Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G10516g2.293ON47447423150.0
Kwal_27.115002.293ON47547421280.0
SAKL0E07524g2.293ON47948216640.0
Skud_9.832.293ON49148614340.0
Suva_9.1092.293ON49148614340.0
Smik_9.892.293ON49148614290.0
YIL090W (ICE2)2.293ON49148614130.0
TDEL0G022302.293ON48848214100.0
NCAS0B062202.293ON48648613610.0
KNAG0A053902.293ON49748713620.0
ZYRO0A02024g2.293ON48648213570.0
CAGL0D04202g2.293ON49949513500.0
NDAI0B035202.293ON50149813350.0
ADL208W2.293ON50250613251e-180
KAFR0J013302.293ON49149313161e-178
Ecym_33322.293ON51351512691e-171
KLLA0E08207g2.293ON48647612581e-170
Kpol_1003.422.293ON49048512291e-165
TPHA0C034402.293ON57953711211e-148
TBLA0B059802.293ON49349210131e-133
TBLA0B069902.293ON53653210161e-133
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G10516g
         (474 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   896   0.0  
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   824   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   645   0.0  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   556   0.0  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   556   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   555   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   548   0.0  
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   547   0.0  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   528   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   529   0.0  
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   527   0.0  
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   524   0.0  
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   518   0.0  
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   514   e-180
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   511   e-178
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   493   e-171
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   489   e-170
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   478   e-165
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   436   e-148
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   394   e-133
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            395   e-133

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/474 (95%), Positives = 452/474 (95%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR
Sbjct: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  ARGLAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120
           ARGLAKLASAAYYAQH               NDELKRQIDTNTRPDESLIDLLRSTTQSQ
Sbjct: 61  ARGLAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120

Query: 121 TWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVI 180
           TWVF       VVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVI
Sbjct: 121 TWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVI 180

Query: 181 SGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIE 240
           SGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIE
Sbjct: 181 SGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIE 240

Query: 241 SSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNG 300
           SSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNG
Sbjct: 241 SSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNG 300

Query: 301 EMVWDAILARTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMARE 360
           EMVWDAILARTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMARE
Sbjct: 301 EMVWDAILARTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMARE 360

Query: 361 AIAPAVVINLCFRILIFYSATRIIPALQKKHKRRSRRFMRMLYWYSPCIVIAMYTHLILQ 420
           AIAPAVVINLCFRILIFYSATRIIPALQKKHKRRSRRFMRMLYWYSPCIVIAMYTHLILQ
Sbjct: 361 AIAPAVVINLCFRILIFYSATRIIPALQKKHKRRSRRFMRMLYWYSPCIVIAMYTHLILQ 420

Query: 421 YSGQISNDLCLWGCFPWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLGSKS 474
           YSGQISNDLCLWGCFPWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLGSKS
Sbjct: 421 YSGQISNDLCLWGCFPWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLGSKS 474

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/474 (86%), Positives = 429/474 (90%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           M PRS++QS RVCLTSFYLLLILITIPI+FQVGGLYCGLSFTVTLFNLYLITTTLKIAAR
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  ARGLAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120
           ARG AKLASAAYYAQH               NDELK QIDTNTRPDESLIDLLRS+T SQ
Sbjct: 61  ARGFAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSSTHSQ 120

Query: 121 TWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVI 180
            W+F       VVRPWQF+LLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRG+GSN+WVI
Sbjct: 121 PWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVI 180

Query: 181 SGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIE 240
           SGLM SGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGI+GIVSGRGSTIE
Sbjct: 181 SGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIE 240

Query: 241 SSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNG 300
           SSLFFAYIVRCLYEISPQLATSAMDEI  LVK+TWHNQHRSLRSSDT L YYRDIILKNG
Sbjct: 241 SSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNG 300

Query: 301 EMVWDAILARTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMARE 360
           EM+WDA+LARTNVNV  +G   W SW+RVQPLWKFVKHFTSSVPSSIQEIF LTL MARE
Sbjct: 301 EMIWDAVLARTNVNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSMARE 360

Query: 361 AIAPAVVINLCFRILIFYSATRIIPALQKKHKRRSRRFMRMLYWYSPCIVIAMYTHLILQ 420
           AIAPAVVINLCFRILIFYSATRIIPALQ+KHKRRSRRFMRMLYWYSPCIVIAMYTHLI+Q
Sbjct: 361 AIAPAVVINLCFRILIFYSATRIIPALQRKHKRRSRRFMRMLYWYSPCIVIAMYTHLIMQ 420

Query: 421 YSGQISNDLCLWGCFPWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLGSKS 474
           YSGQISNDLCLWGCFPWS P+  KVVVDSWGFWNWCNIFCTMAIYASEL GSKS
Sbjct: 421 YSGQISNDLCLWGCFPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASELFGSKS 474

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/482 (65%), Positives = 376/482 (78%), Gaps = 12/482 (2%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           M PRS+IQS R CLT+FYLLL+LITIPISFQVGGLYCGLSFTVTLFNLY +TTTLKI ++
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 61  A--RGLAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTR-PDESLIDLLRSTT 117
              R    + S  YY QH               NDELKRQID +   P ESL++ LR+ +
Sbjct: 61  KYNRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNKS 120

Query: 118 QSQTWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNM 177
              +W+F        V+PWQF+LL STPYFTLLEGFFTVLGIQA+GETN+WL     SN 
Sbjct: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180

Query: 178 WVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGS 237
           W+I  L+ SGGVIT +LYYLYRIYVTP+WELS+QTASLLGFT SIV GLG+YGIVSG+GS
Sbjct: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240

