Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G10450g2.290ON26126113010.0
Kwal_27.115092.290ON26126110511e-145
SAKL0E07590g2.290ON2602618601e-116
TDEL0G022002.290ON2612628231e-111
Kpol_1003.402.290ON2612627981e-107
Ecym_33292.290ON2582617931e-106
ZYRO0A01958g2.290ON2632667771e-104
NCAS0B062402.290ON2602597581e-101
TBLA0B059602.290ON2662507521e-100
Skud_9.802.290ON2642587456e-99
YIL093C (RSM25)2.290ON2642427371e-97
Smik_9.862.290ON2642427361e-97
KAFR0J013502.290ON2642467326e-97
KLLA0E08273g2.290ON2612627264e-96
Suva_9.1062.290ON2642567257e-96
NDAI0B035402.290ON2612477031e-92
TPHA0C034202.290ON2682507005e-92
KNAG0A054102.290ON2662416822e-89
CAGL0D04158g2.290ON2722556675e-87
ADL211C2.290ON2251795941e-76
KLTH0C01166gna 1ON29754730.82
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G10450g
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   505   0.0  
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   409   e-145
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   335   e-116
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   321   e-111
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   311   e-107
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   310   e-106
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   303   e-104
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   296   e-101
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   294   e-100
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   291   6e-99
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   288   1e-97
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   288   1e-97
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   286   6e-97
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   284   4e-96
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   283   7e-96
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   275   1e-92
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   274   5e-92
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   267   2e-89
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   261   5e-87
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   233   1e-76
KLTH0C01166g Chr3 (107662..108555) [894 bp, 297 aa] {ON} weakly ...    33   0.82 

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/261 (94%), Positives = 247/261 (94%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
           SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIX 180
           LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRI 
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240
                        MFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW
Sbjct: 181 EEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240

Query: 241 SAQESQPQSDAKAEDTKELQL 261
           SAQESQPQSDAKAEDTKELQL
Sbjct: 241 SAQESQPQSDAKAEDTKELQL 261

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  409 bits (1051), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 202/261 (77%), Positives = 228/261 (87%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MKVQQNAVNVLERTSSYL+AG+LKKTPAWY+VVA +PPSKRFVREPRLVNPSTN E AKL
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
           SEF E Y+ ENRSYKTRASR ++QVSG+KL+ APKLKYAEDKLRE+F+EQHPWELSRPKM
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIX 180
           LVENSG  DYDWST+QQLGKPLDGESVVQRTLYLL++K HQELLAAYDQARFEFYRLRI 
Sbjct: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240
                        M GSVFGPSAIDFGL+KEQKIIDVWKQKAIDQ+E++SARN NPSESW
Sbjct: 181 EEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTNPSESW 240

Query: 241 SAQESQPQSDAKAEDTKELQL 261
           S+  S   +D+K ++T+E++L
Sbjct: 241 SSSPSSQDNDSKVQETEEIKL 261

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  335 bits (860), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 200/261 (76%), Gaps = 1/261 (0%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MKVQ NAVN+LERTS+YL+AGLL K PAWY+VVA VPPSK F REP++ NPS NK  A L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
           SE++E   ++N +YKTR S S+R+VS +KL+ APKL YAEDKLRE+FY+QHPWELSRPK+
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIX 180
           L+EN+G   YDWSTIQQLGKPLDGESVVQRTLYLL+ K    L+ AYDQARFEFYR+R+ 
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240
                        MFGSVFG S+I++GLEKEQK+I+ WK+KAI QTE+M+AR+  PS +W
Sbjct: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPSAAW 240

Query: 241 SAQESQPQSDAKAEDTKELQL 261
                  +   + +D +ELQL
Sbjct: 241 ENAAEANEESVE-QDVEELQL 260

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  321 bits (823), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 202/262 (77%), Gaps = 2/262 (0%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NAVNVLERTS+YL++GLL+ TPAWYDVVA +PP  +F REPRL+NPS  K+ A L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
            + A++ + +   +KTRAS  +++++ +KL+ APKLK+ ED+LREVFY+QHPWELSRPK+
Sbjct: 61  KDHADEPNAKG-FFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIX 180
           LVEN    ++DWS IQQL KPLDGESV+QRTL+LL+    + L  AYDQARFEFYRLR+ 
Sbjct: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240
                        MFGS++GPSAIDFG+++EQK ID+WKQKAI++T++++AR  NPSE+W
Sbjct: 180 QEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239

