETITQRMPTPVVHRSNR 333
           +    +S  +VT+V              + AIFKQ  P++P+SE I+ + P PV +RSNR
Sbjct: 324 TSQTEQSKAKVTNVNATASMLNNISSS-KSAIFKQTEPAIPISENISTKTPAPVAYRSNR 382

Query: 334 PTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXX 393
           PTITGGSAMNA+AL TP  TKLPPYE+D +RVMSKRKLRELVK+V               
Sbjct: 383 PTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDV 442

Query: 394 XXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTR 453
                     F+TNVT+F+CRLAKHRKSDNL+ RDIQLHLERNWNIRIPGY+ADE+RSTR
Sbjct: 443 EELLLDLADDFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTR 502

Query: 454 KWNPTTSYNQKLQGI 468
           KWNP+ +YNQKLQ I
Sbjct: 503 KWNPSQNYNQKLQSI 517

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  328 bits (841), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 204/489 (41%), Positives = 270/489 (55%), Gaps = 56/489 (11%)

Query: 25  LTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAYRQRQQSAQGFEQG 84
           L P  ++++  KF    NEAK VG  T +G+ELL QAS++KAMYD Y +++Q     +Q 
Sbjct: 21  LQPNQIRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAMYDNYNRQRQQQLQQQQA 80

Query: 85  GATSNTGDNTAGTPTNARSPNGTPNNNMS--------------------SNI-QNLLTPQ 123
                  +N    P+N  + N T NN+ +                    +NI + +LT +
Sbjct: 81  V------NNKVQNPSN--NDNVTTNNSFASPSSPPTSGSTISNSSSTQLANIMRQVLTDE 132

Query: 124 QNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNK 183
           QN  + +L QT       +K ++T+LK+ IE L  EI K+  +    KQLE  + E+L  
Sbjct: 133 QNANFDKLDQTFRSRASALKDKHTFLKQNIERLTQEINKQADNVNARKQLEEKRGELLRN 192

Query: 184 LRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANS------------ 231
           L+  +  +  L QK +  KK FYIECA TNP+L++ LQ STQ Q+               
Sbjct: 193 LKAITMEHNTLYQKYQNGKKAFYIECAKTNPDLQKLLQKSTQHQQQRLAQQQQQQQQQQQ 252

Query: 232 ------------TASQNASPLPAATGANQASSPIQQTGAPSQVQQQTATPSQPRSGVNSR 279
                       TA+               +S  +   + + + Q+T TP+   S    +
Sbjct: 253 QQQQNVTQGQVPTANPVQHQPQPQPQPMDHTSMNRTNSSATSMTQKTNTPNTTISDNAQK 312

Query: 280 SPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGG 339
           S  QVT+V              +Q IFKQ +P VPVS+TI+ + P  V +RSNRPT+TGG
Sbjct: 313 S--QVTNVNAAASMSDSSNSS-KQTIFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGG 369

Query: 340 SAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXX 399
           SAM+A+AL TPVMTKLPPYE+D ERVMSKRKLRELVKS+                     
Sbjct: 370 SAMSASALNTPVMTKLPPYELDTERVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLD 429

Query: 400 XXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTT 459
               FITNVTSFACRLAKHRKSDNL+ RDIQLHLERNW+IRIPGY+ADE+RS RKWNP  
Sbjct: 430 MADDFITNVTSFACRLAKHRKSDNLEARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQ 489

Query: 460 SYNQKLQGI 468
           +YNQKLQ I
Sbjct: 490 TYNQKLQQI 498

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  304 bits (778), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 205/549 (37%), Positives = 288/549 (52%), Gaps = 91/549 (16%)

Query: 2   SSNPNSGQPAQSGNNQQGTPAQR-LTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQ 60
           S N N+  P+ SG    G P++  +  + +Q++  +F Q   EAK+VG  TP+G+ELL Q
Sbjct: 10  SKNDNTSAPSGSG----GPPSKSAIQQKQIQELTARFKQLVTEAKKVGETTPRGKELLLQ 65