Query: 238 TIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIIL 297
            IESSLFFAYIVRC+YEISPQLATSAMDEIF +VK+TW  +H+    +D LL+YYR+++L
Sbjct: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQ-KHQGNLPTDNLLSYYRNVVL 299

Query: 298 KNGEMVWDAILARTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEM 357
           KNGEM+WDAI+ +T     ++   VW    R+QPLWKF K+FT SVPSSI+EIF +TL+M
Sbjct: 300 KNGEMIWDAIVQKTGTTSPSTTQMVWL---RLQPLWKFTKNFTISVPSSIREIFRVTLKM 356

Query: 358 AREAIAPAVVINLCFRILIFYSATRIIPALQKKH---KRRSRRFMRMLYWYSPCIVIAMY 414
           A E++ P VVINL FRIL+FYSATRIIPALQK     ++ SRR MR++YWYSPCIVIAMY
Sbjct: 357 ATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMY 416

Query: 415 THLILQYSGQISNDLCLWGCFPWSVPDTP--KVVVDSWGFWNWCNIFCTMAIYASELLGS 472
           THLILQYSG+++NDLCLWGCFPWS  + P  KVVVD+WGFWNWCN+FCT+AIY  EL+G 
Sbjct: 417 THLILQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGG 476

Query: 473 KS 474
           KS
Sbjct: 477 KS 478

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/486 (56%), Positives = 346/486 (71%), Gaps = 15/486 (3%)

Query: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63
           +S +QS RVC   FYLL  L++IPISF+VGGL CGLSFTVTLF LY ITTTL + A+  G
Sbjct: 6   KSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAKRHG 65

Query: 64  ---LAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120
                 L +  YY+QH               NDEL   +   +   ES +D L+ +  S 
Sbjct: 66  GKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSLNSN 125

Query: 121 --TWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMW 178
              +V        VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN W
Sbjct: 126 QINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTW 185

Query: 179 VISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGST 238
           +IS L+ASGGVITA+LYYLYRIYVTPIW LS+QTASLLGF  S+V GLG+YGIVS +GS 
Sbjct: 186 IISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKGSV 245

Query: 239 IESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK 298
           IESSLFFAYIVRC+YEISP+LAT+A DEI  L K+ W    R+L ++D LL Y+ +++LK
Sbjct: 246 IESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVVLK 305

Query: 299 NGEMVWDAILARTNVNVGASGTPVWA--SWNRV----QPLWKFVKHFTSSVPSSIQEIFY 352
           N EM+W + + R     G     + +  S+ +V    +P WKF K+FT SVP SI E   
Sbjct: 306 NAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINEFCQ 365

Query: 353 LTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSPCI 409
           +T++MA E+++PA+VINLCFR+L+FYSATRIIPALQ+K+    R+SRR MR LYWYSPCI
Sbjct: 366 VTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYSPCI 425

Query: 410 VIAMYTHLILQYSGQISNDLCLWGCF-PWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASE 468
           +IAMYTHLILQYSG++  DLC+WGC   W   + P+++VDSWGFWNWCNIFCT+ +YA+E
Sbjct: 426 LIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTILVYATE 485

Query: 469 LLGSKS 474
           L+GS S
Sbjct: 486 LIGSGS 491

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/486 (56%), Positives = 347/486 (71%), Gaps = 15/486 (3%)

Query: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63
           +S +QS R+C   FYLL  L++IPISF+VGGL CGLSFTVTLF LY ITTTL + AR  G
Sbjct: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRNG 65

Query: 64  ---LAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120
                 L S  YY+QH               NDEL   +   +   ES ++ L+++  S 
Sbjct: 66  GRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKNSLNSN 125

Query: 121 --TWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMW 178
              +V        VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN W
Sbjct: 126 QINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTW 185

Query: 179 VISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGST 238
           +IS L+ASGGVITA+LYYLYRIYVTPIW LS+QTASLLGF  S+V GLG+YGIVS RGS 
Sbjct: 186 IISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQRGSV 245

Query: 239 IESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK 298
           IESSLFFAYIVRC+YEISP+LAT+A DEI  L K+ W    R+L ++D LL Y+ ++ILK
Sbjct: 246 IESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVILK 305

Query: 299 NGEMVWDAILARTNVNVGASGTPVWA--SWNRV----QPLWKFVKHFTSSVPSSIQEIFY 352
           N E++W + + R           + +  S+ +V    +P W+F K+FT SVP SI E   
Sbjct: 306 NAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINEFCQ 365

Query: 353 LTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSPCI 409
           +T++MA E+++PA+VINLCFR+L+FYSATRIIPALQ+K+    R+SRR M+ LYWYSPCI
Sbjct: 366 VTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCI 425

Query: 410 VIAMYTHLILQYSGQISNDLCLWGCF-PWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASE 468
           +IAMYTHLILQYSG++  DLC+WGC   W  PD P+++VDSWGFWNWCNIFCT+ +YA+E
Sbjct: 426 LIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTILVYATE 485

Query: 469 LLGSKS 474
           L+GS S
Sbjct: 486 LVGSGS 491

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/486 (56%), Positives = 346/486 (71%), Gaps = 15/486 (3%)

Query: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63
           +S +QS R+C   FYLL  L++IPISF+VGGL CGLSFTVTLF LY ITTTL + AR  G
Sbjct: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRYG 65

Query: 64  ---LAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120
                 L S  YY+QH               NDEL   +       ES ++ L+++  S 
Sbjct: 66  GKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKNSLNSN 125