Query: 241 SAQESQP-QSDAKAEDTKELQL 261
           +A E QP + D + +D +E+ L
Sbjct: 240 AAGEEQPDKKDLEDQDIEEIVL 261

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  311 bits (798), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 194/262 (74%), Gaps = 2/262 (0%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q+NAVNVLERTS+YL+AGLL K PAWY+VVA VPP K+F R P+L NPS ++   +L
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
               +  +  N  +KTR +  +R  +  +L++A KL Y ED+LRE+FY+QHPWELSRPK+
Sbjct: 61  HSL-DSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIX 180
           L+EN+G   YDWS +QQ+GKPLDGESVVQRTLYL++ K    L+ AYD AR+EFYRLR+ 
Sbjct: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240
                        MFGSVFGPSAI++G++KEQK+ID WK+KAI QTE+M+AR INPSESW
Sbjct: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239

Query: 241 SAQESQP-QSDAKAEDTKELQL 261
           +  E  P ++D   ED +E++L
Sbjct: 240 ATDEKDPKKNDDIEEDVEEIKL 261

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  310 bits (793), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 148/261 (56%), Positives = 189/261 (72%), Gaps = 3/261 (1%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NA N+LERTSS+L+ GLL +TP WYDV+   PPS +F R+P+LVNPST   TAKL
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
            EF++  +  + +YKTRA++ E++VS S ++ APKL Y EDKLR +FY+QHPWELSRPK+
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIX 180
           LVEN G   +DWS IQQLGKPLDGESVVQRTLYLL +  H  L+ AYDQARFEFYRLR+ 
Sbjct: 121 LVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRMQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240
                        M GSVFGPSA++FGL KEQ++ID WK+KA+ Q E+MSA+  + S +W
Sbjct: 181 QELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSANW 240

Query: 241 SAQESQPQSDAKAEDTKELQL 261
             +E        A + +EL+L
Sbjct: 241 GTREDNAND---AVEIEELEL 258

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  303 bits (777), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 195/266 (73%), Gaps = 8/266 (3%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NAVNVLERTS+YL++GLL++TPAWY VVA VPP+ +F RE R +NPST K+T + 
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  SEFAEQYSVENRS--YKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRP 118
            EF E     NR   YKTR S  +R+   S+L+ APKL++ ED+LREVFY+QHPWE SRP
Sbjct: 61  KEFDEGI---NRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRP 117

Query: 119 KMLVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLR 178
           KMLVEN    ++DWS + QLGKPLDGESVVQRT+YLL+      ++ AYD+ RFEFYRLR
Sbjct: 118 KMLVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLR 177

Query: 179 IXXXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSE 238
           +              MFGSVF  SAID+G+E+EQ++IDVWKQKAI++TE+++AR  +P+E
Sbjct: 178 MQEEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAE 237

Query: 239 SWS--AQESQP-QSDAKAEDTKELQL 261
           SW    QE +P +SD   ++T+EL L
Sbjct: 238 SWGQEKQEGEPNKSDEDGQETEELHL 263

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  296 bits (758), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/259 (55%), Positives = 191/259 (73%), Gaps = 2/259 (0%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           M+VQ NA+N++ERTS+YLK+GLLK TPAWY+VVA +PP+K+F REPRL+NPSTN++ A L
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
            +  E  + +   YKTR ++ +R+V+ +KL+  PKL+Y ED+LR +F++QHPWELSRPK+
Sbjct: 61  RDNREAVNKKG-FYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIX 180
           LVENS    +DWS IQQLGKPLDGESVVQRT+YLL+T    +++ AY+QARFEFYR RI 
Sbjct: 120 LVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTD-KMDMITAYNQARFEFYRFRIQ 178

Query: 181 XXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240
                        MFGSVF  S IDFG+EKEQK+I  WK+KA  +TE+++AR  NPS+SW
Sbjct: 179 QEVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSW 238

Query: 241 SAQESQPQSDAKAEDTKEL 259
            + E+    +   E   EL
Sbjct: 239 ISAEAGATEENLDEQGSEL 257

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  294 bits (752), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 137/250 (54%), Positives = 180/250 (72%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+QQNAVNVLERTS+YL+AG++KK P WYDVVA  PPSK+F REP+ +NPSTNK T + 
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
               +  +     YKTRA+  +++ + S L+  PKL Y EDKLR++FYEQHPWEL+RPK+
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIX 180
           ++EN G   YDWS + QLGKPLDGESVVQRTL+LL+TK H++L+ AY+QARFEFYRLR+ 
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240
                        MFG+VFG + I+FG+EKEQ++ID WK +AI +TE+  A+    S SW
Sbjct: 181 EEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240