Query: 61  ASRIKAMYDAYRQRQQSAQGFEQGGATSNTGDNT-------------------AGTPTNA 101
           A+++KA+Y+ Y +RQQ+    +        G NT                   +G+ + +
Sbjct: 66  AAKLKAVYENYTRRQQALARAQ---QLQQQGSNTNAAASSGSSTTGTTGTANSSGSASTS 122

Query: 102 RSPNGTPNNNMSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIK 161
            + +   +  +++ I+ +LTP+QN+ Y +L+Q        IK ++T++K+ I+ L  EI 
Sbjct: 123 GNNSSNSSAQLANIIKQVLTPEQNQQYEQLLQNFQVRASAIKDKHTFIKQNIDRLVVEIN 182

Query: 162 KRQGDPATVKQLETNKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQ 221
           K Q D    KQL   KTE+L  ++     + AL Q+L+  KK FY+ECA  NP L+R LQ
Sbjct: 183 K-QTDEEAKKQLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNPALQRLLQ 241

Query: 222 ASTQ----------------------------QQRANSTAS--QNASPLP---------- 241
            STQ                            Q  AN  A+  Q+    P          
Sbjct: 242 RSTQQQRMMQQKKQPQPAQPQVQSQAMPGAQSQANANGQAAIPQSVGEAPPTNMGQQQMP 301

Query: 242 -AATGANQAS----SPIQ------------QTGAPSQVQQQTATPSQPRSGVNSRSPTQ- 283
             ATGAN ++     P+Q            + G P+   Q+   P+QP+   + R  T  
Sbjct: 302 TTATGANISTPSGQQPVQGNTQDPKTQIKTEVGTPAPGSQKGGRPAQPQQTPSGRGQTAS 361

Query: 284 ----VTSVXXXXXXXXXXXXXXRQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGG 339
               VT V              + +IFK  +P+VP+++T++ + P P+  RSNRPTI+ G
Sbjct: 362 QQSPVTGVNAAASSAGSSTVT-KSSIFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDG 420

Query: 340 SAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXX 399
           SAMNAAAL TPVMT LPPYE+D +RVMSKRKLRELVKS+                     
Sbjct: 421 SAMNAAALNTPVMTTLPPYEIDTDRVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLD 480

Query: 400 XXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTT 459
               F+TNVT FACRLAKHRKSDNL+  DIQLHLERNWNIRIPGY+ADE+RS  KWN + 
Sbjct: 481 LADDFVTNVTGFACRLAKHRKSDNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASP 540

Query: 460 SYNQKLQGI 468
           +Y QKL  I
Sbjct: 541 AYAQKLTSI 549

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  241 bits (616), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 127/167 (76%)

Query: 302 RQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVD 361
           + AIFKQ +P VP+SE +T + P+PV ++SNRPT+TGG+AMNA+ L TP +TKLPPYEVD
Sbjct: 366 KSAIFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVD 425

Query: 362 NERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKS 421
            ERVMSKRKLRELVK+V                         F+TNVT FACRLAKHRKS
Sbjct: 426 TERVMSKRKLRELVKTVGIDDGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKS 485

Query: 422 DNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           DNLD RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ SYNQK+Q I
Sbjct: 486 DNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSI 532

 Score =  112 bits (281), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 118/213 (55%), Gaps = 19/213 (8%)

Query: 30  LQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY--------RQRQQSAQGF 81
           L ++  KF Q   E+K VG  T +G+ELL QAS+IKA+Y  Y        +  +Q+  G 
Sbjct: 39  LLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSRQRQQAAQAYEQARNGA 98

Query: 82  EQGGAT-SNTGDNTAGTPTNARSPNGTPNNN---------MSSNIQNLLTPQQNEAYGRL 131
             GG+T  + G   +  P  ++S  G+ ++          +++ I+ +LTP+QN+ Y  L
Sbjct: 99  AAGGSTPQSAGSGVSTVPAGSQSTGGSSSSGGQSTGGGSQLANIIKQVLTPEQNQQYDNL 158

