Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G10494g2.292ON74774733230.0
Kwal_27.115032.292ON72775425280.0
SAKL0E07546g2.292ON71875122560.0
YIL091C (UTP25)2.292ON72156920960.0
Suva_9.1082.292ON72256920900.0
Skud_9.822.292ON72258320890.0
Smik_9.882.292ON72457020870.0
KLLA0E08229g2.292ON70458320810.0
KAFR0J013402.292ON72875820760.0
NCAS0B062302.292ON72358420680.0
NDAI0B035302.292ON73957120670.0
TBLA0B059702.292ON71974820470.0
Ecym_33312.292ON70857520390.0
KNAG0A054002.292ON72159420220.0
Kpol_1039.462.292ON70456620070.0
TDEL0G022202.292ON71056220070.0
ADL209C2.292ON70457019830.0
ZYRO0A02002g2.292ON70956119690.0
CAGL0D04180g2.292ON70057519630.0
TPHA0D015202.292ON71656219500.0
Kwal_26.71637.88ON622109771.5
KAFR0G022206.121ON52785733.4
KLTH0G14278g8.238ON2173132726.1
YER060W-A (FCY22)7.241ON53048708.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G10494g
         (747 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...  1284   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   978   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   873   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   811   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   809   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   809   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   808   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   806   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   804   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   801   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   800   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   793   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   790   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   783   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   777   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   777   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   768   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   763   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   760   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   755   0.0  
Kwal_26.7163 s26 (243008..244876) [1869 bp, 622 aa] {ON} YAL016W...    34   1.5  
KAFR0G02220 Chr7 (463161..464744) [1584 bp, 527 aa] {ON} Anc_6.1...    33   3.4  
KLTH0G14278g Chr7 (1236981..1243502) [6522 bp, 2173 aa] {ON} sim...    32   6.1  
YER060W-A Chr5 (276572..278164) [1593 bp, 530 aa] {ON}  FCY22Put...    32   8.6  

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score = 1284 bits (3323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/747 (85%), Positives = 639/747 (85%)

Query: 1   MSSLKRSSSAIKGSNEYRSSKSGRKQLRTIRKASGPRRGLXXXXXXXXXXXXXXXXXDKL 60
           MSSLKRSSSAIKGSNEYRSSKSGRKQLRTIRKASGPRRGL                 DKL
Sbjct: 1   MSSLKRSSSAIKGSNEYRSSKSGRKQLRTIRKASGPRRGLAEESANEENNGSETEAEDKL 60

Query: 61  AAPELNEPAQDQRAGGEAYAALLTLLKAEHGGXXXXXXXXXXXXXXXXXXXNVKXXXXXX 120
           AAPELNEPAQDQRAGGEAYAALLTLLKAEHGG                   NVK      
Sbjct: 61  AAPELNEPAQDQRAGGEAYAALLTLLKAEHGGPARRKTKTDDKKTSADPTSNVKDEEESE 120

Query: 121 XXXXXXXXXXXXXXAAIENALMXXXXXXXXXXXXXXXXXXXXINGVTREGGDATELAAGF 180
                         AAIENALM                    INGVTREGGDATELAAGF
Sbjct: 121 SRDNEDEEEDEDEEAAIENALMDEHTSGDEDDEGDDGSHQDDINGVTREGGDATELAAGF 180

Query: 181 EEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPA 240
           EEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPA
Sbjct: 181 EEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPA 240

Query: 241 SAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDPMFQYQXXXXXXXXXXX 300
           SAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDPMFQYQ           
Sbjct: 241 SAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDPMFQYQDLLYEYEDYDK 300

Query: 301 XXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYD 360
                 LYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYD
Sbjct: 301 ETEYRDLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYD 360

Query: 361 ILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKT 420
           ILSKIIQKSGL               EALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKT
Sbjct: 361 ILSKIIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKT 420

Query: 421 IKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLT 480
           IKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLT
Sbjct: 421 IKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLT 480

Query: 481 SIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAG 540
           SIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAG
Sbjct: 481 SIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAG 540

Query: 541 RWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTG 600
           RWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTG
Sbjct: 541 RWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTG 600

Query: 601 YEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYT 660
           YEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYT
Sbjct: 601 YEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYT 660

Query: 661 ERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLD 720
           ERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLD
Sbjct: 661 ERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLD 720

Query: 721 GLSLERIVGTERAAVLTHGPNETYEFK 747
           GLSLERIVGTERAAVLTHGPNETYEFK
Sbjct: 721 GLSLERIVGTERAAVLTHGPNETYEFK 747

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/754 (66%), Positives = 557/754 (73%), Gaps = 34/754 (4%)

Query: 1   MSSLKRSSSAIKGSNEYRSSKSGRKQLRTIRKASGPRRGLXXXXXXXXXXXXXXXXXDKL 60
           MSS KR  +     +  + +K GRKQLR+IRKAS  R                     + 
Sbjct: 1   MSSSKRRYTDHDRHDGEKFTKGGRKQLRSIRKAS--RYDSKKPEDEPVETPEEEINEVED 58

Query: 61  AAPELNEPAQDQRAGGEAYAALLTLLKAEHG-GXXXXXXXXXXXXXXXXXXXNVKXXXXX 119
              E  E ++ Q + GEAYAALLTLLKAEHG G                    +      
Sbjct: 59  VHEERTEVSRKQESNGEAYAALLTLLKAEHGTGKKKVKAGPQGEGSGESQISEI----SP 114

Query: 120 XXXXXXXXXXXXXXXAAIENALMXXXXXXXXXXXXXXXXXXXXINGVTREGGDATELAA- 178
                           AIEN L                        +  +G +A E+   
Sbjct: 115 EAEQDEEEEEEEEEETAIENGLAEH---------------------LDSDGDEAAEIGDE 153

Query: 179 -----GFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRP 233
                G ++E+  D LE HFNSV EKDT+ALD AFK K+VRYRS K+ + KN+EFIYSRP
Sbjct: 154 EDDNNGDQDENASDPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRP 213

Query: 234 TLVNEPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDPMFQYQXXXX 293
            L  E  + +  P G+QSL+ YFIKQRLKIQNDLLDS++ LTPLQK+IVDP+FQYQ    
Sbjct: 214 DLNLESRTPIQVPQGTQSLSPYFIKQRLKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLY 273

Query: 294 XXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAP 353
                        LYALH L+HIYKTRDRILKNNQRLQ+NPDQE+LDQGFTRPKVLIV P
Sbjct: 274 EYENYDQETEYRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVP 333

Query: 354 TRDAAYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLG 413
           TRD AY +LSKII+KSGL               ++LPP YKPKSFQQ+FKGNTNDFFVLG
Sbjct: 334 TRDVAYSVLSKIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLG 393

Query: 414 AKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEF 473
           AKFTRKTIKLYSNFYQSDII+CSPLGIQLILENTDKKKRQDDFLSSIELLV+DQLHSIEF
Sbjct: 394 AKFTRKTIKLYSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEF 453

Query: 474 QNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLING 533
           QN+LHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFT+ S+PFANSLING
Sbjct: 454 QNVLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLING 513

Query: 534 KCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVP 593
           KCRNYAGRWKNH ++  E SSL QLGMRTRL+FQRFD+ G + ++EPD RFKHFCSVIVP
Sbjct: 514 KCRNYAGRWKNHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVP 573

