Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G10428g2.289ON25125113200.0
Kwal_27.115132.289ON2512519841e-135
NDAI0G006802.289ON2552537741e-103
CAGL0M06897g2.289ON2482437427e-99
NCAS0G03850singletonON2512467402e-98
NCAS0G037702.289ON2512467402e-98
Suva_14.3232.289ON2532427392e-98
SAKL0E07612g2.289ON2522507383e-98
YNL024C2.289ON2462427211e-95
Skud_14.3052.289ON2492427211e-95
KNAG0H019802.289ON2492457183e-95
Smik_14.3072.289ON2462427114e-94
ADL212W2.289ON2512436932e-91
KLLA0E08295g2.289ON2662446656e-87
Ecym_33282.289ON2542446584e-86
KAFR0H032902.289ON2452486523e-85
Suva_12.2204.352ON3371741527e-11
Skud_10.3524.352ON3361991511e-10
Smik_10.4224.352ON3401971482e-10
YBR271W (EFM2)1.325ON4191461431e-09
Smik_2.4141.325ON417931431e-09
Skud_2.4031.325ON417931422e-09
NCAS0J021504.352ON3221751402e-09
SAKL0D06798g1.325ON4211991393e-09
Suva_4.5321.325ON416931377e-09
Kwal_47.166354.352ON3222061351e-08
NCAS0B074101.325ON4141121332e-08
KNAG0C018001.325ON421961315e-08
KLTH0H10560g1.325ON4171541305e-08
SAKL0G18106g4.352ON3351381271e-07
TPHA0L003404.352ON3411351261e-07
KAFR0C042501.325ON3911311271e-07
KAFR0E042804.352ON3151931243e-07
CAGL0I09438g1.325ON4061371243e-07
NDAI0J028604.352ON3471451208e-07
TDEL0D019401.325ON4052041201e-06
KLLA0E21539g1.325ON400891191e-06
TPHA0I026501.325ON4211351191e-06
NDAI0B047301.325ON4321291182e-06
YJR129C4.352ON3391801172e-06
Kpol_1066.171.325ON435951163e-06
TDEL0D006404.352ON3271021137e-06
KLTH0D17996g4.352ON3171711128e-06
ZYRO0G20548g1.325ON397891102e-05
KNAG0B067204.352ON2831851074e-05
KLLA0B04444g4.352ON3081541074e-05
Kpol_1028.814.352ON3361081041e-04
Ecym_55131.325ON396871041e-04
AER240W1.325ON3901011031e-04
CAGL0M00572g4.352ON3271791022e-04
Kwal_14.25501.325ON418971003e-04
AER161C4.352ON31698950.001
TBLA0D052001.325ON399102950.002
Ecym_11274.352ON320139920.003
ZYRO0B14916g4.352ON298139860.018
ZYRO0D14542g6.79ON263236850.019
CAGL0M09801g6.79ON256218810.073
TBLA0B061504.352ON31694790.12
TDEL0F046308.339ON322108750.46
CAGL0E00231gsingletonOFF186487731.1
KLLA0B07117g3.233ON34868711.5
TPHA0F004004.50ON191747693.4
Kpol_505.363.476ON39643683.6
SAKL0D04466g3.233ON34854674.8
Kpol_414.34.50ON190926675.2
TPHA0B007504.255ON36647665.6
Smik_7.3171.371ON46098666.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G10428g
         (251 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   513   0.0  
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   383   e-135
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   302   e-103
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   290   7e-99
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               289   2e-98
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   289   2e-98
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   289   2e-98
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   288   3e-98
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   282   1e-95
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   282   1e-95
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   281   3e-95
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   278   4e-94
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   271   2e-91
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   260   6e-87
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   258   4e-86
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   255   3e-85
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    63   7e-11
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    63   1e-10
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    62   2e-10
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    60   1e-09
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    60   1e-09
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    59   2e-09
NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {O...    59   2e-09
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    58   3e-09
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    57   7e-09
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    57   1e-08
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    56   2e-08
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    55   5e-08
KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {...    55   5e-08
SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]...    54   1e-07
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    53   1e-07
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    54   1e-07
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    52   3e-07
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    52   3e-07
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    51   8e-07
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    51   1e-06
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    50   1e-06
TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {O...    50   1e-06
NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa] ...    50   2e-06
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    50   2e-06
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    49   3e-06
TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.35...    48   7e-06
KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} simil...    48   8e-06
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    47   2e-05
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    46   4e-05
KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar...    46   4e-05
Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON} (1820...    45   1e-04
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    45   1e-04
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    44   1e-04
CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar ...    44   2e-04
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    43   3e-04
AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON} Sy...    41   0.001
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    41   0.002
Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to...    40   0.003
ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa] ...    38   0.018
ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} simil...    37   0.019
CAGL0M09801g Chr13 complement(970260..971030) [771 bp, 256 aa] {...    36   0.073
TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4....    35   0.12 
TDEL0F04630 Chr6 (869804..870772) [969 bp, 322 aa] {ON} Anc_8.33...    33   0.46 
CAGL0E00231g Chr5 complement(15452..21046) [5595 bp, 1864 aa] {O...    33   1.1  
KLLA0B07117g Chr2 (618368..619414) [1047 bp, 348 aa] {ON} highly...    32   1.5  
TPHA0F00400 Chr6 (91892..97645) [5754 bp, 1917 aa] {ON} Anc_4.50...    31   3.4  
Kpol_505.36 s505 (83512..84702) [1191 bp, 396 aa] {ON} (83512..8...    31   3.6  
SAKL0D04466g Chr4 (357282..358328) [1047 bp, 348 aa] {ON} highly...    30   4.8  
Kpol_414.3 s414 (8196..13925) [5730 bp, 1909 aa] {ON} (8196..139...    30   5.2  
TPHA0B00750 Chr2 complement(170775..171875) [1101 bp, 366 aa] {O...    30   5.6  
Smik_7.317 Chr7 (529500..530882) [1383 bp, 460 aa] {ON} YFR012W ...    30   6.4  

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  513 bits (1320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%)

Query: 1   MAELLDFTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELL 60
           MAELLDFTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELL
Sbjct: 1   MAELLDFTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELL 60

Query: 61  CEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNAKVHIT 120
           CEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNAKVHIT
Sbjct: 61  CEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNAKVHIT 120

Query: 121 DIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETA 180
           DIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETA
Sbjct: 121 DIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETA 180

Query: 181 FPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQR 240
           FPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQR
Sbjct: 181 FPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQR 240

Query: 241 THLFQLIRVQK 251
           THLFQLIRVQK
Sbjct: 241 THLFQLIRVQK 251

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  383 bits (984), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 215/251 (85%)