Query: 121 --TWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMW 178
              +V        VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN W
Sbjct: 126 QINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTW 185

Query: 179 VISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGST 238
           +IS L+ASGGVITA+LYYLYRIYVTPIW LS+QTASLLGF  S+V GLG+YGIVS +GS 
Sbjct: 186 IISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKGSV 245

Query: 239 IESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK 298
           IESSLFFAYIVRC+YEISP+LAT+A DEI  L K+ W    R+L ++D LL Y+ ++ILK
Sbjct: 246 IESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVILK 305

Query: 299 NGEMVWDAILARTNVNVGASGTPVWA--SWNRV----QPLWKFVKHFTSSVPSSIQEIFY 352
           N EM+W + + R     G     + +  S+ +V    +P WKF K+FT SVP SI E   
Sbjct: 306 NAEMLWGSFIPRGRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSINEFCQ 365

Query: 353 LTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSPCI 409
           +T++MA E+++PA+V+NLCFR+L+FYSATRIIPALQ+K+    R+SRR M+ LYWYSPCI
Sbjct: 366 VTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCI 425

Query: 410 VIAMYTHLILQYSGQISNDLCLWGCF-PWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASE 468
           +IAMYTHLILQYSG++  DLC+WGC   W   D P+++VDSWGFWNWCNIFCT+ +YA+E
Sbjct: 426 LIAMYTHLILQYSGELKKDLCIWGCSEKWFGSDQPEIIVDSWGFWNWCNIFCTILVYATE 485

Query: 469 LLGSKS 474
           L+GS S
Sbjct: 486 LIGSGS 491

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/486 (55%), Positives = 343/486 (70%), Gaps = 15/486 (3%)

Query: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63
           +S +QS R+C   FYLL  L++IPISF+VGGL CGLSFTVTLF LY ITTTL + AR  G
Sbjct: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRHG 65

Query: 64  ---LAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120
                   +  YY+QH               NDEL   +       ES ++ L+++  S 
Sbjct: 66  GRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKNSLNSN 125

Query: 121 --TWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMW 178
              +V        VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN W
Sbjct: 126 QINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTW 185

Query: 179 VISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGST 238
           +IS L+ SGGVITA+LYYLYRIYVTPIW LS+QTASLLG   S+V GLG+YGIVS +GS 
Sbjct: 186 IISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQKGSV 245

Query: 239 IESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK 298
           IESSLFFAYIVRC+YEISP+LAT+A DEI  L K+ W    R+L ++D LL Y+ ++ILK
Sbjct: 246 IESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNVILK 305

Query: 299 NGEMVWDAILARTNVNVGASGTPVWA--SWNRV----QPLWKFVKHFTSSVPSSIQEIFY 352
           N E++W + + R     G     + +  S+ +V    +P WKF K+FT SVP SI E   
Sbjct: 306 NAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSINEFCQ 365

Query: 353 LTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSPCI 409
           +T++MA E+++PA+VINLCFR+L+FYSATRIIPALQ+K+    R+SRR M+ LYWYSPCI
Sbjct: 366 VTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCI 425

Query: 410 VIAMYTHLILQYSGQISNDLCLWGCF-PWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASE 468
           +IAMYTHLILQYSG++  DLC+WGC   W   D P+++VDSWGFWNWCNIFCT+ +YA+E
Sbjct: 426 LIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTILVYATE 485

Query: 469 LLGSKS 474
           L+GS S
Sbjct: 486 LIGSGS 491

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/482 (55%), Positives = 351/482 (72%), Gaps = 12/482 (2%)

Query: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63
           +S +Q  R+ L  FYLL  L+TIPISF+VGGLYCGLSFTVTLFNLYLITTTL + A++ G
Sbjct: 6   KSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQSYG 65

Query: 64  LAKL---ASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRST--TQ 118
                   +  YY QH               N+EL + ++  ++P++SL+++LR+   + 
Sbjct: 66  NKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVFSN 125

Query: 119 SQTWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMW 178
             +W+        VV+PWQ +L  ST +F L EGFFTVLGIQA+GETNRWL     SN W
Sbjct: 126 HSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSNTW 185

Query: 179 VISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGST 238
           +I+ L+ SGGVITA+LYYLYRIYVTPIW LSVQTASLLGFT SIV G+G++GIVS  GS 
Sbjct: 186 IIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKNGSV 245

Query: 239 IESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK 298
           IESSLFFAYIVRC+YEISP+LAT+A DEI  ++K  W    ++L +++ LL+YY+D++LK
Sbjct: 246 IESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDVVLK 305

Query: 299 NGEMVWDAILARTNVNVGASGT---PVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTL 355
           N EMVW++I+ RT  +   + T   P+   W+   P+WKF K F  SVPSSI  +F +TL
Sbjct: 306 NAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGVFQVTL 365

Query: 356 EMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSPCIVIA 412
           ++A E+++PA+V+NLCFR+L+FYSATRIIPALQ+K+    R+SRR M +LYWYSPCI+IA
Sbjct: 366 KLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCILIA 425

Query: 413 MYTHLILQYSGQISNDLCLWGCF-PWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLG 471
           MYTHLILQYSG++++DLCLWGC   W     PK+ +++W FWNWCNIF T+ IY SEL+G
Sbjct: 426 MYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYGSELIG 485

Query: 472 SK 473
            K
Sbjct: 486 GK 487

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/486 (54%), Positives = 341/486 (70%), Gaps = 20/486 (4%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           M   S I+  R+C  +FYLL  LI+IPISF++GGL+CGL+FTV+LF LY ++TTL I AR
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 61  ARG---LAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTT 117
             G      L +  YY QH               N++L   +    +P +S+ D+ +   
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120