Query: 594 NIVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGR 653
           NIV+STGYEDGILLYIPDYTDF+RVRNYLREKTTILFGDI+EYSEQRQLT+NRA+FQQGR
Sbjct: 574 NIVQSTGYEDGILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGR 633

Query: 654 VKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVR 713
           VKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEE  RYL KSAFLG+ADLNISVVR
Sbjct: 634 VKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVR 693

Query: 714 CLFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747
           CL+SKLDGL+LERIVGTERAA+LTHGPNETYEFK
Sbjct: 694 CLYSKLDGLALERIVGTERAAILTHGPNETYEFK 727

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/751 (58%), Positives = 535/751 (71%), Gaps = 46/751 (6%)

Query: 5   KRSSSAIKGSNEYRSSKSGRKQLRTIRKASGPRRGLXXXXXXXXXXXXXXXXXDKLAAPE 64
           KRS+         ++ K+GRK+LRTI +A+   R                   ++LA   
Sbjct: 6   KRSNRDESHGGYKKAKKTGRKELRTITRANA--RHANESKDDFENEPDMSSEEEELAD-- 61

Query: 65  LNEPAQDQRAGG-------EAYAALLTLLKAEHGGXXXXXXXXXXXXXXXXXXXNVKXXX 117
            N+P  D+           + Y ALLTLL++EH                      V+   
Sbjct: 62  -NKPRSDEEEEEDIETKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYS 120

Query: 118 XXXXXXXXXXXXXXXXXAAIENALMXXXXXXXXXXXXXXXXXXXXINGVTREGGDATELA 177
                             AIENAL+                          E    +++ 
Sbjct: 121 DEDEE------------EAIENALVETNDD---------------------EDDVGSDIN 147

Query: 178 AGFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVN 237
              ++EDK D+ E+HFN+VSE     L +AF+ K++RY+S K+ V++++ FIYSRPT+  
Sbjct: 148 GDEDDEDKADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEG 207

Query: 238 EPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQXXXXXXX 296
           E  S+V AP   +SL+SYFIKQ+LKIQN+LLD + + L PLQK +VDPMFQYQ       
Sbjct: 208 EDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLYEYR 267

Query: 297 XXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRD 356
                     LYALHVLNH+YKTRDRIL+N+Q+LQ+N DQELLDQGFTRPKVLIV PTRD
Sbjct: 268 SYEQEEEYRDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRD 327

Query: 357 AAYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKF 416
            AY I++KII+KSGL                +LPPS KPKSF+ +FKGNTNDFFVLGAKF
Sbjct: 328 VAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLPPSSKPKSFKHIFKGNTNDFFVLGAKF 387

Query: 417 TRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNM 476
           TRKT+KLYSNFYQSD+I CSPLGIQLILENTDKKKRQDDFLSSIEL+V+DQLHSIE+QN+
Sbjct: 388 TRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNL 447

Query: 477 LHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCR 536
            H+T+IF+HINKIPQQQHDADFSRI+MWYIN+QA LFRQT++FTK++SPFANSLINGKCR
Sbjct: 448 SHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCR 507

Query: 537 NYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIV 596
           N+AGRWKNH ++ PE SS+ QLG++ R IFQRFDLVG S  +EPD RFK F SVI+ +I+
Sbjct: 508 NHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASII 567

Query: 597 KSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKV 656
           KSTGYEDGILLYIPDYTD+VRVRN+LREKTT+LFGDINEYSEQ+QLTSNRA+FQQG+VKV
Sbjct: 568 KSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKV 627

Query: 657 LLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLF 716
           LLYTERLHHFRRYEIKGVK+VIFYKPPTNPEF+ EV RY+GKSAFLG ADLNIS VRC++
Sbjct: 628 LLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVY 687

Query: 717 SKLDGLSLERIVGTERAAVLTHGPNETYEFK 747
            KLDGLSLER+VGT+RAAVLTHG NE YEFK
Sbjct: 688 CKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/569 (67%), Positives = 460/569 (80%), Gaps = 3/569 (0%)

Query: 181 EEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPA 240
           + ED+ D  E HFN V EK  + L  AFK K V+Y+S K  +  ++ +IY++P ++ E A
Sbjct: 154 DSEDEQDPFESHFNQVPEKFVDKLSNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEA 213

Query: 241 SAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQXX-XXXXXXX 298
             V +P  S S+ SYF+KQRLK+QN LLD + D LT LQK++VDPMFQY+          
Sbjct: 214 -LVESPYRSSSIYSYFLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILYEYDSYE 272

Query: 299 XXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAA 358
                   LYALHVLNHIYKTRDRILKNNQRLQ+NPD E LDQGFTRPKVLIV PTR+ A
Sbjct: 273 KDEDEYRDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVA 332

Query: 359 YDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTR 418
           Y ++ KII KSG+               ++LPP  KPKSFQ +F+GNTNDFFV+G KFTR
Sbjct: 333 YRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTR 392

Query: 419 KTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLH 478
           K IKLYSNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFLSSIEL+V+DQLHSIE+QN+ H
Sbjct: 393 KAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISH 452

Query: 479 LTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNY 538
           + +IF+H+NKIP QQH+ADFSRI+MWYIN+QAKLFRQT++FTK+ SP ANSLING+CRN 
Sbjct: 453 IFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNM 512

Query: 539 AGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKS 598
           AGRWKNH+VI  ENSS+GQ G++ R IFQRFD++G S+ EEPD RFK F SVI+P IVKS
Sbjct: 513 AGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKS 572

Query: 599 TGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLL 658
           TGYEDGIL+YIPDYTDF+R+RNY++EKTTILFGDINEYS QRQL +NR++FQQGR+KV+L
Sbjct: 573 TGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVML 632

Query: 659 YTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSK 718
           YTERLHH+RRYEIKGVK+V+FYKPP NPEF+ EV R++GK+AFLG  DLNIS VRC++SK
Sbjct: 633 YTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSK 692

Query: 719 LDGLSLERIVGTERAAVLTHGPNETYEFK 747
           LDGLSLERIVGT+RAAVL+H   E YEFK
Sbjct: 693 LDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/569 (67%), Positives = 457/569 (80%), Gaps = 3/569 (0%)

Query: 181 EEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPA 240
           + ED+ D  E HFN VSEK  + +  AFKA  ++Y+S K  +  ++  IYS+P +VN   
Sbjct: 155 DSEDEQDPFESHFNQVSEKYVDDVSNAFKANNIKYKSVKSPLGDDESCIYSKP-VVNGDE 213

Query: 241 SAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQXX-XXXXXXX 298
           + V  P  S S+ SYF+KQRLKIQN LLD + D LT LQK++VDPMFQY+          
Sbjct: 214 TPVERPYKSSSIYSYFLKQRLKIQNGLLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYE 273

Query: 299 XXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAA 358
                   LY LH LNHIYKTRDRILKNNQRLQ+NPD E LDQGFTRPKVLIV PTRDAA
Sbjct: 274 KDEDEYRDLYTLHALNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAA 333

Query: 359 YDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTR 418
           Y ++ KII+KSG+               ++LPPS KPKSFQ +F+GNT+DFFV+G KFTR
Sbjct: 334 YHVVDKIIKKSGIDQVDKKGKFYDQFRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTR 393