Query: 1   MAELLDFTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELL 60
           M ELLDFT QF DLVPSRP+EH GDSDL+FGG++ PALKIHEDGGE+GCGGKLW+AGELL
Sbjct: 1   MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELL 60

Query: 61  CEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNAKVHIT 120
           C+YLLENSD  GILSK+M  +    PF+NILELGSGTGLVGLCAGS+A+ +G   KV+IT
Sbjct: 61  CDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTKVYIT 120

Query: 121 DIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETA 180
           DID+LV LME NV LN LA  VS E L WGEPLK +FGPDA ++K DLVLAADCVYLETA
Sbjct: 121 DIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETA 180

Query: 181 FPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQR 240
           FPLLEKTLLDLT+G+TPP VLMSYRKRRKAD+ FF+ IRKNFK+VPIT+F R D +LK++
Sbjct: 181 FPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQ 240

Query: 241 THLFQLIRVQK 251
           THLFQL+R+ K
Sbjct: 241 THLFQLVRIPK 251

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  302 bits (774), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 152/253 (60%), Positives = 188/253 (74%), Gaps = 14/253 (5%)

Query: 7   FTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLE 66
           F + F DLV +RPLEH G+SDL+FGGR+   LKIHEDGGESGCGGK+WIAGELLCE++LE
Sbjct: 5   FGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCEFILE 64

Query: 67  NSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARAN-GGNAKVHITDIDQL 125
            S+ + +L+         K F  I+ELGSGTGLVGLC G L + N   +   +ITDIDQ+
Sbjct: 65  KSNSDDLLN---GWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQI 121

Query: 126 VRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAIS----------NKTDLVLAADCV 175
           V LM+ N++LNG+ + VSAE+LWWGEPL+  F P   S           K DL+LAADCV
Sbjct: 122 VPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAADCV 181

Query: 176 YLETAFPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDD 235
           YLE AFPLLEKTLLDLT+GETPP +LM+YRKRRKAD+ FF+ I+KNF +V I  F++ + 
Sbjct: 182 YLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYEY 241

Query: 236 FLKQRTHLFQLIR 248
           +LKQRTHLFQLIR
Sbjct: 242 YLKQRTHLFQLIR 254

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  290 bits (742), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 176/243 (72%), Gaps = 7/243 (2%)

Query: 11  FTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENSDD 70
           F DL+ SRP+EH G SDLTF G + P LKI+EDGGESGCGGK+WIAGELLCE++LE S D
Sbjct: 7   FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSRD 66

Query: 71  NGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGN-AKVHITDIDQLVRLM 129
             +L   +N       F N+LELGSGTGLVGLC G + +       K +ITDIDQLV LM
Sbjct: 67  GELLKDWIN--DDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQLVPLM 124

Query: 130 EGNVELNGLASVVSAEKLWWGEPLKYEFGP----DAISNKTDLVLAADCVYLETAFPLLE 185
           E NVELN +   V A++L WGE L  EF P     A ++  DLVLAADCVYLE AFPLLE
Sbjct: 125 EKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLE 184

Query: 186 KTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQ 245
           KTLLDLT+ + PPV+LM+YRKRRKAD+ FF+ IRKNF V+ I  F   D +LKQRTHLFQ
Sbjct: 185 KTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQ 244

Query: 246 LIR 248
           L+R
Sbjct: 245 LVR 247

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  289 bits (740), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 180/246 (73%), Gaps = 8/246 (3%)

Query: 9   AQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENS 68
             F  LV  RP+EH G+SDL+FGG++   LKIHEDGGESGCGGK+WIAGELLC+++LE S
Sbjct: 6   GDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKS 65

Query: 69  DDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARAN-GGNAKVHITDIDQLVR 127
               +L+K  +    ++ F N+LELGSGTGLVGLC G L +     N  VHITDIDQLV 
Sbjct: 66  GTEDLLNKWPH--DGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQLVP 123

Query: 128 LMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAI-----SNKTDLVLAADCVYLETAFP 182
           LM+ N+ELNG++  V AE LWWGEPL   F P  +     +N  DL+LAADCVYLE AFP
Sbjct: 124 LMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFP 183

Query: 183 LLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTH 242
           LLE+TLLDLT+ ETPPV+LMSYRKRRKAD+ FF  I+KNF V+ +  F + + +LK RTH
Sbjct: 184 LLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTH 243

Query: 243 LFQLIR 248
           LFQL R
Sbjct: 244 LFQLAR 249

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  289 bits (740), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 180/246 (73%), Gaps = 8/246 (3%)

Query: 9   AQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENS 68
             F  LV  RP+EH G+SDL+FGG++   LKIHEDGGESGCGGK+WIAGELLC+++LE S
Sbjct: 6   GDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKS 65

Query: 69  DDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARAN-GGNAKVHITDIDQLVR 127
               +L+K  +    ++ F N+LELGSGTGLVGLC G L +     N  VHITDIDQLV 
Sbjct: 66  GTEDLLNKWPH--DGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQLVP 123

Query: 128 LMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAI-----SNKTDLVLAADCVYLETAFP 182
           LM+ N+ELNG++  V AE LWWGEPL   F P  +     +N  DL+LAADCVYLE AFP
Sbjct: 124 LMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFP 183

Query: 183 LLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTH 242
           LLE+TLLDLT+ ETPPV+LMSYRKRRKAD+ FF  I+KNF V+ +  F + + +LK RTH
Sbjct: 184 LLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTH 243

Query: 243 LFQLIR 248
           LFQL R
Sbjct: 244 LFQLAR 249

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  289 bits (739), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 148/242 (61%), Positives = 183/242 (75%), Gaps = 8/242 (3%)

Query: 11  FTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENSDD 70
           F DLV  R  EHFG +DL+FGG++ PALKI EDGGESGCGGK+WIAGELLCEY+LE SDD
Sbjct: 8   FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSDD 67

Query: 71  NGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARAN-GGNAKVHITDIDQLVRLM 129
           + +LS+ ++     +PF+ +LELGSGTGLVGLC G L +     N KV++TDID+LV LM
Sbjct: 68  H-LLSETVH---EKRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDRLVPLM 123

Query: 130 EGNVELNGLASVVSAEKLWWGEPLKYEFGP---DAISNKTDLVLAADCVYLETAFPLLEK 186
           E N+EL+ +   V A +LWWGEPL  +F P   D   N  DLVLAADCVYLE AFPLLEK
Sbjct: 124 ERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEK 183

Query: 187 TLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQL 246
           TLLDLT   +PPV+LM+Y+KRRKAD+ FF  I++NF V+ I  F + D +LKQ+THLFQL
Sbjct: 184 TLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQL 243