Query: 118 QSQT---WVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNG 174
            S T   WV         V+PWQF+L  STP+FTL EGFFT+L IQA+GETN+WL     
Sbjct: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180

Query: 175 SNMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSG 234
           SN WVIS L+ASGGVITA+LYYLYRIYVTPIW+LSVQTASLLGFT S+V GLGIYGIV+ 
Sbjct: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240

Query: 235 RGSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRD 294
           +GS IESS+FFAYIVRC+YEISP+LAT+A +EI  + KE W     +L S + LL+YY +
Sbjct: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300

Query: 295 IILKNGEMVWDAILARTNVNVGASGTPVWASWNRV----QPLWKFVKHFTSSVPSSIQEI 350
           ++LKN E +W++     N  + +  T       RV     P+WK +K FT +VPSSI E+
Sbjct: 301 VVLKNIETIWESFKINDNSFITSFST------ERVITIFMPIWKLLKTFTITVPSSINEL 354

Query: 351 FYLTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSP 407
            ++T +MA E+I+PAV++NLCFR+LIFYSATRIIPALQ++     R+SRR M++LYWYSP
Sbjct: 355 CFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSP 414

Query: 408 CIVIAMYTHLILQYSGQISNDLCLWGCFPWSVP-DTPKVVVDSWGFWNWCNIFCTMAIYA 466
           CI+IAMY HLILQYSG++ ++LCLWGC     P D PK++VDSWGFWNWCNIF T+ +YA
Sbjct: 415 CILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYA 474

Query: 467 SELLGS 472
           SEL+G+
Sbjct: 475 SELIGT 480

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/487 (54%), Positives = 336/487 (68%), Gaps = 23/487 (4%)

Query: 7   IQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG--- 63
           I+  R+C  + YLLL LI+IPISF+VGGLYCGL+FT TLF LY ++TTL I AR  G   
Sbjct: 10  IRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRI 69

Query: 64  LAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTTQSQ--T 121
              L+S  YY QH               N EL + I+ +  P ESL  +L  +  S    
Sbjct: 70  YIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEAN 129

Query: 122 WVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVIS 181
           W+F       VV PW+F+L  STP+FTL EGFFT+L IQA+GETN+WL     SN W+IS
Sbjct: 130 WIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189

Query: 182 GLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIES 241
            L+ S  VI+AALYYLYRIYVTPIWEL+VQTASLLGF  S+VSGLGIYGIVS  GS IES
Sbjct: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDSGSVIES 249

Query: 242 SLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNGE 301
           SLFFAYIVRC+YEISP+LAT+A DE+  L K+ W  +  +L   + L+ YY ++ILKN E
Sbjct: 250 SLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309

Query: 302 MVWDAILARTNVNVGASGTPVW-------ASWNRVQPLWKFVKHFTSSVPSSIQEIFYLT 354
           M WD  + RT    G SGT  +        +W   +P+WKF K+FT SVP SI+EI  +T
Sbjct: 310 MAWDNFILRT----GTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILLMT 365

Query: 355 LEMAREAIAPAVVINLCFRILIFYSATRIIPALQKK---HKRRSRRFMRMLYWYSPCIVI 411
            +M+ E+++PAVVINLCFRILIFYSATRI+P+LQ+K    +RRSR+ M ++YWYSPCI+I
Sbjct: 366 WKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILI 425

Query: 412 AMYTHLILQYSGQISNDLCLWGC----FPWSVPDTPKVVVDSWGFWNWCNIFCTMAIYAS 467
           AMY HLILQYS ++ N+LCLWGC      ++      VVVD+W FWNWCN+FCT+ +YA+
Sbjct: 426 AMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYAN 485

Query: 468 ELLGSKS 474
           EL+G  +
Sbjct: 486 ELIGDTT 492

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/482 (54%), Positives = 348/482 (72%), Gaps = 14/482 (2%)

Query: 6   VIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR---AR 62
           V+QS RV L  FYLL ILITIPISF+VGGLYCGLSFTVTLFNLY ++TTL +  R   +R
Sbjct: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63

Query: 63  GLAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRST--TQSQ 120
                 +  YY+QH               N+EL + +++ ++P++SL+++L+S   +   
Sbjct: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHS 123

Query: 121 TWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVI 180
            W+        +V+PWQ++L  ST +F+L EGFFT+L IQAVGE++RWL     SN+W I
Sbjct: 124 NWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNI 183

Query: 181 SGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIE 240
           + L+ SGGVITAALYYLYRIYVTP+WELS+QTASLLGFT S+V GLG+YGIVS  GS IE
Sbjct: 184 TSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIE 243

Query: 241 SSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNG 300
           SSLFFAYIVRC+YEISP+LAT+A DEI  + KE W    R+  S++ LL+YY D++L + 
Sbjct: 244 SSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSA 303

Query: 301 EMVWDAILARTNVNVG-----ASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTL 355
           EM+W++I+++T          +   P+    +  +P+  F K+FT SVPSSI+ +F +TL
Sbjct: 304 EMMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVTL 363

Query: 356 EMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHKR---RSRRFMRMLYWYSPCIVIA 412
           +MA ++++PA+V+NL FR+LIFYSAT+IIPALQ K  R   +SRR M +LYWYSPCI+IA
Sbjct: 364 KMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIA 423