Query: 419 KTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLH 478
           K IKLYSNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFLSSIEL+V+DQLHSIE+QN+ H
Sbjct: 394 KAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISH 453

Query: 479 LTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNY 538
           + +IF+HINKIP QQH+ADFSRI+MWYIN+QAKL RQT++FTK+ SP ANSLING+CRN 
Sbjct: 454 IFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLLRQTMVFTKYISPAANSLINGRCRNL 513

Query: 539 AGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKS 598
           AGRWKNH+VI  E SS+GQLG++ R IFQRFD++G S+ EEPD RFK F SVI+P+IVKS
Sbjct: 514 AGRWKNHKVIESETSSIGQLGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKS 573

Query: 599 TGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLL 658
           TGYEDGIL+YIPDYTDF+R+RNY++EKTTILFGDINEYS Q+QL +NR++FQQGRVKVLL
Sbjct: 574 TGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQKQLNANRSLFQQGRVKVLL 633

Query: 659 YTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSK 718
           YTERLHH+RRYEIKGVK VIFYKPP NPEF+ E  RY+GK+AFLG  DLNIS VRC++SK
Sbjct: 634 YTERLHHYRRYEIKGVKNVIFYKPPNNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSK 693

Query: 719 LDGLSLERIVGTERAAVLTHGPNETYEFK 747
           LDGLSLERIVGT+RA VL+H   E YEFK
Sbjct: 694 LDGLSLERIVGTKRAGVLSHAQKEVYEFK 722

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/583 (65%), Positives = 461/583 (79%), Gaps = 3/583 (0%)

Query: 167 TREGGDATELAAGFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQ 226
           + + G   E     + ED+ D  E HFN V EKD + L  AFK+K +RY+S K  ++ ++
Sbjct: 141 SEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVKAPLNGDE 200

Query: 227 EFIYSRPTLVNEPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPM 285
            +IY++P +V E  S+V +P  S S+ SYF+KQRLKIQN L D + D L  LQ+++VDPM
Sbjct: 201 SYIYAQPVVVGE-ESSVESPYKSSSIYSYFLKQRLKIQNGLQDKKIDPLNALQRKLVDPM 259

Query: 286 FQYQXX-XXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFT 344
           FQY+                  LY LHVLNHIYKTRDRILKNNQRLQ+NPD E LDQGFT
Sbjct: 260 FQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFT 319

Query: 345 RPKVLIVAPTRDAAYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKG 404
           RPKVLIV PTRD AY ++ KII KSG+               ++LPP  KP+SFQ +FKG
Sbjct: 320 RPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPRSFQHIFKG 379

Query: 405 NTNDFFVLGAKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLV 464
           NTNDFFV+G KFTRK IKLYSNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFLSSIE++V
Sbjct: 380 NTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIEIMV 439

Query: 465 VDQLHSIEFQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSS 524
           +DQLHSIE+QN+ H+ +IF+H+NKIP QQH+ADFSRI+MWYIN+QAK FRQT++FTK+ S
Sbjct: 440 IDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFRQTMVFTKYIS 499

Query: 525 PFANSLINGKCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRF 584
           P  NSLING+CRN AGRWKNHR I PE SS+GQLG++ R IFQRFD +G S+ EEPD RF
Sbjct: 500 PTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRF 559

Query: 585 KHFCSVIVPNIVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTS 644
           K F SV++P+IVKSTGYEDGIL+YIPDYTDF+R+RNY++EKTTILFGDINEYS QRQL +
Sbjct: 560 KFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNA 619

Query: 645 NRAMFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGL 704
           NR++FQQGR+KV+LYTERLHH+RRY+IKGVK+VIFYKPP NPEF+ E  R++GK+AF G 
Sbjct: 620 NRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGN 679

Query: 705 ADLNISVVRCLFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747
            DLNIS VRC++SKLDG+SLERIVGT+RAAVL+H   E YEFK
Sbjct: 680 TDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/570 (66%), Positives = 461/570 (80%), Gaps = 3/570 (0%)

Query: 180 FEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEP 239
            + ED+ D  E HFN VSEK  + L  AFK+K ++Y+S K  +  ++ +IY++P +V E 
Sbjct: 156 MDSEDEQDPFESHFNQVSEKYVDDLSNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEE 215

Query: 240 ASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQXX-XXXXXX 297
           A  V +P  S S+ SYF+KQRLK+QN LLD + D LT +QK+++DPMFQY+         
Sbjct: 216 A-LVESPYRSSSIYSYFLKQRLKVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSY 274

Query: 298 XXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDA 357
                    LYALHVLNHIYKTRDRILKNNQRLQ+NPD E LDQGFTRPKVLIV PTR+ 
Sbjct: 275 EKDESEYRDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREV 334

Query: 358 AYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKFT 417
           AY ++ KII KSG+               ++LPP  KPKSFQ +FKGNT+DFFV+G KFT
Sbjct: 335 AYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFT 394

Query: 418 RKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNML 477
           RK IKLYSNFYQSDIIICSPLGIQ+ILENTDKKKRQDDFLSSIEL+V+DQLHSIE+QN+ 
Sbjct: 395 RKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNIS 454

Query: 478 HLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRN 537
           H+ +IF+HINKIP QQH+ADFSRI+MWYIN+QAKLFRQT++FTK+ SP ANSLING+C N
Sbjct: 455 HIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCN 514

Query: 538 YAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVK 597
            AGRWKNH+VI  E+SS+GQLG++ R IFQRFD++G S+ EEPD RFK F SVI+P+IVK
Sbjct: 515 MAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVK 574

Query: 598 STGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVL 657
           S GYEDGIL+YIPDYTDF+R+RNY++EKTTILFGDINEYS QRQL +NR++FQQGR+KV+
Sbjct: 575 SVGYEDGILVYIPDYTDFIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVM 634

Query: 658 LYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFS 717
           LYTERLHH+RRYEIKGVK+V+FYKPP NPEF+ E  R++GK+AFLG  DLNIS VRC++S
Sbjct: 635 LYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYS 694

Query: 718 KLDGLSLERIVGTERAAVLTHGPNETYEFK 747
           KLDGLSLERIVGT+RAAVL+H   E YEFK
Sbjct: 695 KLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/583 (65%), Positives = 459/583 (78%), Gaps = 3/583 (0%)

Query: 165 GVTREGGDATELAAGFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDK 224
           GV  E      L+   E ED+ D  E HF+  SE    A D  FK K V+Y+S K  V +
Sbjct: 125 GVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSKTDVSE 184

Query: 225 NQEFIYSRPTLVNEPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDP 284
            +  IYS+P L +E    V    G Q+L+SYFIKQ+LK+ ND  ++   LT +QK++VDP
Sbjct: 185 EESLIYSKPCLDDEEVLPVK---GKQTLSSYFIKQKLKLANDFQNNGLPLTEIQKELVDP 241

Query: 285 MFQYQXXXXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFT 344
           MFQY+                 LY+LH LNH+YKTRDRILKNNQ+LQEN D+ELLDQGFT
Sbjct: 242 MFQYKDMLYEYDDYADEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGFT 301

Query: 345 RPKVLIVAPTRDAAYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKG 404
           RPKVLIV PTRDAA+ I+ KI++KSGL               ++LPP+ KPKSFQ +F+G
Sbjct: 302 RPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQG 361