Query: 247 IR 248
           +R
Sbjct: 244 VR 245

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  288 bits (738), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 187/250 (74%), Gaps = 3/250 (1%)

Query: 1   MAELLDFTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELL 60
           M ++L FTA F DLVPSRP EH GDSDL+FGG++ P LKIHEDGGESGCGGK+WIAGELL
Sbjct: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60

Query: 61  CEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANG-GNAKVHI 119
           CE+LLE SD  G+ S+  +      P   I+ELGSGTGLVGLC G L + N   +  +++
Sbjct: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYV 120

Query: 120 TDIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNK-TDLVLAADCVYLE 178
           TDIDQLV LM+ N++LN L  V   E LWWGEPLK EF P   + +  DL+LAADCVYLE
Sbjct: 121 TDIDQLVTLMDRNIKLNELEHVFPKE-LWWGEPLKPEFAPTRSNQRQVDLILAADCVYLE 179

Query: 179 TAFPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLK 238
            AFPLLE TLLDLT  + PP++LMSY+KRRKAD+ FFK I+KNF V+ I  F R D +LK
Sbjct: 180 KAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLK 239

Query: 239 QRTHLFQLIR 248
           Q+THLFQL+R
Sbjct: 240 QKTHLFQLVR 249

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  282 bits (721), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 145/242 (59%), Positives = 180/242 (74%), Gaps = 8/242 (3%)

Query: 11  FTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENSDD 70
           F DLV  RP EH G +DL+FGG++ PALKI EDGGESGCGGK+WIAGELLCEY+LE S D
Sbjct: 8   FGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVD 67

Query: 71  NGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGN-AKVHITDIDQLVRLM 129
           + +LSK +N     K F  +LELGSGTGLVGLC G L +    +  KV++TDID+L+ L+
Sbjct: 68  H-LLSKTVN---GTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDKLIPLL 123

Query: 130 EGNVELNGLASVVSAEKLWWGEPLKYEFGPD---AISNKTDLVLAADCVYLETAFPLLEK 186
           + N+EL+ +   V A +LWWGEPL  +F P      +N  DLVLAADCVYLE AFPLLEK
Sbjct: 124 KRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLEK 183

Query: 187 TLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQL 246
           TLLDLT    PPV+LM+Y+KRRKAD+ FF  I++NF V+ IT F + + +LK+RTHLFQL
Sbjct: 184 TLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQL 243

Query: 247 IR 248
           IR
Sbjct: 244 IR 245

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  282 bits (721), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 182/242 (75%), Gaps = 8/242 (3%)

Query: 11  FTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENSDD 70
           F DLV  R  EH G +DL+FGG++ PALKI EDGGESGCGGK+WIAGELLCEY+LE S  
Sbjct: 8   FEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSLH 67

Query: 71  NGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGN-AKVHITDIDQLVRLM 129
           + +LS+  +  GR + F  +LELGSGTGLVGLC G L +    + +KV++TDID+LV L+
Sbjct: 68  H-LLSEATH--GR-RQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKLVPLL 123

Query: 130 EGNVELNGLASVVSAEKLWWGEPLKYEFGP---DAISNKTDLVLAADCVYLETAFPLLEK 186
           E N+EL+ +   V A +LWWGEPL  +F P   D  +N  DLVLAADCVYLE AFPLLE+
Sbjct: 124 ERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLER 183

Query: 187 TLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQL 246
           TLLDLT   +PPV+LM+Y+KRRKAD+ FF  I++NF V+ IT F + D +LKQRTHLFQL
Sbjct: 184 TLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQL 243

Query: 247 IR 248
           IR
Sbjct: 244 IR 245

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  281 bits (718), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 144/245 (58%), Positives = 179/245 (73%), Gaps = 7/245 (2%)

Query: 9   AQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENS 68
             F DLV +RP+EH G  D++FGGR+ PAL+IHEDGGESGCGGK+W+AGELLC+Y++E S
Sbjct: 6   GSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDYIVEKS 65

Query: 69  DDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNA-KVHITDIDQLVR 127
           D++ +L+       + + F NI+ELGSGTGLVGLC   L +       KV ITDIDQLV 
Sbjct: 66  DEDDLLANWDT--SKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVP 123

Query: 128 LMEGNVELNGLASVVSAEKLWWGEPLKYEFGP--DAISNKT--DLVLAADCVYLETAFPL 183
           LM+ N+ELN + + + AE+LWWGEPL   F P  + +S  T  DL+LAADCVYLE AFPL
Sbjct: 124 LMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPL 183

Query: 184 LEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHL 243
           LEKTLLDLT    PPV+LM+YRKRR AD+ FF+ I K+F V  IT F   D +LKQRTHL
Sbjct: 184 LEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHL 243

Query: 244 FQLIR 248
           F+LIR
Sbjct: 244 FELIR 248

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  278 bits (711), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 182/242 (75%), Gaps = 8/242 (3%)

Query: 11  FTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENSDD 70
           F DLV  RP EH G +DL+F G++ PALKI EDGGESGCGGK+WIAGELLCEY+LE S D
Sbjct: 8   FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVD 67

Query: 71  NGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLAR-ANGGNAKVHITDIDQLVRLM 129
           + +LSK ++  G+ K F  +LELGSGTGLVGLC G L +       KV++TDID+LV L+
Sbjct: 68  H-LLSKTVD--GK-KRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLVPLL 123

Query: 130 EGNVELNGLASVVSAEKLWWGEPLKYEFGP---DAISNKTDLVLAADCVYLETAFPLLEK 186
           + N+EL+ +   V A +L WGEPL  +F P   D  +N  DLVLAADCVYLE AFPLLEK
Sbjct: 124 KRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEK 183

Query: 187 TLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQL 246
           TLLDLT   +PPV+LM+Y+KRRKAD+ FF  I++NF V+ I++F + D +LKQRTHLFQL
Sbjct: 184 TLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQL 243

Query: 247 IR 248
           IR
Sbjct: 244 IR 245

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  271 bits (693), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 145/243 (59%), Positives = 177/243 (72%), Gaps = 8/243 (3%)

Query: 7   FTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLE 66
           FTA F DLV  RP+EH G SDL++ G++ P LKIHEDGGESGCGGK+WIAG LLCE++LE
Sbjct: 5   FTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILE 64

Query: 67  NSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGG-NAKVHITDIDQL 125
            S D  +LS+     G ++ F NI+ELGSGTGLVGLC G   + NG  +  V+ITDI+ L
Sbjct: 65  KSKDGRVLSQ---FPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGL 121