Query: 413 MYTHLILQYSGQISNDLCLWGCFP-WSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLG 471
           MYTHLILQYSG+++ DLCLWGC   W   +  K+VVDSWGFWNWCNIF T+ +Y SEL+G
Sbjct: 424 MYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELIG 483

Query: 472 SK 473
            K
Sbjct: 484 GK 485

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/495 (53%), Positives = 343/495 (69%), Gaps = 24/495 (4%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           +    V +S R+   + YL+L L++IPISF++GGL CGLSFTVTLFNLYLI+TTL + AR
Sbjct: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62

Query: 61  ---ARGLAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQID-----TNTRPDESLIDL 112
               RG     S  YY+QH               N+E  R +          PD S +DL
Sbjct: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFLDL 122

Query: 113 LR-------STTQSQTWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGET 165
           L+       +   S+ W         +V+PWQ++L  STP+FTLLEGFFT+L IQA+GET
Sbjct: 123 LKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGET 182

Query: 166 NRWLSRGNGSNMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSG 225
           N+WLS    SN W+I+ L+ SGGVIT +LYYLYRIYVTPIW+L++Q+ASLLGF  SIV  
Sbjct: 183 NKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFC 242

Query: 226 LGIYGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSS 285
           LG+YGI+S +GS IESSLFFAYIVRC+YEISP+LAT A +EI  LVK+ W    R+L + 
Sbjct: 243 LGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNR 302

Query: 286 DTLLTYYRDIILKNGEMVWDA-ILARTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVP 344
           D LL YY +++LKN EMVW++ IL R+           W     V P+WKF K+FT SVP
Sbjct: 303 DNLLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRFWLD---VTPVWKFFKNFTVSVP 359

Query: 345 SSIQEIFYLTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQK---KHKRRSRRFMRM 401
           SSI E+  +T +MA E+++PAV++NLCFRILIFYSATRIIPALQ+   K +R+SRR +++
Sbjct: 360 SSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKL 419

Query: 402 LYWYSPCIVIAMYTHLILQYSGQISNDLCLWGCFP--WSVPDTPKVVVDSWGFWNWCNIF 459
           LYWYSPC++IAMYTHLILQYSG++  +LCLWGC    +   D P++V DSW FWNWCNIF
Sbjct: 420 LYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCNIF 479

Query: 460 CTMAIYASELLGSKS 474
            T+ +YA+EL+G+++
Sbjct: 480 WTVLVYANELIGTQA 494

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/498 (51%), Positives = 346/498 (69%), Gaps = 26/498 (5%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           M   S ++  R    +FYLL  LI+IPISF++GGL CGL+FT TLF +Y ++TTL + AR
Sbjct: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60

Query: 61  ARGLAK---LASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTT 117
             G      L    YY+QH               +++L   +  +T+  + + D++R   
Sbjct: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120

Query: 118 QS--QTWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGS 175
            S    W          V+PW+++L  STP+FTL EGFFT+L IQAVGETN+WL     S
Sbjct: 121 SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS 180

Query: 176 NMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGR 235
           N W+IS L+ SGGVITA+LYYLYRIYVTPIW+LS+QTASLLGFT S+V GLG+YGIV+ +
Sbjct: 181 NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK 240

Query: 236 GSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDI 295
           GS IESSLFFAYIVRC+YEISP+LAT+A DEI  + KE W     +L ++D LL YY + 
Sbjct: 241 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF 300

Query: 296 ILKNGEMVWDAILARTNVNVGASGTPVWASWN--------------RV-QPLWKFVKHFT 340
           +L++ +M+W+ ++++ N N   +  P  +S+N              R+ +P+WK  K+FT
Sbjct: 301 VLRHIDMLWELLVSKINQNDPNNTLP--SSFNINFLTTFLSKDLLLRICKPIWKLFKNFT 358

Query: 341 SSVPSSIQEIFYLTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRR 397
            SVPSSI E+  +T +MARE+++PAVVINLCFR+LIFYSATRIIPALQ+++    ++SRR
Sbjct: 359 VSVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRR 418

Query: 398 FMRMLYWYSPCIVIAMYTHLILQYSGQISNDLCLWGC-FPWSVPDTPKVVVDSWGFWNWC 456
            M++LYWYSPC++IAMYTHLILQYSG++  DLCLWGC   W +P+ P+++VDSWGFWNWC
Sbjct: 419 IMKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWC 478

Query: 457 NIFCTMAIYASELLGSKS 474
           NIF T+ IYASEL G+ +
Sbjct: 479 NIFFTIIIYASELFGTTA 496

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  514 bits (1325), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 268/506 (52%), Positives = 343/506 (67%), Gaps = 37/506 (7%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           M P+ +++S R  L SFYL L+LIT+PISFQ+GGLYCGLSFTVTLF LY +TTTLKI A 
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 61  ARG--LAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQI--------------DTNTR 104
            RG     +AS  YY QH               ND+L++++              D N  
Sbjct: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM- 119

Query: 105 PDESLIDLLRSTTQSQTWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGE 164
            +ESL+ LL  +   +  +        VVRPWQ+MLL +TP FTL EGFFTVL IQ +GE
Sbjct: 120 -NESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178

Query: 165 TNRWLSRGNGSNMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVS 224
           T RWL     S  WVIS LM SG VIT ++YYLYRIYVTPIW LSV TA+LLGFT S+V 
Sbjct: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238

Query: 225 GLGIYGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRS 284
           GLG+YGI+SG+GS IESSLFFAY+V C+YEISPQLA +AM EIF +V  TW  Q  +L  
Sbjct: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTL-P 297