Query: 405 NTNDFFVLGAKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLV 464
           NTNDFFVLG KFTRK++K+YSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIE+++
Sbjct: 362 NTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVMI 421

Query: 465 VDQLHSIEFQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSS 524
           +DQLHSIE+QN +H+T+IF+HINKIP+QQ +ADFSRI+MWYIN+QAK FRQT++FTK+ S
Sbjct: 422 IDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYIS 481

Query: 525 PFANSLINGKCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRF 584
           PFANS++NGKCRN AGRWKNHR I PE SS+GQLG++ R IFQRFDL G +  +EPD RF
Sbjct: 482 PFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYRF 541

Query: 585 KHFCSVIVPNIVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTS 644
           K F SVIVP+IVKSTGYEDGILLYIPDYTDF+RVRNYL+EKTTI+FG+INEYS Q+QLTS
Sbjct: 542 KFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLTS 601

Query: 645 NRAMFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGL 704
           NRA FQ G+VKVLLYTERLHHFRRYEIK VK+VIFYKPP NPEF+ EV R +GK+ FLG 
Sbjct: 602 NRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGN 661

Query: 705 ADLNISVVRCLFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747
            D+NIS VRC++SK+DGLSLER+VG++RAAVL HG NE YEFK
Sbjct: 662 CDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

 Score = 38.5 bits (88), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 21 KSGRKQLRTIRKASGPRRGLXXXXXXXXXXXXXXXXXDKLAAPELNEPAQD-QRAGGEAY 79
          KSGRKQLR I +A   R                    D  A P +    +D ++  G+AY
Sbjct: 9  KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDN-AEPSVAAEREDVEQHRGQAY 67

Query: 80 AALLTLLKAEH 90
           ALLTLLK+EH
Sbjct: 68 NALLTLLKSEH 78

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/758 (54%), Positives = 512/758 (67%), Gaps = 44/758 (5%)

Query: 4   LKRSSSAIKGSNEYRSSKSGRKQLRTIRKASG--PRRGLXXXXXXXXXXXXXXXXXDKLA 61
           +KRS +   G +  R  K GRK+LR IR+A G  PR                    +  +
Sbjct: 1   MKRSGTGADGYDGVR--KRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSS 58

Query: 62  AP-------ELNEPAQD--QRAGGEAYAALLTLLKAEHGGXXXXXXXXXXXXXXXXXXXN 112
           A        E+ + A D  +    + Y ALLT+LK+EH                     +
Sbjct: 59  AANGDDVGDEVGDEASDDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQD 118

Query: 113 VKXXXXXXXXXXXXXXXXXXXXAAIENALMXXXXXXXXXXXXXXXXXXXXINGVTREGGD 172
                                   IENALM                         +E GD
Sbjct: 119 ESDASEEEEDET----------QQIENALMGSHADDASEDD-------------DKEHGD 155

Query: 173 ATELAAGFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSR 232
             E     E +++ D  E HFNSV EK T+ LD +FK  +++Y+S KL + +++  I+S+
Sbjct: 156 DNE-----ESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSK 210

Query: 233 PTL-VNEPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQX 290
           P +  +E  S V       S++SYF+KQRLK+QN+L+D + D LTPLQKQ+VDPMFQY+ 
Sbjct: 211 PVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKD 270

Query: 291 XXXXXXXX-XXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVL 349
                            LY+LHVLNH+YKTRD+ILKNNQRLQ+N D E LDQGFTRPKVL
Sbjct: 271 ILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVL 330

Query: 350 IVAPTRDAAYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDF 409
           IV PTRD AY ++ KII KSG+               ++LPPS KPKSFQ +FKGNTNDF
Sbjct: 331 IVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDF 390

Query: 410 FVLGAKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLH 469
           FVLG KFTRK IKLYSNFYQSDIIICSPLGIQ+ILENTDKKKRQDDFLSSIEL+++DQLH
Sbjct: 391 FVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLH 450

Query: 470 SIEFQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANS 529
           SIE+QN+ HL +I  HINKIPQ+QHDADFSR++MWYINDQAKLFRQT++FTK+ SP ANS
Sbjct: 451 SIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANS 510

Query: 530 LINGKCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCS 589
           L+NGKC+N++GRWKNH+VI   +SS+ ++G++ R IFQRF+ V  SV +EPD RFK F S
Sbjct: 511 LLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTS 570

Query: 590 VIVPNIVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMF 649
           V VPNIVK+TGYEDG L+YIP+YTD++RVRNYL++KTTILFGDINEYS+Q+QL SNR++F
Sbjct: 571 VTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLF 630

Query: 650 QQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNI 709
           QQGRVKVLLYTERLHH+RRYEIKGVK V+FY+PP NPEF+ EV RY+GK+AFLG  DLNI
Sbjct: 631 QQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNI 690

Query: 710 SVVRCLFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747
           S VRCL+SKLD LSLE IVG++RA VL H  NE YEFK
Sbjct: 691 STVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/584 (64%), Positives = 458/584 (78%), Gaps = 6/584 (1%)

Query: 169 EGGDATELAAGFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEF 228
           E  DA       + ED+ D  E HFN VSEK  + L+ AF    V+Y+S K  +  N+  
Sbjct: 141 EDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGDNKTV 200

Query: 229 IYSRPTLV---NEPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDP 284
           I S PT++   N      SAP  S S++SYF+KQRL++ ND+LDS+ D L PLQK++VDP
Sbjct: 201 ISSIPTIIGKENTEEEKDSAPKSS-SIHSYFLKQRLRVANDMLDSKKDPLGPLQKELVDP 259

Query: 285 MFQYQXX-XXXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGF 343
           MFQY+                  LYALH LNH+YKTRDRILK+N RLQ+N D E  DQGF
Sbjct: 260 MFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGF 319

Query: 344 TRPKVLIVAPTRDAAYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFK 403
           TRPKVLIV PTRD AY+++SKII KSGL               E LPPS KPKSFQ +FK
Sbjct: 320 TRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFK 379

Query: 404 GNTNDFFVLGAKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELL 463
           GNTNDFFVLG KFTRK IKLYSNFYQSDII+CSPLG+Q+I+ENTDKK RQDDFLSSIE+L
Sbjct: 380 GNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKNRQDDFLSSIEVL 439

Query: 464 VVDQLHSIEFQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFS 523
           ++DQLHSIE+QN+ H+ +IF+H+NKIP+QQH+ADFSRI+MWYINDQA+LFRQT+IFTK+ 
Sbjct: 440 IIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYV 499

Query: 524 SPFANSLINGKCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSR 583
           +P AN+LIN +CRN+AGRWKNH +I PE S++ QLG++ +  FQRFD++G SV +EPD R
Sbjct: 500 TPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYR 559

Query: 584 FKHFCSVIVPNIVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLT 643
           FKHF SVI+P+IVKST Y DGIL+YIPDYTD+VR+RNYL+EKTT+LFGDINEYSEQR+L 
Sbjct: 560 FKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELN 619

Query: 644 SNRAMFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLG 703
           SNR++FQQGRVKVLLYTERLHH+RRYE+KGVK+V+FYKPPTNPEF+ EV RY+GKSAFLG
Sbjct: 620 SNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLG 679