Query: 126 VRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETAFPLLE 185
             LM+ NVELNGL  +V    L+WGEPL  EF    I    DLVLAADCVYLE AFPLLE
Sbjct: 122 CPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPI----DLVLAADCVYLEKAFPLLE 177

Query: 186 KTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQ 245
           KTLLDLT GE+ P+VLMSY+KRRKAD+ FF  I+K F ++ I  F   +D+ +QRT+LFQ
Sbjct: 178 KTLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLFQ 237

Query: 246 LIR 248
           L+R
Sbjct: 238 LVR 240

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  260 bits (665), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 180/244 (73%), Gaps = 11/244 (4%)

Query: 7   FTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLE 66
           F++ F +LVP+RP+EH G  D++F G++   L I+EDGGESGCGGK+WIAGELLCEY+LE
Sbjct: 30  FSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILE 89

Query: 67  NSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANG-GNAKVHITDIDQL 125
            SD   +LS     L  D    ++LELGSGTGLVGLC G + +AN   + +V+I+DIDQL
Sbjct: 90  KSDKEHLLSH----LFPDGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQL 145

Query: 126 VRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNK-TDLVLAADCVYLETAFPLL 184
           + LME N+++NGL   V AE LWWG PL     PD    K  DLVLAADCVYLE AFPLL
Sbjct: 146 LGLMESNIQVNGLDDKVHAEVLWWGNPL-----PDVFVKKPVDLVLAADCVYLEAAFPLL 200

Query: 185 EKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLF 244
           EKTLL+LT GE  P++LM+Y+KRRKAD+ FF+ I+KNFK+V I  F   D +LKQRTHLF
Sbjct: 201 EKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLF 260

Query: 245 QLIR 248
           QL+R
Sbjct: 261 QLMR 264

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  258 bits (658), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 169/244 (69%), Gaps = 7/244 (2%)

Query: 7   FTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLE 66
           F + F +LVP+ P+EH G SDL+F GR+ P LKI+EDGGESGCGGK+WIAGELLC++LLE
Sbjct: 5   FASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCDFLLE 64

Query: 67  NSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGN-AKVHITDIDQL 125
            S D  +LSK    +   K F  +LELGSGTGLVGLC G     +  N   V+ITDID L
Sbjct: 65  KSKDGQLLSK---FVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDTL 121

Query: 126 VRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETAFPLLE 185
             LM  NV +N L   V   +L+WG+ L  EF      +  DL+LAADCVYLE AFPLLE
Sbjct: 122 CPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNK--DSPVDLILAADCVYLEKAFPLLE 179

Query: 186 KTLLDLTKG-ETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLF 244
             LL+LT   E  PVVLMSYRKRRKAD+ FF  I+K+F +  +T F R D+++KQRTH+F
Sbjct: 180 MKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIKQRTHIF 239

Query: 245 QLIR 248
           QL+R
Sbjct: 240 QLVR 243

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  255 bits (652), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 168/248 (67%), Gaps = 17/248 (6%)

Query: 9   AQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENS 68
            ++  L+ +RP+EH G +DL+F G++ PA+KI+EDGG SGCGGK+WIAGELLCEYL+E S
Sbjct: 6   GEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEYLIEKS 65

Query: 69  DDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARAN-GGNAKVHITDIDQLVR 127
           D   +L         D    NILELGSGTGLVG+C G + +     + KV ITDI  LV 
Sbjct: 66  DSENLLC--------DGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVP 117

Query: 128 LMEGNVELNGLASVVSAEKLWWGEPLKYEF-------GPDAISNKTDLVLAADCVYLETA 180
           LME N+ LN +A    A++L WG+ L  E+         D +SN  DLV+AADCVY E A
Sbjct: 118 LMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSN-VDLVVAADCVYAEKA 176

Query: 181 FPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQR 240
           FPLLEK LLDLT  + PP++LM+YRKRRKAD+ FF  IRKNF V+ I  F   + ++KQR
Sbjct: 177 FPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQR 236

Query: 241 THLFQLIR 248
           THLF+L R
Sbjct: 237 THLFELKR 244

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 63.2 bits (152), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 82/174 (47%), Gaps = 20/174 (11%)

Query: 82  GRDKPFVNILELGSGTGLVGLCAGSLARANGGNAKVHITDID------QLVRLMEGNVEL 135
           G DK  +N+LE+G+GTG+V L    L +     +K+++TD D      QL R  E N   
Sbjct: 160 GDDKKKLNVLEIGAGTGIVSLVL--LHKYREYVSKMYVTDGDSDLVETQLRRNFELNDAW 217

Query: 136 NGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETAFPLLEKTLLDLTKGE 195
              +  +  ++LWW        G D + ++ +LV+AAD  Y  T FP L + L +     
Sbjct: 218 REQSPDIRLQRLWW--------GSDRVPDEVNLVVAADVTYDSTIFPELCQCLAECLAMS 269

Query: 196 TPPVVLMSYRKRR-KADRIFFKAIRK---NFKVVPITSFDRCDDFLKQRTHLFQ 245
              V L+S   R    D+ F +   K    + VV  T +DR  +   + + LF+
Sbjct: 270 HCKVCLLSATIRSYSTDKEFAQECHKVGLKYSVVTSTEYDRNSEARMEESLLFK 323

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 92/199 (46%), Gaps = 25/199 (12%)

Query: 44  GGESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLC 103
              S  G + W A   + ++L+     N  L +   +   D+  +N+LE+G+GTG+V L 
Sbjct: 127 SAASTTGFRTWEAALYMGDFLI-----NKPLQQLALMQKEDRKKLNVLEIGAGTGIVSLV 181

Query: 104 AGSLARANGGNAKVHITDIDQ--LVRLMEGNVELNGLASV----VSAEKLWWGEPLKYEF 157
              L +      ++++TD D   + R ++ N ELN         V  ++LWWG       
Sbjct: 182 L--LEKYREFVNRMYVTDGDSNLVERQLKRNFELNDALCENGPDVKLQRLWWG------- 232

Query: 158 GPDAISNKTDLVLAADCVYLETAFPLLEKTLLDLTKGETPPVVLMSYRKRRKA-DRIFFK 216
             D I +  DLV+AAD  Y  T FP L + L +        + L+S   R ++ D++F +
Sbjct: 233 -SDRIPDDIDLVVAADVTYDSTIFPELCQCLAECLAISRCKMCLLSATIRSESTDKLFAQ 291

Query: 217 AIRK---NFKVVPITSFDR 232
              K   N+ VV  T  D+
Sbjct: 292 ECNKIGLNYTVVSSTEHDK 310

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 86/197 (43%), Gaps = 18/197 (9%)