Query: 285 SDTLLTYYRDIILKNGEMVWDAILART----NVNVGASGTPVWAS----------WNRVQ 330
            ++LL YY++ IL N E +WD +L +     +V +  + + V             WN+ Q
Sbjct: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356

Query: 331 PLWKFVKHFTSSVPSSIQEIFYLTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKK 390
            LW F K+F++ +P SI EIF +TL +ARE+I  AVV NL FR+++FYSATRIIPALQ+ 
Sbjct: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416

Query: 391 -HKRRSRRFMRMLYWYSPCIVIAMYTHLILQYSGQISNDLCLWGCFPW--SVPDTPKVVV 447
               +SR+ MR++YWYSPCIVIAMYTH+IL+YSG+++N+LC+WGCFPW  S  +  + VV
Sbjct: 417 TGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVV 476

Query: 448 DSWGFWNWCNIFCTMAIYASELLGSK 473
           D+WGFWNWCN+F T+ IYA EL+GS+
Sbjct: 477 DAWGFWNWCNLFFTLLIYAVELIGSR 502

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  511 bits (1316), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 259/493 (52%), Positives = 327/493 (66%), Gaps = 25/493 (5%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           +  +S+I+  R+   +FYLL  LI+IP+SF++GG++CGLSFTVTLF  Y ++TTL I AR
Sbjct: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62

Query: 61  ARG---LAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTT 117
             G      L S  YY QH               NDEL R +   T   E L+       
Sbjct: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVANQDLMV 122

Query: 118 QSQTWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNM 177
               W+        VV+PW+F+L  STP+F L EGFFT+L IQA+GETNRWLS    SN 
Sbjct: 123 SESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNSNS 182

Query: 178 WVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGS 237
           W+IS L+AS GV+TA+LYYLYRIYVTPIWELS QTA+LLG   S+  GLGI+GI+S RGS
Sbjct: 183 WIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISERGS 242

Query: 238 TIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIIL 297
            +ESSLFFAYIVRC+YEISP+LAT+A DEI  L KE W      L  +D +L YYR +IL
Sbjct: 243 VVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSVIL 302

Query: 298 KNGEMVWDAILARTNVNVGASGTPVWAS---WNRVQPLWKFVKHFTSSVPSSIQEIFYLT 354
           KN EM+W+A L++T  +   +    + +   W    PLWKF K+FT SVP SI E+  + 
Sbjct: 303 KNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSGMM 362

Query: 355 LEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKH---KRRSRRFMRMLYWYSPCIVI 411
           L+MA E+I+PAVV+NLCFR+LIFYSATRIIP+LQ+K     R+SRR M++LYWYSPCI+I
Sbjct: 363 LQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCILI 422

Query: 412 AMYTHLILQYSGQISNDLCLWGCFPWSVPDTP----------KVVVDSWGFWNWCNIFCT 461
           AMYTHLILQYSG++  +L LWG      PD+            +VVDSW FWNWCNIF T
Sbjct: 423 AMYTHLILQYSGELKRELYLWG------PDSKLSFLVDKEENNIVVDSWSFWNWCNIFWT 476

Query: 462 MAIYASELLGSKS 474
           + IY  EL G+ +
Sbjct: 477 ILIYGGELFGTPT 489

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  493 bits (1269), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 266/515 (51%), Positives = 331/515 (64%), Gaps = 44/515 (8%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAA- 59
           M  R +++S R  L  FYL L+LITIPISFQVGGLYCGLSFTVTLF LY  TTTLKI   
Sbjct: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTT 60

Query: 60  RARGLAKL-ASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTTQ 118
              G  KL AS  YY QH               +D+L+R +D++     S   +      
Sbjct: 61  NGSGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVN 120

Query: 119 SQTWVFXXXXX-------------XXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGET 165
                                     +V+PWQ+MLL +TPYFTL EGFFTVL IQA+GET
Sbjct: 121 ESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180

Query: 166 NRWLSRGNGSNMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSG 225
            RWL     SN WVI  L+ SG VIT +++YLYRIYVTPIW LSVQTA+LLGFT S+V G
Sbjct: 181 GRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240

Query: 226 LGIYGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSS 285
           LG+YGI+SG+GSTIESSLFFAY+VRC+YEISPQLA +AM EIF +V +TW  Q  +L S 
Sbjct: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-SK 299

Query: 286 DTLLTYYRDIILKNGEMVWDAILARTNVNVGASGTPVWAS-------------------- 325
           + LLTYY   +  N E  WD++L +T +   A+    +                      
Sbjct: 300 NNLLTYYNTFV-SNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQ 358

Query: 326 ---WNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMAREAIAPAVVINLCFRILIFYSATR 382
              W + Q +W F K+F+  +P SI EI  +TL+MA+E+I PAV+ NL FR+L+FYSATR
Sbjct: 359 TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATR 418

Query: 383 IIPALQKK-HKRRSRRFMRMLYWYSPCIVIAMYTHLILQYSGQISNDLCLWGCFPW---S 438
           IIPALQK     +SR+ MR++YWYSPCIVIAMYTHLIL+YSG+++NDLC+WGCFPW   S
Sbjct: 419 IIPALQKATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFS 478

Query: 439 VPDTPKVVVDSWGFWNWCNIFCTMAIYASELLGSK 473
                K VVD+W FWNWCN+F T+ IYA EL+GS+
Sbjct: 479 AKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  489 bits (1258), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 256/476 (53%), Positives = 317/476 (66%), Gaps = 33/476 (6%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           +  +SV+Q+ R+ LT+ YL L+LITIPISFQVGGL CGLSFTVTLF LY ++TT K+   
Sbjct: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101