Query: 132 IQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASY 191
           +QT       I+ ++ +L++ +E L+ EI K+  +PA  KQLE  K E+L  L+  +  Y
Sbjct: 159 LQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKT-EPAAKKQLEDKKMELLTNLKSLNMEY 217

Query: 192 LALNQKLREDKKKFYIECAATNPNLKRFLQAST 224
             L Q+    KKKFY+ECA  NP L+R LQ ST
Sbjct: 218 SVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  239 bits (610), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 125/164 (76%)

Query: 305 IFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364
           IFKQ  P++P+SE I+ + P PV +RSNRPTITGGSAMNA AL TPV TKLPPYE+D +R
Sbjct: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415

Query: 365 VMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNL 424
           VMSKRKLRELVK+V                         F+TNVT+FACRLAKHRKSDNL
Sbjct: 416 VMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFACRLAKHRKSDNL 475

Query: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           + RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ SYNQKLQ I
Sbjct: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNI 519

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  234 bits (598), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 143/213 (67%), Gaps = 5/213 (2%)

Query: 259 PSQVQQQTATPS---QPRSGVNSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSVPV 315
           P Q+ Q+  T S   QP S   S + +QVT+V              + AIFKQ +PSVP+
Sbjct: 350 PVQLPQEQGTGSIQSQPNSAT-SANRSQVTNVNATASSANKNIQS-KSAIFKQSDPSVPI 407

Query: 316 SETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELV 375
           SE+IT + P  V + SNRP++TGG+AMNA+ L TP +TKLPPYE+D ERVMSKRKLREL+
Sbjct: 408 SESITVKAPEAVSYISNRPSLTGGTAMNASVLNTPTITKLPPYEIDTERVMSKRKLRELI 467

Query: 376 KSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLER 435
           KSV                         F+TNVTSFACRLAKHRKSD+L+ RDIQLHLER
Sbjct: 468 KSVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKSDSLEARDIQLHLER 527

Query: 436 NWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           NWNIRIPGY+ DE+RSTRKW PT SY+QK+Q I
Sbjct: 528 NWNIRIPGYSGDEIRSTRKWIPTQSYSQKMQSI 560

 Score =  117 bits (293), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 113/212 (53%), Gaps = 27/212 (12%)

Query: 36  KFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY-RQRQQSAQGFEQGGATSNTGDNT 94
           KF +  NEAKRVG  T +G+ELL QAS +KA+YD Y +QRQ      +Q  A S+     
Sbjct: 33  KFKELVNEAKRVGQNTQRGKELLIQASNLKAVYDNYNKQRQALINQQQQQQAGSS--QTP 90

Query: 95  AGTPTNARS-----------------------PNGTPNNNMSSNIQNLLTPQQNEAYGRL 131
           AGT  NA +                        N +  + ++  I+ +LTP++N+ Y +L
Sbjct: 91  AGTTNNADAASSSSAPAAAGASGANGTRKTAVANASGGSQLADLIKQVLTPEENQQYDKL 150

Query: 132 IQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASY 191
           +Q        IK ++T+LK+ I+ L  EI + Q D A  KQLE N+ E+L  LR  +  Y
Sbjct: 151 LQNFQSRASSIKDQHTFLKQHIDRLSQEINQ-QTDEAAKKQLEVNRAELLTNLRTLNTEY 209

Query: 192 LALNQKLREDKKKFYIECAATNPNLKRFLQAS 223
             L + ++  KK FY+ECA  NP L+R LQ S
Sbjct: 210 SNLYEDIKNKKKAFYVECARQNPELQRLLQKS 241

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  219 bits (558), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 122/167 (73%)

Query: 302 RQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVD 361
           +  +FK   P V +S+TI+ + P  V +RSNRP++TGGSAMNA+ALTTPV TKLPPYE+D
Sbjct: 436 KSIMFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGGSAMNASALTTPVATKLPPYEID 495

Query: 362 NERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKS 421
            ERVMSKRKLRELVKS+                         F+TNVTSFACRLAKHR S
Sbjct: 496 TERVMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRNS 555