Query: 44  GGESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLC 103
              S  G + W A   + ++L+        L+++      DK  +N+LE+G+GTG+V L 
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQELALTQEEQ--EEDKKKLNVLEIGAGTGIVSLV 184

Query: 104 AGSLARANGGNAKVHITDIDQLVRLMEGNVELNGLASV----VSAEKLWWGEPLKYEFGP 159
                R       V   D D + R ++ N ELN   S     +  ++LWW        G 
Sbjct: 185 LSQNYRNFVNKMYVTDGDSDLVERQLKKNFELNDALSEHKPDIRFQRLWW--------GS 236

Query: 160 DAISNKTDLVLAADCVYLETAFPLLEKTLLDLTKGETPPVVLMSYRKRRKA-DRIFFKAI 218
           D + +  DLV+ AD  Y  T FP L K L +        + L+S   R ++ D++F +  
Sbjct: 237 DKVPDDIDLVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRSESTDKLFAQEC 296

Query: 219 RK---NFKVVPITSFDR 232
            K    + +V  T  D+
Sbjct: 297 SKLGLEYTIVTSTECDK 313

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 78/146 (53%), Gaps = 11/146 (7%)

Query: 37  ALKIHEDG-GESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGR-DKPFVNILELG 94
           ++ +HE        G K W +  +L + ++++ D   + +  +N+L   D   + +LELG
Sbjct: 204 SIPLHEPSLTADNLGWKTWGSSLILSQLVVDHLD--YLHTTNVNMLANSDIKQIKVLELG 261

Query: 95  SGTGLVGLCAGSLARANGG--NAKVHITDIDQLVRLMEGNVELNGLASVVSAEKLWWGEP 152
           +GTGLVGL      +   G  N ++ +TD+ ++V  ++ NV LN L   V AE L W  P
Sbjct: 262 AGTGLVGLSWALKWKELYGTENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTNP 321

Query: 153 LKY--EFGPDAISNKTDLVLAADCVY 176
             +  +FG +   N+ D++L AD +Y
Sbjct: 322 HDFIDKFGHE---NEFDVILIADPIY 344

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 52/93 (55%), Gaps = 7/93 (7%)

Query: 88  VNILELGSGTGLVGLCAGSLARANGG--NAKVHITDIDQLVRLMEGNVELNGLASVVSAE 145
           + +LELGSGTGLVGL   S  +   G  N ++ +TD+  +V  ++ NV LN L   V AE
Sbjct: 253 IKVLELGSGTGLVGLSWASKWKELYGIDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAE 312

Query: 146 KLWWGEPLKY--EFGPDAISNKTDLVLAADCVY 176
            L W  P  +   FG     N+ D++L AD +Y
Sbjct: 313 ILDWTNPQSFIDRFG---YENEFDIILIADPIY 342

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 53/93 (56%), Gaps = 7/93 (7%)

Query: 88  VNILELGSGTGLVGLCAGSLARANGGNAKVHI--TDIDQLVRLMEGNVELNGLASVVSAE 145
           + +LELGSGTGLVGL   S  +   G  K+ I  TD+ ++V  ++ NV LN L   V AE
Sbjct: 253 IKVLELGSGTGLVGLSWASKWKELYGTDKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAE 312

Query: 146 KLWWGEPLKY--EFGPDAISNKTDLVLAADCVY 176
            L W  P  +   FG +   N+ D++L AD +Y
Sbjct: 313 ILDWTNPQDFIDRFGHE---NEFDIILVADPIY 342

>NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {ON}
           Anc_4.352
          Length = 322

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 82/175 (46%), Gaps = 24/175 (13%)

Query: 50  GGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLAR 109
           G + W A   L +YL+++ D          L+  D    NILELG+GTGLV L   S+ +
Sbjct: 123 GFRTWAASVYLSKYLVDHED---------ALINDDD---NILELGAGTGLVSLTIASMDK 170

Query: 110 ANGGN-AKVHITDID-QLVR-LMEGNVELN--GLASVVSAEKLWWGEPLKYEFGPDAISN 164
                  ++++TD D +LV   M+ N ++N   + + +  +KLWW  P         I  
Sbjct: 171 MKDNKLRRMYVTDGDSELVSGQMQDNFQMNEVNVDNHIKLQKLWWNSP------DQPIPE 224

Query: 165 KTDLVLAADCVYLETAFPLLEKTLLD-LTKGETPPVVLMSYRKRRKADRIFFKAI 218
           + ++V+ AD  Y  T F  L   L   L + E    ++ S  +  K D++F   +
Sbjct: 225 RVNVVIGADVTYDSTCFTDLCSCLRQCLLESECYKCLIASTIRNVKTDKLFQSTV 279

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 98/199 (49%), Gaps = 26/199 (13%)

Query: 50  GGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGL---CAGS 106
           G K W A  +L + +      N I +   NLL        +LELGSGTGLVG+   C   
Sbjct: 220 GLKTWGASLILSQKICNRF--NSIFAGTGNLL-------RVLELGSGTGLVGITFSCKYK 270

Query: 107 LARANGGNAKVHITDIDQLVRLMEGNVELNGLAS----VVSAEKLWWGEPLKY--EFGPD 160
            ++   G+ ++++TD+ ++V  ++ NVE+N L S     V A+ L W  P+ +  ++G D
Sbjct: 271 ESKTALGSCEMYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTNPVSFTEKYGDD 330

Query: 161 AISNKTDLVLAADCVYLETAFPLLEKTLLDLTKGETPPVVL-MSYRKRRKADR-IFFKAI 218
               K D++L AD +Y     P+   T++D    E   V L +  R +   +R + +  +
Sbjct: 331 ----KFDVILIADPIY-SPQHPVWVVTMIDKFLSEKGKVYLEVPIRPKYAQERQLLWSLL 385

Query: 219 RKNFKVVPITSFDR-CDDF 236
            +N  VV    +D   DD+
Sbjct: 386 TENALVVVEEVYDNGVDDW 404

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 54/93 (58%), Gaps = 7/93 (7%)

Query: 88  VNILELGSGTGLVGLCAGSLARANGG--NAKVHITDIDQLVRLMEGNVELNGLASVVSAE 145
           + +LELGSGTGLVGL   +  +   G  N ++++TD+ ++V  ++ NV LN L   V AE
Sbjct: 252 IKVLELGSGTGLVGLSWAAKWKELYGIHNIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAE 311

Query: 146 KLWWGEPLKY--EFGPDAISNKTDLVLAADCVY 176
            L W  P  +  +FG +      D++L AD +Y
Sbjct: 312 VLDWTNPQNFINQFGHEM---DFDIILVADPIY 341

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 90/206 (43%), Gaps = 51/206 (24%)

