Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G10472g2.291ON72553013e-37
Kwal_YGOB_Anc_2.2912.291ON72552934e-36
Cgla_YGOB_Anc_2.2912.291ON72552657e-32
NCAS0G037602.291ON72552641e-31
NDAI0G006902.291ON72552632e-31
KNAG0H019702.291ON72552623e-31
Kpol_1003.412.291ON72552596e-31
TDEL0G022102.291ON72542544e-30
Smik_14.3062.291ON72552492e-29
YNL024C-A (KSH1)2.291ON72552492e-29
Skud_14.3042.291ON72552493e-29
KAFR0H032802.291ON72552483e-29
Suva_14.3222.291ON72552475e-29
ADL210W2.291ON72552458e-29
SAKL0E07568g2.291ON72552459e-29
TPHA0C034302.291ON72552423e-28
TBLA0B069702.291ON72542423e-28
KLLA0E08251g2.291ON72552345e-27
ZYRO0A01980g2.291ON72542335e-27
Ecym_33302.291ON72542223e-25
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G10472g
         (72 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly s...   120   3e-37
Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72 a...   117   4e-36
Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72...   106   7e-32
NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}...   106   1e-31
NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291...   105   2e-31
KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}...   105   3e-31
Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON} (99502..9...   104   6e-31
TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291...   102   4e-30
Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON...   100   2e-29
YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON} ...   100   2e-29
Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON...   100   3e-29
KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}...   100   3e-29
Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON...   100   5e-29
ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic homo...    99   8e-29
SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON...    99   9e-29
TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291...    98   3e-28
TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON} Anc_2.2...    98   3e-28
KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON...    95   5e-27
ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly s...    94   5e-27
Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to ...    90   3e-25

>KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  120 bits (301), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 55/55 (100%), Positives = 55/55 (100%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT
Sbjct: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72

>Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  117 bits (293), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 55/55 (100%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSCTYIHSQWPSLLDRYK+HSMLGAFWKCARIGERASPYVS+ACIIMAVNQFQT
Sbjct: 18 ICSCTYIHSQWPSLLDRYKDHSMLGAFWKCARIGERASPYVSLACIIMAVNQFQT 72

>Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  106 bits (265), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 51/55 (92%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSCTYIH+QWPSLLDRYK H +LGAFWK ARIGERASPYVS+ACI+MA+NQF +
Sbjct: 18 ICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSVACILMAINQFNS 72

>NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  106 bits (264), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 51/55 (92%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSCTY+H+QWPSLLDRYK+H  LGAFWK ARIGERASPYVS+ACIIMA+NQF +
Sbjct: 18 ICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSLACIIMAINQFNS 72

>NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  105 bits (263), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 51/55 (92%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSCTY+HSQWPS+LDRYK+H  LGAFWK ARIGERASPYVS+ACIIMA+NQF +
Sbjct: 18 ICSCTYVHSQWPSILDRYKDHGALGAFWKMARIGERASPYVSLACIIMAINQFNS 72

>KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  105 bits (262), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 51/55 (92%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSCTY+H+QWPSLLDRYKEH  LGAFWK AR+GERASPYVS+ACI+MA+NQF +
Sbjct: 18 ICSCTYVHTQWPSLLDRYKEHEALGAFWKMARLGERASPYVSLACILMALNQFMS 72

>Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON}
          (99502..99720) [219 nt, 73 aa]
          Length = 72

 Score =  104 bits (259), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 46/55 (83%), Positives = 50/55 (90%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICS TYIHSQWPS LDRYK+ S+LGAFWK ARIGERASPYVS+ACIIMAVNQF +
Sbjct: 18 ICSSTYIHSQWPSFLDRYKDQSVLGAFWKLARIGERASPYVSLACIIMAVNQFNS 72

>TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  102 bits (254), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 41/54 (75%), Positives = 50/54 (92%)

Query: 19 CSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          CSCTY+H+QWPSLLDRYK+H + GAFWK AR+GERASPYVS+ACI+MA+NQF +
Sbjct: 19 CSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSVACILMAINQFNS 72

>Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  100 bits (249), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 41/55 (74%), Positives = 50/55 (90%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSC+Y+H QWPSLLDRYK H +LGAFWK AR+GERASPYVS+ACI+MA++QF +
Sbjct: 18 ICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSLACILMAISQFNS 72

>YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON}
          KSH1Essential protein suggested to function early in
          the secretory pathway; inviability is suppressed by
          overexpression of Golgi protein Tvp23p; ortholog of
          human Kish
          Length = 72

 Score =  100 bits (249), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 41/55 (74%), Positives = 50/55 (90%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSC+Y+H QWPSLLDRYK H +LGAFWK AR+GERASPYVS+ACI+MA++QF +
Sbjct: 18 ICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSLACILMAISQFNS 72

>Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  100 bits (249), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (90%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSC+Y+H QWPSLLDRYK H +LGAFWK ARIGERASPYVS+ACI+MA++QF +
Sbjct: 18 ICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSLACILMAISQFNS 72

>KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  100 bits (248), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSCTYIH+QWPSLL+RYK+H  LG FWK AR+GER SPYVS+ACI+MAVNQF +
Sbjct: 18 ICSCTYIHTQWPSLLERYKDHEALGIFWKMARVGERGSPYVSLACILMAVNQFNS 72

>Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score = 99.8 bits (247), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 41/55 (74%), Positives = 49/55 (89%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSC+Y+H QWPSLLDRYK H + GAFWK ARIGERASPYVS+ACI+MA++QF +
Sbjct: 18 ICSCSYVHGQWPSLLDRYKNHEVFGAFWKMARIGERASPYVSLACILMAISQFNS 72

>ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL024CX; YNL024CX
          was overlooked in Saccharomyces cerevisiae
          Length = 72

 Score = 99.0 bits (245), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICS TY+H+QWPSLL+RYKEHS+LG FWK ARIGERASPYVSIACI MA+NQ  +
Sbjct: 18 ICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSIACIAMAINQINS 72

>SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON}
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping, microarray-based
          expression analysis, and genome-wide homology searching
          Length = 72

 Score = 99.0 bits (245), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSCTYIH+QWPSLLDRYK H ML  FWK AR+GERASPYVS+ACI MA++QF++
Sbjct: 18 ICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSLACICMAISQFKS 72

>TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score = 97.8 bits (242), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICS TYIHSQWPSL DRYK+  +L  FWK +RIGERASPYVSIACIIMAVNQF +
Sbjct: 18 ICSSTYIHSQWPSLFDRYKDTGVLSTFWKLSRIGERASPYVSIACIIMAVNQFNS 72

>TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score = 97.8 bits (242), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQ 71
          ICS TYIH QWPSLLDRYK HS LGAFWK ARIGERASPYVS+ACI MA++QF 
Sbjct: 18 ICSSTYIHCQWPSLLDRYKNHSTLGAFWKMARIGERASPYVSLACIAMAISQFN 71

>KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON}
          highly similar to uniprot|Q8TGJ3 Saccharomyces
          cerevisiae YNL024C-A Identified by gene-trapping
          microarray-based expression analysis and genome-wide
          homology searching
          Length = 72

 Score = 94.7 bits (234), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%)

Query: 18 ICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          ICSCTYIH+Q PSLLDRYK+  +LG FWK ARIGERASPYVS+ACI MAV+QF +
Sbjct: 18 ICSCTYIHAQRPSLLDRYKDSGILGVFWKFARIGERASPYVSLACIAMAVSQFNS 72

>ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score = 94.4 bits (233), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (88%)

Query: 19 CSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          CSCTY+H+QWPSLLDRYK H +L AFWK AR+GERASPYVS+ACI+MA++Q  +
Sbjct: 19 CSCTYVHAQWPSLLDRYKGHGVLSAFWKMARVGERASPYVSLACILMALSQLNS 72

>Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to
          Ashbya gossypii ADL210W
          Length = 72

 Score = 90.1 bits (222), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%)

Query: 19 CSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSIACIIMAVNQFQT 72
          CS TY+H QWPSLL+RYK+H +L  FWK ARIGERASPYVS+ACI+M  NQF +
Sbjct: 19 CSSTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSLACIVMVANQFNS 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.133    0.457 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,244,932
Number of extensions: 130862
Number of successful extensions: 299
Number of sequences better than 10.0: 20
Number of HSP's gapped: 299
Number of HSP's successfully gapped: 20
Length of query: 72
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 27
Effective length of database: 48,321,429
Effective search space: 1304678583
Effective search space used: 1304678583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 59 (27.3 bits)