Query: 422 DNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           D+L+ RDIQLHLE+NWNIRIPGY+ADE+RS RKW+P  +YNQKLQ I
Sbjct: 556 DSLEPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQNYNQKLQHI 602

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 121/242 (50%), Gaps = 42/242 (17%)

Query: 17  QQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQ-GQELLKQASRIKAMYDAYRQRQ 75
            QG P   L P  + +++ KF    NEAK++G    Q G+ELL QAS+IKA+YD Y +++
Sbjct: 28  HQGGPPITLQPNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTYNRQR 87

Query: 76  Q--------------------SAQGFEQGGATSNTGDNTAGTPT-NARSPNGTP------ 108
           Q                    S    E   +T+N  +N   TP+ N  +PN  P      
Sbjct: 88  QAAAAAAAAQARVQAQVQVQSSDVNKELPTSTAN-NNNIGATPSANTPTPNSIPISNSNT 146

Query: 109 -------------NNNMSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEI 155
                        +N ++S ++ +LTP+QN+ Y +L+ T       IK +++++K+ IE 
Sbjct: 147 PSSLNANNGNRLSSNQLASIMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIER 206

Query: 156 LDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATNPN 215
           L  E+ K   DP    QLE  KTE+ N +R  +  +  L+Q+ +  +K FY+ECA  NP 
Sbjct: 207 LSQELNKPNLDPNLKTQLENKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPA 266

Query: 216 LK 217
           L+
Sbjct: 267 LQ 268

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  211 bits (538), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 97/168 (57%), Positives = 124/168 (73%), Gaps = 2/168 (1%)

Query: 302 RQAIFKQPNPSVPVSETITQRMPTPVV-HRSNRPTITGGSAMNAAALTTPVMTKLPPYEV 360
           +  IFKQ +P+VP+S+ +T   PT ++ ++SNRP++TGG+AM+AAAL  P +T LPPYE+
Sbjct: 351 KSVIFKQSDPTVPISDNVTLE-PTELIPYKSNRPSLTGGAAMSAAALNVPPLTTLPPYEI 409

Query: 361 DNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRK 420
           D ERVM+KRKLREL+K+V                         F+TNVTSFACRLAKHRK
Sbjct: 410 DTERVMAKRKLRELIKNVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRK 469

Query: 421 SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           S+NL+ RDIQLHLERNWNIRIPGY+ DE+RSTRKW PT +++QKLQ I
Sbjct: 470 SENLESRDIQLHLERNWNIRIPGYSGDEIRSTRKWLPTQAFSQKLQSI 517

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  211 bits (536), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 119/164 (72%)

Query: 305 IFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364
           IFKQ  P +P+SE +T ++P  + +R+NRPT+TGG+AMN + L TPV+TKLPPYE+D +R
Sbjct: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625

Query: 365 VMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNL 424
           VM KRKL+E+V+SV                         F+T+VT+FAC++AKHRKSD+L
Sbjct: 626 VMLKRKLKEVVRSVGVDDGDGETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685

Query: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           DV DIQLHLE+NWNIRIP Y+ D +RS+RKWNPT SYNQKL  +
Sbjct: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSL 729

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%)

Query: 112 MSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVK 171
           +++ I+ LLTP+QN+ Y +L+         IK ++ +LK+ I     E+ K         
Sbjct: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRV 289

Query: 172 QLETNKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQASTQ 225
           +LE  K E+++ L+  S  Y  L Q+ +  KK FYI CA  NPNL+R LQ ++ 
Sbjct: 290 KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTSH 343

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 17  QQGTPAQ--RLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY-RQ 73
            Q TP Q   L  + L ++  KF    NEAK+VG  T +G+ELL QA +IK +YD + +Q
Sbjct: 46  HQLTPNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQ 105

Query: 74  RQQSAQGFEQG 84
           RQQ+ Q +++ 
Sbjct: 106 RQQAIQAYKRA 116

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  204 bits (518), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 115/167 (68%)

Query: 302 RQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVD 361
           +  IFK+  PSVP+ E+I    P  V ++ NRPTITGGS MNA AL TPV  K+P YE D
Sbjct: 320 KHKIFKESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEAD 379