Query: 704 LADLNISVVRCLFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747
            ADLNIS VR L+ KLDGLSLERIVG++RA +L H  NE YEF+
Sbjct: 680 NADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/571 (65%), Positives = 463/571 (81%), Gaps = 4/571 (0%)

Query: 181 EEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEP- 239
           E +D+ D  E HFN  +E+  + L AAF+++E++Y++ K+ +D +   I S+PT+  E  
Sbjct: 169 ESDDEQDPFESHFNKPTEQFVDKLHAAFESREIKYKATKIVIDDSHSVISSKPTIFGEEL 228

Query: 240 -ASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQXXXXXXXX 297
             + +S+    QS+ SYFIKQRLKIQN+LL+ + D LTPLQK+++DPMFQY+        
Sbjct: 229 ETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDS 288

Query: 298 X-XXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRD 356
                     LYALH LNH+YKTRDRILKNNQRLQ+N D E LDQGFTRPKVLIV PTRD
Sbjct: 289 YGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRD 348

Query: 357 AAYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKF 416
            AY++  KII+KSGL               ++LPPS KPKSFQQ+FKGNTNDFFVLG KF
Sbjct: 349 TAYEVTDKIIKKSGLDQVDKKGKFYDQFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKF 408

Query: 417 TRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNM 476
           TRK IKLYSNFYQSDII+CSPLG+Q+I+ENTDKKKRQDDFLSSIELL+VDQLHS+E+QN+
Sbjct: 409 TRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNL 468

Query: 477 LHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCR 536
            H+ +IF+H+NKIP +QHDADFSRI+MWYINDQAKLFRQT++FTK+ SP AN++IN +CR
Sbjct: 469 AHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPAANAIINNRCR 528

Query: 537 NYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIV 596
           N+ GRWKNH+++ PE SS+G+LG++ + IFQRFD++G S+ +EPD RFKHF SVI+P+IV
Sbjct: 529 NWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIV 588

Query: 597 KSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKV 656
           KST Y+DGIL+YIPDYTD+VR+RNYL+EKT ILFGDINEYSEQR+L SNR++ QQGRVKV
Sbjct: 589 KSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKV 648

Query: 657 LLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLF 716
           LLYTERLHH+RRYEIKGVK+V+FYKPPTNPEF+ EV R++GK+AFLG  DLNIS VR ++
Sbjct: 649 LLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVY 708

Query: 717 SKLDGLSLERIVGTERAAVLTHGPNETYEFK 747
            KLDGLSLERIVGT+RA +L H  NE YEFK
Sbjct: 709 CKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/748 (53%), Positives = 509/748 (68%), Gaps = 39/748 (5%)

Query: 9   SAIKGSNEYRSS--KSGRKQLRTIRKASGPRRGLXXXXXXXXXXXXXXXXXDKLAAPELN 66
           S  K  N Y     K GR Q R+I+K+SG +R                   + ++   ++
Sbjct: 2   SGFKPQNNYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSID 61

Query: 67  EPA---QDQRAGGEAYAALLTLLKAEHGGXXXXXXXXXXXXXXXXXXXNVKXXXXXXXXX 123
           + A   +D     + Y AL+T+LK+EH                     ++          
Sbjct: 62  KEAEVTEDLEKKKQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDL---------- 111

Query: 124 XXXXXXXXXXXAAIENALMXXXXXXXXXXXXXXXXXXXXINGVTREGGDATELAAGFEEE 183
                        IEN L+                    I     EG +  + A   ++E
Sbjct: 112 -DEDEKFETEEQEIENNLL-------------------SIKDDEEEGENNDDNAGESDDE 151

Query: 184 --DKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPAS 241
             +K D  + HFN  +E+ TN    AFK K+++YRS K  +++ +  IYS P ++ +  +
Sbjct: 152 SDNKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQT 211

Query: 242 AVSAPDGSQSLNSYFIKQRLKIQNDLLD-SQDKLTPLQKQIVDPMFQYQXXXXXX-XXXX 299
            V +P    S++SY +K+RLKI NDLLD + + LT +QK++VDPMFQY+           
Sbjct: 212 KVKSPVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGK 271

Query: 300 XXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAY 359
                  LY LHVLNHIYKTRDRILKNN ++Q+NPD E LDQGFTRPKVLIVAPTRDA Y
Sbjct: 272 DEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGY 331

Query: 360 DILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRK 419
            I+++II+KSG+               E+L P+ KPKSFQ +FKGN+ND+FVLG KFTRK
Sbjct: 332 SIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRK 391

Query: 420 TIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHL 479
            IKLYSNFYQSDII+CSPLG+ +ILENTDKKKRQDDFLSSIEL+++DQLHS+EFQN+ H+
Sbjct: 392 AIKLYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHV 451

Query: 480 TSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYA 539
           TSIFEHINKIP++QHD DFSRIKMWYINDQAKLFRQT+IFTK+ SP AN  +NGKC+N++
Sbjct: 452 TSIFEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWS 511

Query: 540 GRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKST 599
           GRWKNH++I P  SS+GQLG+R + +F RFD++G S+ +EPD RFK+F SVIV +I KST
Sbjct: 512 GRWKNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKST 571

Query: 600 GYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLY 659
            YEDG+L+YI DYTD+VRVRNYL+EKTTILFGDINEYS+Q+Q+ SNRA+FQQ RVKVLLY
Sbjct: 572 SYEDGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLY 631

Query: 660 TERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKL 719
           TERLHHFRRYEIKGVK ++FYK PTNPEF+ EV RY+GK+AF G  D+NIS VR ++SKL
Sbjct: 632 TERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKL 691

Query: 720 DGLSLERIVGTERAAVLTHGPNETYEFK 747
           DGL+LERI+GT+RAAVLTHG NETYEFK
Sbjct: 692 DGLALERIMGTKRAAVLTHGQNETYEFK 719

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/575 (66%), Positives = 458/575 (79%), Gaps = 4/575 (0%)

Query: 177 AAGFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKL-HVDKNQEFIYSRPTL 235
           + G + ED+ D  E HFN +SE DTN LDAAFK K V+Y S KL ++  N+ FI+S+P +
Sbjct: 134 SDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPYMHDNEGFIFSKPVI 193

Query: 236 VNEPAS-AVS-APDGSQSLNSYFIKQRLKIQNDLLDSQDK-LTPLQKQIVDPMFQYQXXX 292
                S AV+  P    +++SYF+K++LK+ N LLD + K LTPL K +VDP+FQY+   
Sbjct: 194 EGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLTPLSKTLVDPIFQYRDLL 253

Query: 293 XXXXXXXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVA 352
                         LY LH+LNHIYKTRDRILKNN +LQEN DQELLDQGFTRPKVL+VA
Sbjct: 254 FEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQELLDQGFTRPKVLVVA 313

Query: 353 PTRDAAYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVL 412
           PTR+ AYDI+ KII KSGL               ++LPP+ KPKSFQ +FKGNTNDFFVL
Sbjct: 314 PTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQHVFKGNTNDFFVL 373

Query: 413 GAKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIE 472
           G KFTRKT+KLYSNFYQSD+I+CSPLGIQLILENTDKKKRQDDFLSSIE+LVVDQLHS+E
Sbjct: 374 GMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSSIEMLVVDQLHSLE 433

Query: 473 FQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLIN 532
           FQN  H+ SIF+HINKIPQ+QHD+DFSRI+MWYINDQA+LFRQTLIFTK+ SPFANSLIN
Sbjct: 434 FQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIFTKYVSPFANSLIN 493

Query: 533 GKCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIV 592
           GKC N++GR+KN R I PE S++ QLG++ R +F RFDL   S  +EPD RFK F SV V
Sbjct: 494 GKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDEPDYRFKFFTSVTV 553

Query: 593 PNIVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQG 652
           P I KSTGYEDGILLYIPDYTDF+RVRNY +++T ILFG+I EYS+QRQ+TSNRA+FQQG
Sbjct: 554 PIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQRQVTSNRALFQQG 613

Query: 653 RVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVV 712
           +VKVLLYTERLHHFRRY+IKGVK+VIFYKPP+NPEF++E+ R +GK+AFLG ADLNIS V
Sbjct: 614 KVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKNAFLGNADLNISTV 673

Query: 713 RCLFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747
           RC + KLD LSLERIVG++RAAVLT   NE YEFK
Sbjct: 674 RCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/594 (62%), Positives = 462/594 (77%), Gaps = 10/594 (1%)

Query: 164 NGVTREGGDATELAAG-FEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHV 222
           N    +  D  ++AA  F+ ED+ D  E HFN   E + N LDAAFK+K+++YRS KL  
Sbjct: 128 NRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSVKLQP 187

Query: 223 DK-----NQEFIYSRPTLVN--EPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKL 274
            K     ++  IYS PT+    + +  +   +   S+ SYF+K+RLKIQNDLL+++ D L
Sbjct: 188 AKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLENKPDNL 247

Query: 275 TPLQKQIVDPMFQYQXXXXXXXXX-XXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQEN 333
             +QK++VDPMFQY+                  LYALH LNH+YKTRDRILKNNQRLQEN
Sbjct: 248 ASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQRLQEN 307

Query: 334 PDQELLDQGFTRPKVLIVAPTRDAAYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSY 393
            D E LDQGFTRPKVLI+APTRD AY I++ II KSG+               ++LPPS 
Sbjct: 308 SDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLPPSS 367

Query: 394 KPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQ 453
           KPKSFQ +FKGNTNDFFVLG KFTRK IKLYSNFYQSDII+CSPLG+Q+I+ENTDKKKRQ
Sbjct: 368 KPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQ 427

Query: 454 DDFLSSIELLVVDQLHSIEFQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLF 513
           DDFLSSIE+ ++DQLHSIE+QN+ HL +IFEH+N IP +QHDADFSRI+MWYINDQA+ F
Sbjct: 428 DDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQARFF 487

Query: 514 RQTLIFTKFSSPFANSLINGKCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVG 573
           RQT++FTK+ SP ANS+INGKCRN++GRWKNHR++  E S +G+L +R R IFQRF++ G
Sbjct: 488 RQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEVTG 547

Query: 574 KSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDI 633
            S+ +EPD RFK F SVI+P I+KSTGYEDGIL+YIP+YTD+VRVRNYL+EKT ILFGDI
Sbjct: 548 GSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILFGDI 607

Query: 634 NEYSEQRQLTSNRAMFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVA 693
           NEYS Q+QLT+NR++FQQGR+KVLLYTERLHH+RRYEIKGVK+VIFYKPP++PEF+ EV 
Sbjct: 608 NEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYTEVV 667

Query: 694 RYLGKSAFLGLADLNISVVRCLFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747
           R +G++AFLG  DLNIS VRC++SKLD L+LE +VGT+RA VL HG NE YEFK
Sbjct: 668 RNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/566 (64%), Positives = 456/566 (80%), Gaps = 2/566 (0%)

Query: 184 DKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAV 243
           D+ DT E HFN VS+   + + A FK K+++Y+S K  +DK +  I+ +P L+ +    +
Sbjct: 139 DQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETI 198

Query: 244 SAPDGSQSLNSYFIKQRLKIQNDLLDS-QDKLTPLQKQIVDPMFQYQXX-XXXXXXXXXX 301
             P  + S +SYFIKQRLKIQNDLLDS ++ LTPL+K+++DPMFQY+             
Sbjct: 199 DNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDE 258

Query: 302 XXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDI 361
                LY+LHVLNHIYKTRD+ILK+NQRLQEN D E LDQGFTRPKVLIV PTRD AY +
Sbjct: 259 KEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQV 318

Query: 362 LSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTI 421
           +  II+KSGL               ++LPP+ KPKSF+ +FKGNTNDFFVLG KFTRK I
Sbjct: 319 VETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAI 378

Query: 422 KLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTS 481
           KLYSNFYQSDIIICSPLGIQ+ILENTDKKKRQDDFLSSIE+++VDQLHSIE+QN+ H+ +
Sbjct: 379 KLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYT 438

Query: 482 IFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGR 541
           I EHINKIPQQQ +ADFSRI+MWYINDQAK  RQT++FT++ SP AN++INGKC N AGR
Sbjct: 439 ILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGR 498

Query: 542 WKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGY 601
           WKN+++I  E+SS+GQLG++ + IFQRFDLVG +V +E D RFK+F SV++ NIVKSTGY
Sbjct: 499 WKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGY 558

Query: 602 EDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTE 661
           EDGIL+YIP+YTD++R+RNY++EKTTILF +INEYS Q+QL SNR+MFQQGR KVLLYTE
Sbjct: 559 EDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTE 618

Query: 662 RLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDG 721
           RLHH+RRYE+KG+K+VIFYKPPTNPEF+ EV R+  K+AFLG +D+NIS +R ++SKLDG
Sbjct: 619 RLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDG 678

Query: 722 LSLERIVGTERAAVLTHGPNETYEFK 747
           L+L+RIVG++RAA+L HG NE+Y+FK
Sbjct: 679 LALQRIVGSKRAAILCHGQNESYDFK 704

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/562 (64%), Positives = 438/562 (77%), Gaps = 3/562 (0%)

Query: 187 DTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAVSAP 246
           DT + HFN V E   + LDAAFK ++++Y+S K+ + +N+  +YS+P L+ + +  +  P
Sbjct: 151 DTFDSHFNQVPENVVDKLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIP 210

Query: 247 DGSQSLNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDPMFQYQXXXXXXXXXXXXXXX-X 305
              +SL SY  KQRLKIQNDL    + LT  Q+ +VDPM QY                  
Sbjct: 211 SRHESLKSYVFKQRLKIQNDL--EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYR 268

Query: 306 XLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSKI 365
            LYALHVLNH+YKTRD+ILKNNQR+ +NPD + LDQGFTRPKVLIV PTRD AY +L KI
Sbjct: 269 DLYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKI 328

Query: 366 IQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYS 425
           I KSG+               E+LPPS KPKSFQ +FKGNTNDFFVLG KFTRK IKLYS
Sbjct: 329 IDKSGIDQIDKKGKFRDQFFEESLPPSSKPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYS 388

Query: 426 NFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEH 485
           NFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIE+ + DQLHSIE+QN+ H+ +IF+H
Sbjct: 389 NFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDH 448

Query: 486 INKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNH 545
           +N IPQ+QHD DF R+++WYIN+QAKLFRQT+IFTK+ SP AN+LIN KC+N  GRWKNH
Sbjct: 449 LNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNH 508