Query: 1   MAELLDFT-AQFTDLVP-SRPLEHFGD-------SDLTFGGRIFPALKIHEDGGESGCGG 51
           + EL D+   Q+  L+P S P   F D       SD+    +  P L           G 
Sbjct: 80  VVELSDWAFEQYVQLLPLSSPSPTFTDIIRYRFSSDVAVDVQEQPYLLC----ASGTTGF 135

Query: 52  KLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARAN 111
           + W A   L EYL++N +             +D+ F  ILELG+GTGLV L    L +A 
Sbjct: 136 RTWEAALYLAEYLVQNQE----------YYAQDR-FSRILELGAGTGLVSLVWSQLFQAT 184

Query: 112 GGNAKVHITD-----IDQLVRLMEGNVELNGLASVVSA--------EKLWWGEPLKYEFG 158
               ++++TD     ++Q +R    N +LN + +  +         ++LWWGE    +  
Sbjct: 185 MK--ELYVTDGDSTLVEQAIRY---NFQLNNVTAAPANTLDCQYKFQRLWWGE----DVV 235

Query: 159 PDAISNKTDLVLAADCVYLETAFPLL 184
           PD      D+VLAAD  Y  +  P L
Sbjct: 236 PD-----VDIVLAADVTYDASVVPSL 256

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 64/112 (57%), Gaps = 10/112 (8%)

Query: 73  ILSKQM-NLLGRDKPFVNI-----LELGSGTGLVGLCAGSLARANGG--NAKVHITDIDQ 124
           ILS+++ NLL ++K   +I     LELGSGTGLVG+   S  R + G  N ++ +TD+  
Sbjct: 230 ILSQKVVNLLEKNKDQKHIHPLRVLELGSGTGLVGIAWASKWRQSFGTENIEMFVTDLPD 289

Query: 125 LVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVY 176
           +V  ++ NV+ N L + V A+ L W  P   +F       K D++L AD +Y
Sbjct: 290 IVANLKKNVQTNDLTTFVEADILDWTNP--DDFIEKHGDEKFDVILVADPIY 339

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 53/96 (55%), Gaps = 7/96 (7%)

Query: 86  PFVNILELGSGTGLVGLCAGSLARANGG----NAKVHITDIDQLVRLMEGNVELNGLASV 141
           P   +LELGSGTGLVG+      R   G    N ++++TD+ ++V  ++ NV+LN L   
Sbjct: 252 PPFRVLELGSGTGLVGISWACKWRELYGIEDSNLQIYLTDLPEIVDNLKKNVQLNKLEHA 311

Query: 142 VSAEKLWWGEPLKYEFGPDAISNKT-DLVLAADCVY 176
           V A+ L W  P  Y F       ++ DL+L AD +Y
Sbjct: 312 VVADVLDWTNP--YNFIERYNGEQSFDLILVADPIY 345

>KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 417

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 76/154 (49%), Gaps = 24/154 (15%)

Query: 32  GRIFPALKIHEDGGES-GCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNI 90
           G +   +K+HE    S   G K W A  +L   L EN        +Q +L         I
Sbjct: 198 GGLRTGVKLHEPALTSDNLGLKTWGASLVLARKLCENFSK---FERQRDL--------RI 246

Query: 91  LELGSGTGLVG--LCAGSLARANGGNAKVHITDIDQLVRLMEGNVELNGLAS----VVSA 144
           LELG+GTGLVG  L    L   +G N  +H+TD+ ++V  ++ NV++N   S     V A
Sbjct: 247 LELGAGTGLVGISLVLKMLESNSGHNCSMHLTDLPEIVTNLKENVKINCCNSRSDLKVYA 306

Query: 145 EKLWWGEPLKYE--FGPDAISNKTDLVLAADCVY 176
           + L W  P  +E  +G    ++K D++L AD VY
Sbjct: 307 DVLDWTNPDSFEKTYG----AHKFDVLLIADPVY 336

>SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]
           {ON} similar to uniprot|P47163 Saccharomyces cerevisiae
           YJR129C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 335

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 68/138 (49%), Gaps = 22/138 (15%)

Query: 50  GGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLAR 109
           G + W A   L ++L +NSD+       M+ LG+D+  + ++ELG+GTG+V +    L  
Sbjct: 142 GFRTWEAALYLSQHLCKNSDE------IMDELGKDQ--ITVVELGAGTGIVSMTWAKL-- 191

Query: 110 ANGGNAKVHITDIDQ--LVRLMEGNVELNGL-ASVVSAEKLWWGEPLKYEFGPDAISNKT 166
            +    K+++TD D   +   M  N +LN +       +KLWW      +  PD      
Sbjct: 192 QHNRLEKLYVTDGDSSLVENQMHRNAQLNNVGGPKYCFQKLWWNS----DDVPD-----N 242

Query: 167 DLVLAADCVYLETAFPLL 184
           DL+LAAD  Y  +  P L
Sbjct: 243 DLILAADVTYDSSVIPDL 260

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 66/135 (48%), Gaps = 21/135 (15%)

Query: 89  NILELGSGTGLVGLCAGSLARANGGNAKVHITDIDQLVRLMEG----NVELNGLASV--V 142
           N LELGSGTG+V +  G + +       ++ITD D   +L+EG    NV LNG+ S   V
Sbjct: 169 NTLELGSGTGMVSI--GLVKKYKDQITTLYITDGDS--QLLEGQLSRNVMLNGIDSSDSV 224

Query: 143 SAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETAFPLLEKTLLDLTKGE---TPPV 199
             +KL W E        D I +  DL++AAD  Y  +  P L   +LD  K     +   
Sbjct: 225 KLQKLRWNE--------DHIPDNLDLIVAADVTYDSSVIPSLCHCILDCFKSSNKCSTVC 276

Query: 200 VLMSYRKRRKADRIF 214
            L + R+ ++   +F
Sbjct: 277 YLAATRRNQETIAVF 291

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 13/131 (9%)

Query: 48  GCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSL 107
             G K W +  +L   L +  D+N +  K  N  G+      ILELGSGTGLVG+   S 
Sbjct: 192 NLGWKTWGSSLILSNILCDRIDENFL--KSFN--GK-----RILELGSGTGLVGISVASK 242

Query: 108 ARANG--GNAKVHITDIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNK 165
               G     ++++TD+ ++V  +E N+ +N LA+ V ++ L W  P    F  +    +
Sbjct: 243 LEEIGVLDEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTNP--ESFVSNYGDTR 300

Query: 166 TDLVLAADCVY 176
            D++L +D +Y
Sbjct: 301 FDVLLISDPIY 311

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 88/193 (45%), Gaps = 33/193 (17%)