Query: 61  ARGLAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120
            RG A L++  YY QH               N      ID++T   E             
Sbjct: 102 DRGSA-LSTLIYYLQHLLIPSILFMFLSYFEN------IDSDTVDSE------------- 141

Query: 121 TWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVI 180
              +       +V+PWQ  L+ STP FTLLEG FT+L IQA+GET RWL     SN WVI
Sbjct: 142 ---YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVI 198

Query: 181 SGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIE 240
             L+ SGG+IT +L+Y YRIYVTP+WELS  +ASLLGFTFSIV G+G+YGI +G GS +E
Sbjct: 199 LSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGSVME 257

Query: 241 SSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNG 300
           SSLFFAY+VR +YEISP++A +AMDEIF +VKETW     +L   D LL    +++ KN 
Sbjct: 258 SSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMTKNY 313

Query: 301 EMVWDAILARTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMARE 360
             +W  I+  T  N           W  + PLW  VK+FT SVP SIQEIF +T +MA+E
Sbjct: 314 RAIWSQIVEHTPRNHKYIKMMDQCKW-ILNPLWNSVKNFTKSVPISIQEIFVVTFKMAKE 372

Query: 361 AIAPAVVINLCFRILIFYSATRIIPALQK--KHKRRSRRFMRMLYWYSPCIVIAMYTHLI 418
           ++ PAVVINL FR+LIFYSATRIIP LQ+  K +R  RR M  +YWYSPCI+IAMYTHLI
Sbjct: 373 SLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYSPCIIIAMYTHLI 432

Query: 419 LQYSGQISNDLCLWGCFPWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLGSKS 474
           L+YSGQ+ NDLC+WGCFP+     PK+VVDSW FWNWCNI+ TM IYA EL+GS  
Sbjct: 433 LRYSGQLKNDLCIWGCFPYET--EPKIVVDSWSFWNWCNIYSTMLIYALELMGSNK 486

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  478 bits (1229), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 242/485 (49%), Positives = 319/485 (65%), Gaps = 14/485 (2%)

Query: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63
           +++I+S +V L  FYLL I+ TIPISF++GGLYCGL+FTVTLF LY  +TTL I AR  G
Sbjct: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNIIARRWG 65

Query: 64  LAK---LASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRST--TQ 118
                 + S+ +Y Q+               N++L + I +  +P E+ +DLLR      
Sbjct: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVS 125

Query: 119 SQTWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMW 178
            + W+         V+PWQ +L  STP FTLLEGFFT+LGIQ +GE N WL     SN+W
Sbjct: 126 VKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIW 185

Query: 179 VISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGST 238
           +IS L+ SGG+IT +LYYLYRIY TPIW LSV  A+LLGFT S+V  LGIYGIVS  GS 
Sbjct: 186 IISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSV 245

Query: 239 IESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK 298
           IESSLFFAYIVRC+YEI+P+LAT+A +E    +KE W + H +L  +D  ++Y+ D    
Sbjct: 246 IESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFYDSFHM 305

Query: 299 NGEMVWDAILARTNV-----NVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYL 353
                W    +RT       N       +    +   P+W+ +K  T SVP+SI E+F+L
Sbjct: 306 QAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSISELFHL 365

Query: 354 TLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSPCIV 410
           T+ MA ++++PA++INLCFR++IFYSATRIIPA+QK+ +   R+ R  M+ LYWYSPCI+
Sbjct: 366 TVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCIL 425

Query: 411 IAMYTHLILQYSGQISNDLCLWGC-FPWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASEL 469
           IAMYTHLILQYSG++  DLCLWGC   W   D  ++ VD+W FWNWCNIF T+ IY SEL
Sbjct: 426 IAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIIIYGSEL 485

Query: 470 LGSKS 474
           +G K 
Sbjct: 486 IGGKK 490

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  436 bits (1121), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 236/537 (43%), Positives = 323/537 (60%), Gaps = 70/537 (13%)

Query: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           + PR VI S    L +FYLL I++TIPISF++GG+YCGLSFT TLF LY I+T++ I  +
Sbjct: 50  LIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITK 109

Query: 61  ----ARGLAKLASAAYYAQHXXXXXXXXXXXXXXXNDEL------------KRQIDTNT- 103
                  L  LAS+ +Y Q+               N +L              +  TNT 
Sbjct: 110 RLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169

Query: 104 --------------------RPDESLIDLLRSTTQSQ-----------TWVFXXXXXXXV 132
                               R D  L  +L+   +S+           +W+         
Sbjct: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIF 229

Query: 133 VRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVISGLMASGGVITA 192
           ++PW+F+L+ STP+FTLLEGFFT+LGIQ +GETN WL +   S+ WVI  L++SGGVITA
Sbjct: 230 IKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289

Query: 193 ALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIESSLFFAYIVRCL 252
            LYYL RIYVTP W+L+V TAS+LGFT SIV GLG++GIVS  GS IESSLFFAYIVRC+
Sbjct: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349

Query: 253 YEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK---NGEMVWDAILA 309
           YE+SP+LA SA DE      E W      +  +D +LTY +  I+    +   +   +  
Sbjct: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFP 409

Query: 310 RTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMAREAIAPAVVIN 369
           +T + +G S   +      V+  W F+K+FT +VPSSI ++  +T +MA ++I+PA++IN
Sbjct: 410 KT-IELGISKNLI------VKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIIN 462