Query: 362 NERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKS 421
            +RV+SKRKLRELV++V                         F+++VT+FACRLAKHR S
Sbjct: 380 TDRVLSKRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRGS 439

Query: 422 DNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           D+L+ RD+QLHLERNWNIR+PGYA DE+RSTRKWN T++Y+QKL  I
Sbjct: 440 DSLEARDVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAI 486

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  116 bits (290), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 358 YEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXX-XXXXXXXXXXXXFITNVTSFACRLA 416
           YE+++ERV+SKRKLRELV+SV                          F++N+TSF+CRL+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 417 KHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGI 468
           +HR S+ ++ RDIQLH+ERNWNIR+PG+ ADE++S +KW  +  Y   L  +
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSV 385

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 106/212 (50%), Gaps = 13/212 (6%)

Query: 30  LQQMAYKFSQCFNEAKRVGLQTPQ-GQELLKQASRIKAMY----DAYRQRQQSAQGFEQG 84
           L ++A  F     +AK  G  T + G+ELL +A+++K ++    + Y+    S       
Sbjct: 15  LNELAENFKNLIKDAKLNGGDTTEKGKELLIKATKVKKLFTQLSNKYKNDSSSNDSTLSR 74

Query: 85  GATSNTGDNTAGTPTNARSPNGT-----PNNNMSSNIQNLLTPQQNEAYGRLIQTSNENG 139
             ++++  N    P+ + + + +      N+N+S  I+N LTP+QNE+Y  L++      
Sbjct: 75  SNSNSSLKNMNTPPSTSSNNSSSTPMVRSNSNLSMMIKNALTPEQNESYETLLKDFQIRA 134

Query: 140 EKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASYLALNQKLR 199
            KIK E++ +K++I+ +   +  +  +      L   + E L +L+  S  Y  L+Q+ +
Sbjct: 135 AKIKREHSDVKEKIDNISKLLNSKTNNQEA---LTAKRNEYLFQLKKLSKDYTELHQQFQ 191

Query: 200 EDKKKFYIECAATNPNLKRFLQASTQQQRANS 231
            +KK FY++ A  N  L++ LQ S    R  S
Sbjct: 192 NEKKNFYLKSAKQNSELQKVLQESHTSARTQS 223

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 27/142 (19%)

Query: 104 PNGTPNN----------NMSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQI 153
           PNGTP             MS  + + L  ++    GRL+ +  +  +  +    + +K+I
Sbjct: 279 PNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEI 338

Query: 154 EILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATN 213
             LD EI K + D  T  Q ET       ++ G  AS   L++ +++ K        A N
Sbjct: 339 ADLDAEISKLRAD-ITALQAETE-----GQIDGLEAS---LSKNIQDMK--------AEN 381

Query: 214 PNLKRFLQASTQQQRANSTASQ 235
            + +  L    + QRA   A +
Sbjct: 382 ADKQHVLHEQAEAQRAEQLADK 403

>Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {ON}
           YKL192C (ACP1) - mitochondrial acyl carrier protein
           [contig 212] FULL
          Length = 123

 Score = 30.8 bits (68), Expect = 3.5,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 405 ITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRK 454
           ITN T FA    K    D+LD  ++ + +E  ++I IP   ADE++S ++
Sbjct: 66  ITNDTHFA----KDLGLDSLDTVELLVAIEEEFDIEIPDKVADEIKSVKE 111

>KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} similar
           to uniprot|P32463 Saccharomyces cerevisiae YKL192C ACP1
           Mitochondrial matrix acyl carrier protein involved in
           biosynthesis of octanoate which is a precursor to lipoic
           acid activated by phosphopantetheinylation catalyzed by
           Ppt2p
          Length = 123

 Score = 30.8 bits (68), Expect = 3.5,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 405 ITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRS 451
           ITN T FA    K    D+LD  ++ + +E  ++I IP   ADE++S
Sbjct: 66  ITNDTHFA----KDLGLDSLDTVELLVAIEEEFDIEIPDKVADEIKS 108