Query: 546 RVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGI 605
             I P  SS+G+LG++ R IFQR DL   S+ EE D RFK F SVI+P+I+KSTGYEDGI
Sbjct: 509 HFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGI 568

Query: 606 LLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHH 665
           L+YIPDY DF+RVRNY++EKTTI+FGDINEYS Q+QL SNRA+FQQGR KVLLYTERLHH
Sbjct: 569 LVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHH 628

Query: 666 FRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLE 725
           FRRYEIKGVK+V+FY+PPTNPEF+ EV R++ KSA LG  DLNIS VR ++SKLDG+SLE
Sbjct: 629 FRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLE 688

Query: 726 RIVGTERAAVLTHGPNETYEFK 747
           RIVGT+RAA+LTHG NE YEFK
Sbjct: 689 RIVGTKRAAILTHGQNEVYEFK 710

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/570 (63%), Positives = 447/570 (78%), Gaps = 6/570 (1%)

Query: 181 EEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPA 240
           E +++ D  ++HFN VS  D   LDAAFK    +YR  K      +E +YS+P   +E  
Sbjct: 138 ESDEEQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQK-EARGEEEILYSKPVASSEGT 196

Query: 241 SA-VSAPDGSQSLNSYFIKQRLKIQNDLL--DSQDKLTPLQKQIVDPMFQYQXXXXXXXX 297
              V  P  ++SL  Y IKQRL++ N L   D +  LTP QK ++DPMFQYQ        
Sbjct: 197 EGPVRVP--ARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDILYEYEG 254

Query: 298 XXXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDA 357
                    LY LH+LNH+YKTRDRILKNNQ+LQ+NPDQELLDQGFTRPK L+V PTR  
Sbjct: 255 YDREREYRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRAT 314

Query: 358 AYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKFT 417
           AYD++  ++Q+SG+                +LPP+ KPKSFQ +FKGNTNDFFVLG KFT
Sbjct: 315 AYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFT 374

Query: 418 RKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNML 477
           RK I+LYSNFYQSD+I+CSPLG+QLI+ENTDKKKRQDDFLSSIE++V+DQLHSIEFQN+ 
Sbjct: 375 RKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIA 434

Query: 478 HLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRN 537
           H+++IF HINKIPQQQ DADFSRI+MWYI DQAKLFRQT++FT++ SPFAN+L+N KC N
Sbjct: 435 HVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCAN 494

Query: 538 YAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVK 597
           +AGR K+HRV+  E S +GQLG++ R IFQRF+++G S  +EPD RFK F SV+VP I K
Sbjct: 495 WAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEK 554

Query: 598 STGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVL 657
           +TGY+ GILLYIP+YTDF+RVRNYL++KT ILFGDINEYS+QRQLTSNRA+FQ GR+KVL
Sbjct: 555 TTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVL 614

Query: 658 LYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFS 717
           LYTERLHHFRR+E+KGVK+VI YKPP+NPEF++E+ RY+GKSAFLG+ADLNI+ VRCL+S
Sbjct: 615 LYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYS 674

Query: 718 KLDGLSLERIVGTERAAVLTHGPNETYEFK 747
           K+D L+LERIVGT+RAAVLTHG NE YEFK
Sbjct: 675 KMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/561 (66%), Positives = 442/561 (78%), Gaps = 5/561 (0%)

Query: 189 LEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAVSAPDG 248
            E HFN  SE   ++LD A+K K++  +S K+ VD ++  IY++ TL  +       P  
Sbjct: 152 FESHFNMQSES-IDSLDEAWKQKKIVNKSGKIRVDDDESLIYTK-TLAGK-GQEFELPSH 208

Query: 249 SQSLNSYFIKQRLKIQNDLLDSQDK-LTPLQKQIVDPMFQYQXXXXXXXXXXXXXXX-XX 306
              L+SY +K++LKIQN+LL+SQD  LTPLQ++IVDP+FQY+                  
Sbjct: 209 KGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDEYRD 268

Query: 307 LYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSKII 366
           LY LHVLNHIYKTRDRILK+NQRL  NPD E LDQGFTRPKVLIVAPTRD AY I+SK+I
Sbjct: 269 LYVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVI 328

Query: 367 QKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYSN 426
           +KSGL               + LPPS KPKSF+  FKGNTNDFFVLG KFTRK I+LYSN
Sbjct: 329 EKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSN 388

Query: 427 FYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEHI 486
           FYQSD+I+CSPLG+QLILENTD+KKRQDDFLSSIEL+++DQL+SIEFQN+ HL +IF H+
Sbjct: 389 FYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHM 448

Query: 487 NKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNHR 546
           NKIP++QHD DF R++MWYIN+QAKL RQTLIFT++ +P AN L+NGKCRN  GRWKNH 
Sbjct: 449 NKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHH 508

Query: 547 VIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGIL 606
            I  E SS+ +LG R R IFQR DL G SV +EPD RF+ F SVIVP+I KSTGYEDGIL
Sbjct: 509 QITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGIL 568

Query: 607 LYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHHF 666
           LYIPDY DF+RVRNYL++KTTILFGDINEYS+ RQLTS R++FQQGR+KVLLYTERLHHF
Sbjct: 569 LYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHF 628

Query: 667 RRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLER 726
           RRYEIKGVK+VIFY+PP+NPEF+ EV RY+GKSAFLG  DLNIS VRC++SKLDGL+LER
Sbjct: 629 RRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALER 688

Query: 727 IVGTERAAVLTHGPNETYEFK 747
           IV ++RAAVLTHG NE YEFK
Sbjct: 689 IVSSKRAAVLTHGQNEIYEFK 709

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 6/83 (7%)

Query: 8  SSAIKGSNEYRSSKSGRKQLRTIRKASGPRRGLXXXXXXXXXXXXXXXXXDKLAAPELNE 67
          + AI GS      K GRK LR+IR+A   +  +                 D       NE
Sbjct: 9  TDAIDGSR-----KRGRKDLRSIRRARNDKEPVEEPEIPVASEEDGELSEDS-EEDATNE 62

Query: 68 PAQDQRAGGEAYAALLTLLKAEH 90
            + + +  +AY ALLT+LK+EH
Sbjct: 63 VQEQEDSKEKAYGALLTILKSEH 85

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/575 (62%), Positives = 454/575 (78%), Gaps = 10/575 (1%)

Query: 182 EEDKPDTLEIHFNSV-SEKDTNALDAAFKAKEVRYRSCKLHV---DKNQ---EFIYSRPT 234
           ++++ D  + HFN   + K   AL  A K  ++RY+S KL V   D++Q   + I+S P 
Sbjct: 127 DDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPY 186

Query: 235 LVNEPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQXXXX 293
           +  E    +  P    SL+SYF+K+RL+IQN+LLD++ + LT LQ++IVDPM QY+    
Sbjct: 187 IEGE-TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILY 245

Query: 294 XXXXX-XXXXXXXXLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVA 352
                         LY LHVLNH+YKTRD+I+KNNQ+LQ+NPD E LDQGFTRPKVLI+A
Sbjct: 246 EYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIA 305

Query: 353 PTRDAAYDILSKIIQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVL 412
           PTRD+AY I++K+I+KSGL                + PPS KPKSFQ +FKGNTND+FVL
Sbjct: 306 PTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTNDYFVL 365