Query: 241 SAQESQPQSD 250
                + + D
Sbjct: 241 KTDSLEGKED 250

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  291 bits (745), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 136/258 (52%), Positives = 191/258 (74%), Gaps = 9/258 (3%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NAVNVL+RTS+YLK+GLLK+TPAWY+VVA +PPS +F REPR  NPS      +L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  SEFAE-QYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPK 119
            +  + Q++ +N  YKTR + ++++VS  KL+  PKL Y ED+LR +FY+QHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 120 MLVENS-GTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLR 178
           +LVEN  G  DYDW  + QLGKPLDGESVVQRT++LL+TK +++++ AYD AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 179 IXXXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSE 238
           +              MFGS+FG SAI+ G++KEQ+++DVW++K I++TE+M+A++ NP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240

Query: 239 SW-------SAQESQPQS 249
           SW       +AQ+ +P +
Sbjct: 241 SWKDDTTLDTAQDEEPTT 258

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  288 bits (737), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 180/242 (74%), Gaps = 2/242 (0%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NAVNVL+RTS+YLK+GLLK+TPAWY+VVA +PPS +F REPR  NPS      KL
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  SEFAEQYSVENRS-YKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPK 119
            +  EQ    N+  YKTR + S+++V   +L+  PKL Y ED+LR +FY+QHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 120 MLVENS-GTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLR 178
           +LVEN  G  +YDWS + Q+G+PLDGESV+QRT+YL++TK + +++ AYD AR+EFY LR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 179 IXXXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSE 238
           +              MFGS+FG SAI+ G++KEQ+++DVW++K +++TE+M+AR  NP+ 
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 239 SW 240
           SW
Sbjct: 241 SW 242

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  288 bits (736), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 179/242 (73%), Gaps = 2/242 (0%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NAVNVL+RTS+YLK+GLLK TPAWY+VVA +PPS +F REP   NPS      +L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  SEFAE-QYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPK 119
            +  E Q++  N  YKTR + +++++   KL+  PKL Y ED+LR +FY+QHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 120 MLVENS-GTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLR 178
           +LVEN  G  DYDWS + QLGKPLDGESV+QRT+YLL+TK ++  + AYD AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 179 IXXXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSE 238
           +              MFGS+FG SAI+ G++KEQ+++++W++K I++TE+M+AR+ NP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPAG 240

Query: 239 SW 240
           SW
Sbjct: 241 SW 242

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  286 bits (732), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 130/246 (52%), Positives = 181/246 (73%), Gaps = 2/246 (0%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NA N+LERTS+YL+AGLL+  PA+YDV+A VPPS +F REP+LVNPST ++  + 
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
            E  ++ +     YKTR + S+R  S S+L+ A +LKY ED LR++FY+QHPWELSRPK+
Sbjct: 61  RELTDKVNWRG-LYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119

Query: 121 LVENS-GTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRI 179
           ++EN+      DWS IQQLGKP+DGESVVQRTL+L++ K H  L   YDQARFEFY++R+
Sbjct: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179

Query: 180 XXXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSES 239
                         MFGS+FGP+A+++G+++EQ +I  WKQ+AI +TE++ A+  NPS+S
Sbjct: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDS 239

Query: 240 WSAQES 245
           W+ +ES
Sbjct: 240 WAQEES 245

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  284 bits (726), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 144/262 (54%), Positives = 193/262 (73%), Gaps = 2/262 (0%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MKVQQ AVNVLERTS+YLK+G+LKKTPAWY+V+A VPP+K+F R P+L +P   K    L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
            +++   +  +  YKTR +  E++   SKL+ +PKL Y EDKLR++F++QHPWELSRPK+
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 121 LVENS-GTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRI 179
           LVEN+  T +YDWS IQQLGKPLDGESVVQRTL+LL++   +EL+ AYDQARFEFYRLRI
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 180 XXXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSES 239
                         MFGSVF  ++I++G+ KEQK+ID WK+KA+ Q E+M+AR  +PS S
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240

Query: 240 WSAQESQPQSDAKAEDTKELQL 261
           W+  E++ +     +D +E+QL
Sbjct: 241 WT-NETEEEQKPIDQDVEEIQL 261

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  283 bits (725), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 135/256 (52%), Positives = 187/256 (73%), Gaps = 9/256 (3%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NAVNVL+RTS+YLK+GLLK TPAWY+VVA +PPS +F REPR  NPS  +   KL
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  SEFAE-QYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPK 119
            +  E Q +  N  YKTR + ++R+V   KL+  PKL Y ED+LR +FY+QHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 120 MLVENS-GTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLR 178
           +LVEN  G  +YDWS + QLGK LDGESV+QRT++LL+T+ +++++ AYD AR+EFY LR
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 179 IXXXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSE 238
           +              MFGS+FG S+I+ G++KEQ+++DVW++K I++TE+M+AR+ NP+ 
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPAG 240

Query: 239 SW-------SAQESQP 247
           SW       +AQ+ +P
Sbjct: 241 SWKDDATLDTAQDEEP 256