Query: 370 LCFRILIFYSATRIIPALQKKHKRRSRR---FMRMLYWYSPCIVIAMYTHLILQYSGQIS 426
           L FR++IFYSATRIIPA+Q++ K  +     FM  +YW+SPC++IAMYTHLILQ+SG++ 
Sbjct: 463 LSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELK 522

Query: 427 NDLCLWGCFPW--SVPDTP-------KVVVDSWGFWNWCNIFCTMAIYASELLGSKS 474
            ++CLW C  W  S  D          ++VDSW FWNWCNIF T+ IYASEL+G +S
Sbjct: 523 KNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  394 bits (1013), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 217/492 (44%), Positives = 309/492 (62%), Gaps = 27/492 (5%)

Query: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63
           +++ +S R      YLL +L+T+PI+FQ+GGL CGL+FT+TLF+ Y ITTTL   AR   
Sbjct: 6   KNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAIARKLR 65

Query: 64  LAKL---ASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDESLIDLLRS--TTQ 118
             +     +  YY Q+               + EL   +       E++  +L++  T  
Sbjct: 66  WQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKNNDTYP 125

Query: 119 SQTWVFXXXXXXXVVRP-WQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNM 177
           S+T  F          P W+F L  STP F L+EGFFT+L IQ +GETN WL+    S++
Sbjct: 126 SKTISFIYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTVKNSSI 185

Query: 178 WVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGS 237
           W+I  L+ S  ++T ++YY+Y+IYVTP+W LS Q ASLL FTFS+V G+ IYGIVS RGS
Sbjct: 186 WIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIVSHRGS 245

Query: 238 TIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIIL 297
            +ESSLFFAYIV C+YEISP +AT+AMD+IF  +KE+W    R+   SD LL YY + ++
Sbjct: 246 VVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYYYNSLI 305

Query: 298 KN-GEMVWDAILARTNVNVGASG------TPVWASWNRVQPLWKFVKHFTSSVPSSIQEI 350
           KN  E +   I+  T  +  ++         V  S    + + K  K FT  +PSSI E+
Sbjct: 306 KNVDEFIKLKIIKLTTKDNFSNKFNSLLFQCVKISKKSFKFILKLSKRFTLGIPSSIYEL 365

Query: 351 FYLTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---------RRSRRFMRM 401
           + +TL+MA E+I+P +++NLC+R+LIFY+ATRIIPAL+ +           + + +FM++
Sbjct: 366 YSITLKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTKSNSKFMKV 425

Query: 402 LYWYSPCIVIAMYTHLILQYSGQISNDLCLWGCFPWSVPDTPKVVVDSWGFWNWCNIFCT 461
           LYWYSPCI+IAMYT+LILQYSG++ ++  L     W+  +  +VVVDSW FWNWCNIF T
Sbjct: 426 LYWYSPCILIAMYTNLILQYSGELKSEFKL-----WNNSNNNEVVVDSWRFWNWCNIFWT 480

Query: 462 MAIYASELLGSK 473
           + +Y SEL+G +
Sbjct: 481 ITLYGSELIGGR 492

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  395 bits (1016), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 218/532 (40%), Positives = 321/532 (60%), Gaps = 66/532 (12%)

Query: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63
           +SV QS R+    FYL+ +LITIP +F++GGLYCGLSFT+TLF+LY ++TT+ + A+ R 
Sbjct: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAK-RT 64

Query: 64  LAK----LASAAYYAQHXXXXXXXXXXXXXXXNDELKRQIDTNTRPDE--SLI-----DL 112
           L      L++  YY QH               +  L  +I +N + D+  SL+     D 
Sbjct: 65  LNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNL-NEILSNNKTDQLPSLLYYIKNDT 123

Query: 113 LRSTTQSQTWVFXXXXXXXVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRG 172
            +S +Q+  ++         V+PW ++L  STP+FTLLEGFFT+LGIQA+GET  WL   
Sbjct: 124 SKSVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLLLK 183

Query: 173 NGSNMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIV 232
               ++ +   + S GVI  A+++LY+IY   +WELS+QTASLLG T S+V  +GI+GI 
Sbjct: 184 KQKKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIF 243

Query: 233 SGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYY 292
           S  GS IESSLF  YI+RC YEISP+L+TSA  EI   +KE W N   S+  ++ +L YY
Sbjct: 244 STNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYY 303

Query: 293 RDIILK--NGEMVWDAILARTNVNVGASGT-----------------------------P 321
            +++LK  N   ++++  +++N     + T                              
Sbjct: 304 NNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKS 363

Query: 322 VWASW-NRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMAREAIAPAVVINLCFRILIFYSA 380
           ++ +W     P+++ +K F  ++P+S+  +  +T ++A ++++P++VINLCFR+LIFYSA
Sbjct: 364 IYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSA 423

Query: 381 TRIIPALQKKHK---RRSRRFMRMLYWYSPCIVIAMYTHLILQYSGQISNDLCLWGC--- 434
           TRIIPA+Q+K+    +RSR F++  Y +SPCIVIAMYT+LILQYSG++ NDLC+WGC   
Sbjct: 424 TRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDII 483

Query: 435 ------------FPWSVPDT---PKVVVDSWGFWNWCNIFCTMAIYASELLG 471
                             DT    + +V+SWGFWNWCNIFCT+ IY  EL+G
Sbjct: 484 SKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,429,192
Number of extensions: 1660875
Number of successful extensions: 5129
Number of sequences better than 10.0: 33
Number of HSP's gapped: 5145
Number of HSP's successfully gapped: 36
Length of query: 474
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 361
Effective length of database: 40,524,141
Effective search space: 14629214901
Effective search space used: 14629214901
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)