Query: 47  SGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGS 106
           S  G + W A   LC+Y+      + + ++ +N          +LELG+GT   GLC+ +
Sbjct: 113 STTGFRTWEAASYLCDYI------SNVDTESLNGCS------TVLELGAGT---GLCSLT 157

Query: 107 LARANGGN--AKVHITDID------QLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFG 158
           L +    +   KV++TD D      QL+   + N   + +   V  ++L WGE       
Sbjct: 158 LLKGKFQDDLKKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGE------- 210

Query: 159 PDAISNKTDLVLAADCVYLETAFPLLEKTLLDLTKGETPPVVLMSYRKRR-KADRIFFKA 217
            D+I N  D V+ AD  Y +T F  L K L    + E+  + L++   R  + DR F + 
Sbjct: 211 -DSIPNDIDCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIASTIRNVETDRKFLEH 269

Query: 218 IR-KNFKVVPITS 229
               +FKV  I S
Sbjct: 270 CHDSDFKVEIIQS 282

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 68/137 (49%), Gaps = 23/137 (16%)

Query: 48  GCGGKLW----IAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLC 103
             G K W    I GE++  YL           + ++        V  LELG+GTGLVG+ 
Sbjct: 209 NLGWKTWGSSLILGEIVVSYL-----------ENLSSTFESNRKVRTLELGAGTGLVGIA 257

Query: 104 AGSLARANGGNAK--VHITDIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKY--EFGP 159
             +  R    N+K  +++TD+ ++V  ++ NV++N L  + +A+ L W  P  +  ++G 
Sbjct: 258 WAAKWRDKFCNSKTEIYLTDLPEIVDNLKDNVKINNLQDIATADVLDWTNPDTFTEKYG- 316

Query: 160 DAISNKTDLVLAADCVY 176
              + + D ++ AD +Y
Sbjct: 317 ---NERFDYIVIADPIY 330

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 64/145 (44%), Gaps = 20/145 (13%)

Query: 44  GGESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLC 103
            G+S  G + W     L ++L+ N +   I               +++ELG+GTGLV LC
Sbjct: 136 SGKSTTGFRTWEGAVYLSKFLINNCEKYLIEK------------TDVIELGAGTGLVSLC 183

Query: 104 AGSLARANG-GNAKVHITDIDQ--LVRLMEGNVELNGLA---SVVSAEKLWWGEPLKYEF 157
                   G    KV++TD D   +  ++  N ELN +      V   KLWW +P +   
Sbjct: 184 ILENDLQKGIKRDKVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDPNEKIA 243

Query: 158 GPDAISNKTDLVLAADCVYLETAFP 182
           G D  + K  LV+ AD  Y  +  P
Sbjct: 244 GED--NGKIGLVVGADITYDNSVIP 266

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 91/204 (44%), Gaps = 21/204 (10%)

Query: 28  LTFGGRIFPALKIHEDG-GESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKP 86
            TF G   P ++I+E        G K W A  +L + L+     N +     N   R   
Sbjct: 192 FTFEGLPSP-IEIYEPSLTADNLGWKTWGASFILSQKLI-----NVLAESTFNFKPR--- 242

Query: 87  FVNILELGSGTGLVG---LCAGSLARANGGNAKVHITDIDQLVRLMEGNVELNGLASVVS 143
              +LELGSGTGL G   LC   + +   G+ ++ +TD+  +V  ++ NVE+N + S  +
Sbjct: 243 ---VLELGSGTGLAGISWLCKW-VQKYGNGHTEIFLTDLPVIVANLQKNVEVNKVESFAT 298

Query: 144 AEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETAFPLLEKTLLDLTKGETPPVVLMS 203
              L W +P   +F      ++ D+++ +D +Y      L+   +      +    + + 
Sbjct: 299 VSALDWTDPT--DFINSYTDDEFDILIVSDPIYSPNHPELVVNMIKKFLSSQGQCYLEIP 356

Query: 204 YRKRRKADRIFFKAIRKN--FKVV 225
            R R  A+R   + +  +  FK++
Sbjct: 357 LRPRYAAERKRLRQLLSDNGFKII 380

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 56/89 (62%), Gaps = 8/89 (8%)

Query: 90  ILELGSGTGLVGLCAGSLARANGGNAKVHITDIDQLVRLMEGNVELNGLASVVSAEKLWW 149
           +LELGSGTGLVG+ + +L  +  G++ + +TD+ +++  ++ NV LN L   V+A+ L W
Sbjct: 240 VLELGSGTGLVGI-SYALTHSINGDSVIFLTDLPEILPNLQYNVRLNNLND-VTADVLDW 297

Query: 150 GEPLKY--EFGPDAISNKTDLVLAADCVY 176
            +PL +  ++G +      D ++ AD +Y
Sbjct: 298 TDPLSFTEKYGNEPF----DTIVIADPIY 322

>TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {ON}
           Anc_1.325 YBR271W
          Length = 421

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 60/135 (44%), Gaps = 16/135 (11%)

Query: 50  GGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAG---- 105
           G K W +  +L +YL+ N       +K +N+       V +LELG+GTGLVG+  G    
Sbjct: 215 GWKTWGSSLVLSQYLINN------FNKYINVNNCHVRKVRVLELGAGTGLVGISWGCKWK 268

Query: 106 ----SLARANGGNAKVHITDIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDA 161
               S    N  N ++ +TD+ ++   +  NV  N L+     + L W +P    F    
Sbjct: 269 EEVTSAGNENLQNMELFLTDLPEITNNLAKNVSTNELSDFCKVDVLNWTDPTS--FTNTH 326

Query: 162 ISNKTDLVLAADCVY 176
                  +L AD +Y
Sbjct: 327 TEEPFQYILIADPIY 341

>NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa]
           {ON} Anc_1.325 YBR271W
          Length = 432

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 61/129 (47%), Gaps = 11/129 (8%)

Query: 50  GGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLAR 109
           G K W +  +L + L+     N + + + N   + K    +LELG+GTGLVG+      R
Sbjct: 233 GWKTWGSSLILSQELV-----NDLETNKNN--KKSKSIRRVLELGAGTGLVGIAWACKWR 285

Query: 110 ANGGNAKVH--ITDIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTD 167
              GN  +   +TD+  +V  +  NV+ N L   V A+ L W  P   +F       K D
Sbjct: 286 QLYGNESIEMFVTDLPDIVTNLRKNVQNNDLDDFVVADVLDWTNP--EDFIKKYSDEKFD 343

Query: 168 LVLAADCVY 176
            +L AD +Y
Sbjct: 344 TILIADPIY 352

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 79/180 (43%), Gaps = 23/180 (12%)