Query: 413 GAKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIE 472
           G KFTRK IKLYSNFYQSDII+CSPLG+Q+I+ENTDKKKRQDDFLSS+E+ ++DQ HSIE
Sbjct: 366 GVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIE 425

Query: 473 FQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLIN 532
           +QN  HL +IF+H+NKIPQ+QHDADFSRI+MWYINDQAK FRQT+IFTK+ SP ANSL+N
Sbjct: 426 YQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLN 485

Query: 533 GKCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIV 592
            KCRN  GRWKNH+++  E+SS+G +G++ R IFQRF+++G SV++EPD RFK F SV++
Sbjct: 486 IKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVI 545

Query: 593 PNIVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQG 652
            NI KSTGY+DG L+YIP+Y+D+VRVRNY++EKT+ILFGDINEYSEQR LTSNR +F QG
Sbjct: 546 SNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQG 605

Query: 653 RVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVV 712
           R+KVLLYTERLHHFRRYE+KGVK V+FYKPP++PEF++EV RY+GK+ FLG ADLNIS V
Sbjct: 606 RLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTV 665

Query: 713 RCLFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747
           RC +SKLDGL+LE+IVGT+R  VLTHG NETYEFK
Sbjct: 666 RCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/562 (62%), Positives = 446/562 (79%), Gaps = 3/562 (0%)

Query: 189 LEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQE--FIYSRPTLVNEPASAVSAP 246
            +IHFN V E   + +   F  K+++Y S K+ +  +++  FIYS+P + +     V +P
Sbjct: 155 FDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESP 214

Query: 247 DGSQSLNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDPMFQY-QXXXXXXXXXXXXXXXX 305
               SL+SYFIK+RL+I N+LLD +D LT LQK +VDPMFQY                  
Sbjct: 215 IKKSSLDSYFIKKRLEITNNLLDGKDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYR 274

Query: 306 XLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSKI 365
            LY LH+LNH+YKTRD++LK+NQRLQEN + E LDQGFTRPKVLIV PTRD AY+++  I
Sbjct: 275 ELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETI 334

Query: 366 IQKSGLXXXXXXXXXXXXXXXEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYS 425
           I+KSGL               ++LPPS KPKSFQ +FKGNTNDFFVLG KFTRK +KLYS
Sbjct: 335 IRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYS 394

Query: 426 NFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEH 485
           NFYQSD+IICSPLG+ +I ENTDKKK+QDDFLSSIE+ ++DQLHS+E+QN+ H+ +IFEH
Sbjct: 395 NFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEH 454

Query: 486 INKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNH 545
           +NKIP++QHDADFSRI+MWYINDQA+LFRQT+IFTK+ SP AN++INGKCRN AGRW+N 
Sbjct: 455 LNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNK 514

Query: 546 RVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGI 605
             +  E SSLG+LG++ R IFQRFDLVG ++++EPD RFK F SV++ +I+KSTGYEDGI
Sbjct: 515 IQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGI 574

Query: 606 LLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHH 665
           L+YIP+Y+D++RVRNY++EKTT+LFGDINEYS+QR+L SNR++FQQGRVKVLLYTERLHH
Sbjct: 575 LVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHH 634

Query: 666 FRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLE 725
           +RRYEIKGVK+VIFY PPTNPEF+ EV R++GK+AFLG  D+NI+ VR ++SKLD LSLE
Sbjct: 635 YRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLE 694

Query: 726 RIVGTERAAVLTHGPNETYEFK 747
           RIVGT+RAAVL+   NE YEFK
Sbjct: 695 RIVGTQRAAVLSRAENEVYEFK 716

>Kwal_26.7163 s26 (243008..244876) [1869 bp, 622 aa] {ON} YAL016W
           (TPD3) - protein phosphatase 2A regulatory subunit A
           [contig 47] FULL
          Length = 622

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 9/109 (8%)

Query: 415 KFTRKTIKLYSNFYQSDIIICS-------PLGIQLILENTDKKKRQD-DFLSSI-ELLVV 465
           KF ++ + LY    Q D  +         P+ I L+ +N D     D D++S + + +V 
Sbjct: 177 KFRKELLALYLQLVQDDTPMVRRAAGKNLPVLIDLLTQNPDLSTSDDWDYISGMFQKIVS 236

Query: 466 DQLHSIEFQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFR 514
           D   S++F  +  L SI +  NK     H  D  R  +  I D+A   R
Sbjct: 237 DTQDSVKFLAVDVLVSILKFFNKKNDTTHSKDLLRSAIQLITDEAWRVR 285

>KAFR0G02220 Chr7 (463161..464744) [1584 bp, 527 aa] {ON} Anc_6.121
           YBR223C
          Length = 527

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 8/85 (9%)

Query: 605 ILLYIPDYTDF--VRVRNYLREKTTILFGDINEYSEQ-----RQLTSNRAMFQQGRVKVL 657
           I +Y+P YT      + N+ R+K+  +F   N ++       +Q+        QG+   +
Sbjct: 168 IDIYMPPYTSHHSKMILNFYRDKSVKIFIPSNNFTHHETNLPQQICWCSPSLYQGKTGSV 227

Query: 658 LYTERL-HHFRRYEIKGVKTVIFYK 681
           L+ E L  + + YE K + T I+Y+
Sbjct: 228 LFQENLLSYLKSYEDKTLNTTIYYE 252

>KLTH0G14278g Chr7 (1236981..1243502) [6522 bp, 2173 aa] {ON} similar
            to uniprot|P32639 Saccharomyces cerevisiae YER172C BRR2
            RNA-dependent ATPase RNA helicase involved in the
            facilitation and disruption of snRNA interactions
            required for disruption of U4/U6 base-pairing in native
            snRNPs to activate the spliceosome for catalysis
          Length = 2173

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 55/132 (41%), Gaps = 30/132 (22%)

Query: 415  KFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQ 474
            KFT   +       +S +I+C+P  + L+     +K +Q   +  IELL++DQ H +   
Sbjct: 1441 KFTEDNLVNLKLLGESHLILCTPSQLDLV----SRKWKQRKNVQKIELLILDQAHLVG-- 1494

Query: 475  NMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGK 534
                        N +P   ++   SR  M +I+ Q       L     S+P ANS     
Sbjct: 1495 ------------NGLPGAVYENIISR--MTFISAQ---LETKLRIVALSNPVANS----- 1532

Query: 535  CRNYAGRWKNHR 546
             R++ G W   R
Sbjct: 1533 -RDF-GEWMGVR 1542

>YER060W-A Chr5 (276572..278164) [1593 bp, 530 aa] {ON}
           FCY22Putative purine-cytosine permease, very similar to
           Fcy2p but cannot substitute for its function
          Length = 530

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 198 EKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAVSA 245
           + ++ ALD    A +V Y   +LH  +  EFI ++P+  N  A+A++A
Sbjct: 21  DLESGALDTKSSAADVYYEGVELH--RTNEFIDNKPSFFNRIAAALNA 66

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,664,936
Number of extensions: 2771401
Number of successful extensions: 7708
Number of sequences better than 10.0: 30
Number of HSP's gapped: 7840
Number of HSP's successfully gapped: 36
Length of query: 747
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 630
Effective length of database: 40,065,477
Effective search space: 25241250510
Effective search space used: 25241250510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)