>Kwal_33.14525 s33 complement(706024..706926) [903 bp, 300 aa] {ON}
           YNL166C (BNI5) - bud neck protein [contig 102] FULL
          Length = 300

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 305 IFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAA 346
           ++++P PS P S + T + PTP       P + GG A ++AA
Sbjct: 147 LYQEPAPSAPSSVSTTPKAPTPPSPAVTLPKVRGGPAASSAA 188

>KLLA0A08129g Chr1 (722217..726026) [3810 bp, 1269 aa] {ON} similar
           to uniprot|Q04693 Saccharomyces cerevisiae YML049C RSE1
           RNA splicing and ER to Golgi transport involved in
           secretion and RNA splicing
          Length = 1269

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 10/99 (10%)

Query: 169 TVKQLETNKTEILNKLRGFSASYLALNQKLREDKKKF---------YIECAATNPNLKRF 219
           T + +   K+  L  +  F  SYL   + L ED +K          +IE  +T  NL   
Sbjct: 365 TSEDIHIFKSGALFNVSEFGTSYLTQFESLGEDLEKITSYTPGRRSFIETESTLKNLS-I 423

Query: 220 LQASTQQQRANSTASQNASPLPAATGANQASSPIQQTGA 258
           L + T      S  + N++PL     ANQ  + ++ T A
Sbjct: 424 LDSLTSLNPLTSFHASNSTPLTILAAANQTENLVKLTSA 462

>CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} similar
           to uniprot|P29366 Saccharomyces cerevisiae YBR200w BEM1
           bud emergence mediator
          Length = 557

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 69  DAYRQRQQSAQGFEQGGATSNTGDNT----AGTPTNARSPNGT-PNNNMSSNIQNLLTPQ 123
           D+Y+ ++ +   F +G     TG++T    A  P+  +  NG  P ++   ++ +   P 
Sbjct: 71  DSYKAKRANELSFNKGEFFYVTGEDTSYYKASDPSAGK--NGVVPKSHF--DVIDRTRPS 126

Query: 124 QNEAYGRLIQTSNENGEKIKGEY 146
            ++A GR + TS+ NGEK+   Y
Sbjct: 127 SSDALGRSVSTSSRNGEKMGTLY 149

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 47/121 (38%), Gaps = 16/121 (13%)

Query: 239 PLPAATGA--NQASSPIQQTGAPSQVQQQTATPSQPRSGVNSRSPTQVTS---------- 286
           P+ A++GA  N   SP+Q   +P    +    PS P     S  PT   S          
Sbjct: 68  PMVASSGAALNMGHSPMQTANSPMDAIRSHQVPSPPHEQAISFKPTATGSWSTEFQKDGL 127

Query: 287 VXXXXXXXXXXXXXXRQAIFKQP-NPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAA 345
           V              RQ  F+QP +P++  S T+ Q    P+     R  IT  ++ NA 
Sbjct: 128 VSQKVPAAVAKSDSFRQNHFQQPLHPNLRYSRTMVQSSQLPL---QQREIITPSASHNAT 184

Query: 346 A 346
           A
Sbjct: 185 A 185

>KNAG0C01270 Chr3 (245114..257437) [12324 bp, 4107 aa] {ON} Anc_1.216
            YKR054C
          Length = 4107

 Score = 30.8 bits (68), Expect = 9.8,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 32/51 (62%), Gaps = 4/51 (7%)

Query: 131  LIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGD----PATVKQLETNK 177
            +++   +N E++KG+Y+ L +  E++  E++K +GD     A V++L + K
Sbjct: 3245 MVEDLKQNVEQLKGKYSSLIRDTELIKSELEKVEGDLGRSVALVEKLASEK 3295

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.123    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,300,999
Number of extensions: 2007917
Number of successful extensions: 13727
Number of sequences better than 10.0: 368
Number of HSP's gapped: 14094
Number of HSP's successfully gapped: 408
Length of query: 500
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 386
Effective length of database: 40,409,475
Effective search space: 15598057350
Effective search space used: 15598057350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 68 (30.8 bits)