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  275 bits (703), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 179/247 (72%), Gaps = 3/247 (1%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NAVN++ERTS+YL +GLL+ TPAWYDVVA +PP+K+F REP++ NP+T +     
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  SEFAEQYSVENRS-YKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPK 119
            +  ++  V N+  YKTR ++ +R+ S + L+  PKL Y ED+LR +F+EQHPWELSRPK
Sbjct: 61  KD--DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118

Query: 120 MLVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRI 179
           +L+ENS   ++DWS IQQ  K LDGESVVQRTLYLL+ +    +L AY++ARFEFYRLRI
Sbjct: 119 ILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRI 178

Query: 180 XXXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSES 239
                         MFGS+F  ++ + G+EKEQK+I+ WK+KAI +T++M  R+ NPS+S
Sbjct: 179 QQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDS 238

Query: 240 WSAQESQ 246
           W+A E Q
Sbjct: 239 WAAPEEQ 245

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  274 bits (700), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 179/250 (71%), Gaps = 6/250 (2%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+QQNAVNVLERTSSYL++GLL K PAWY+VVA +PPSK+F R P+  NPS NK+  +L
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  SEFAEQYSVENRS----YKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELS 116
               E+  V +R+    +K+R ++ +++ S   ++   KL Y ED+LREVFY QHPWELS
Sbjct: 61  RIIDERL-VSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELS 119

Query: 117 RPKMLVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYR 176
           RPK++VEN+G   YDWS IQQLGK LDGE+VVQR +YL++ K          +AR+EFYR
Sbjct: 120 RPKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYR 179

Query: 177 LRIXXXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINP 236
           +R+              MFGSVFGPS I+FG+++EQK+IDVWK+KAI +TE+M A+  NP
Sbjct: 180 VRMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239

Query: 237 SESWSAQESQ 246
           SE+W AQE +
Sbjct: 240 SETW-AQEKE 248

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  267 bits (682), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 169/241 (70%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NAVN+LERTS++L++G+++K PAWY+VVA  PP K+F R+P  VNPST K    L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
             F +     +  YKTR S +++QVS + L+  PKL Y ED+LR++FY+QHPWE SRP +
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIX 180
           L+EN+ T  +DWS IQQLGK LDGESVVQR L+LL       L  AYD+ARFEFYR+R+ 
Sbjct: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240
                        M+GSV+  SAI+FGLEKE K+I+ WK++ I +TE M AR  +PSESW
Sbjct: 181 QELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSESW 240

Query: 241 S 241
           +
Sbjct: 241 N 241

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  261 bits (667), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 127/255 (49%), Positives = 177/255 (69%), Gaps = 1/255 (0%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NAVNVLERTS+YL+ G++K+TPAWY+VVA +PP  +F REP  +NPST+K+ ++L
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
            +   +    N  YKTR +  ER+V+  +++  PKL Y EDK+R +FY+QHPWEL+RPK+
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIX 180
           + EN    + DW  + QLG+PLDGE+VVQRTLYLL+TK    +  AYDQAR EFYRLR+ 
Sbjct: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240
                        MFGSVFGPS I+ G+ KEQ++I+ WK+ A  Q+E++SA+  N S++ 
Sbjct: 181 QELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKA- 239

Query: 241 SAQESQPQSDAKAED 255
           +   S   S+ + ED
Sbjct: 240 AGDASAVSSEKQVED 254

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  233 bits (594), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 139/179 (77%), Gaps = 2/179 (1%)

Query: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60
           MK+Q NAVNVL+RTS YL+AGLLKKTPAWY+VVA +PP  +F REP+L +P + K   +L
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120
               ++ +    +YKTRA  S+RQ +   +    KL++ EDKLR +F++QHPWELSRPK+
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRI 179
           LVEN G   YDWS + QLGKPLDGESVVQRTLYLL++ AH+E+LAAYDQARFEFYRLR+
Sbjct: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177

>KLTH0C01166g Chr3 (107662..108555) [894 bp, 297 aa] {ON} weakly
          similar to uniprot|Q08909 Saccharomyces cerevisiae
          YOR385W Hypothetical ORF
          Length = 297

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%)

Query: 34 AFVPPSKRFVREPRLVNPSTNKETAKLSEFAEQYSVENRSYKTRASRSERQVSG 87
          A VPPS RF RE  +V  S   +T  L  F  Q+S E     +R  R+E    G
Sbjct: 14 ADVPPSLRFCRERHMVLASVFYKTRSLMCFPTQHSFEKFLSNSRKIRAEDDGMG 67

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,754,487
Number of extensions: 932740
Number of successful extensions: 2587
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2596
Number of HSP's successfully gapped: 25
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)