Query: 44  GGESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRD--KPFVNILELGSGTGLVG 101
              S  G + W A   + ++L+        L +   + G+D  K  +N+LE+G+GTG+V 
Sbjct: 127 SAASTTGFRTWEAALYMGDFLIHKP-----LQELAPVQGQDDGKKKLNVLEVGAGTGIVS 181

Query: 102 LCAGSLARANGGNAKVHITDID------QLVRLMEGNVELNGLASVVSAEKLWWGEPLKY 155
           L    L + +    K+++TD D      QL R  E N E+      +  ++LWW      
Sbjct: 182 LVI--LQKYHEFVNKMYVTDGDSNLVETQLKRNFELNNEVRENEPDIKLQRLWW------ 233

Query: 156 EFGPDAISNKTDLVLAADCVYLETAFPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFF 215
             G D +    DLV+ AD  Y  T  P L + L +    +   + L+S   R ++    F
Sbjct: 234 --GSDRVPEDIDLVVGADVTYDPTILPDLCECLAECLALDRCKLCLLSATIRSESTVQLF 291

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 10/95 (10%)

Query: 90  ILELGSGTGLVGLCAGS-----LARANGGN---AKVHITDIDQLVRLMEGNVELNGLASV 141
           ILELG+GTGLVG+         +   NG N    ++ +TD+ ++V  ++ N+ +N L  +
Sbjct: 266 ILELGAGTGLVGISWSCKWKEMMKLTNGNNLPNTEIILTDLPEIVGNLQRNISINNLNDI 325

Query: 142 VSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVY 176
             A  L W  P    F  +  + K D++L AD +Y
Sbjct: 326 ARASVLDWTNP--KSFIQEYSNEKFDIILVADPIY 358

>TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.352
           YJR129C
          Length = 327

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 52/102 (50%), Gaps = 14/102 (13%)

Query: 90  ILELGSGTGLVGLCAGSLARANGGNA-KVHITDID-QLVRLMEGNVELNGL-ASVVSAEK 146
           +LELG+GTG+V   + +LA  N G   K+++TD D  L +    N  LNG+  S    E+
Sbjct: 162 VLELGAGTGMV---SATLALTNPGRLDKLYVTDGDWHLTQQARKNFSLNGIETSNTYFEQ 218

Query: 147 LWWGEPLKYEFGPDAISNKTDLVLAADCVYLETAFPLLEKTL 188
           L W E        D +  K D V+AAD  Y  T  P L K +
Sbjct: 219 LRWNE--------DPVPTKLDYVVAADVTYDSTVVPDLCKCI 252

>KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} similar
           to uniprot|P47163 Saccharomyces cerevisiae YJR129C
           Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 317

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 75/171 (43%), Gaps = 38/171 (22%)

Query: 50  GGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLAR 109
           G + W +   L EYL EN  +                F   LELG+GTGLV +    L +
Sbjct: 124 GFRTWESALYLSEYLAENFPEFSA-----------GKFSRALELGAGTGLVSIAWAKLFK 172

Query: 110 ANGGNAKVHITD-----IDQLVRLMEGNVELNGLAS-------VVSAEKLWWGEPLKYEF 157
             G   ++ +TD     ++Q  R+   N +LNG+ +           ++LWWGE      
Sbjct: 173 --GYIKELIVTDGDSSLVEQAARV---NFKLNGIDTRECHGDCAYKFQRLWWGE------ 221

Query: 158 GPDAISNKTDLVLAADCVYLETAFPLLEKTL-LDLTKGETPPVVLMSYRKR 207
             DA+  + D+VLAAD  Y  +  P L   L   L++G    +V  + R +
Sbjct: 222 --DAVP-EVDIVLAADVTYDSSVIPSLTHCLKTALSQGTQFALVAATVRNK 269

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

Query: 90  ILELGSGTGLVGLCAGSLARANGGNAKVHI--TDIDQLVRLMEGNVELNGLASVVSAEKL 147
           +LELGSGTGL G+          GN+ + +  TD+ ++V  +  NVE+NG++     + L
Sbjct: 234 VLELGSGTGLAGISWLMKWIEIHGNSNIEMFFTDLQEIVPNLRKNVEINGISDNSVVDTL 293

Query: 148 WWGEPLKYEFGPDAISNKTDLVLAADCVY 176
            W  P   +F     S K D+++ +D +Y
Sbjct: 294 DWTCP--EDFVDKYSSEKFDIIIVSDPIY 320

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 74/185 (40%), Gaps = 41/185 (22%)

Query: 11  FTDLVPSRPLE---------HFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLC 61
           + DL+ SRPL            GD+ +    R  P L        +  G + W A   L 
Sbjct: 64  YVDLLSSRPLRPDEPNVLVYRLGDT-VRVSIREMPRLI----SAVNTTGFRTWRAATSLS 118

Query: 62  EYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNAKVHITD 121
           + L+E+ +           L R K    +LELG GTGL  +  G L        K+++TD
Sbjct: 119 KLLVEHRE-----------LTRGK---TVLELGCGTGLSSITVGVLDEYK----KLYVTD 160

Query: 122 IDQ--LVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLET 179
            D   L  +   N+ LN +   V  ++L W          D +    D+V+ AD  Y  T
Sbjct: 161 GDTGILSEVTTPNLSLNKVERDVQCQRLVWA-------SEDRVPGDIDVVVGADITYDPT 213

Query: 180 AFPLL 184
            FP L
Sbjct: 214 VFPEL 218

>KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 308

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 68/154 (44%), Gaps = 30/154 (19%)

Query: 45  GESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCA 104
            +   G + W A   LC Y+ ++    G+     +L+         LELG GTG++ +  
Sbjct: 110 AQGTTGFRTWEAALFLCHYMTQHP---GLFVTHDSLM---------LELGCGTGIISILY 157

Query: 105 GSLARANGG--NAKVHITDID-QLVRLMEGNVELNGLASV-----VSAEKLWWGEPLKYE 156
             +  + G      + +TD D  L++ +  N +LNG  S      +  ++L W E     
Sbjct: 158 KMIKDSQGDCKAGTIIVTDGDSNLLQQVSTNFQLNGSLSNDGDVNIGFQRLRWNE----- 212

Query: 157 FGPDAISN--KTDLVLAADCVYLETAFPLLEKTL 188
              D +SN  + DL+LAAD  Y  +  P L K L
Sbjct: 213 ---DELSNYNEIDLILAADVTYDTSVIPDLVKCL 243

>Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON}
           (182083..183093) [1011 nt, 337 aa]
          Length = 336

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 22/108 (20%)

Query: 89  NILELGSGTGLV--GLCAGSLARANGGNAKVHITDIDQLVRLMEG----NVELNGLA--S 140
           NILELG+GTGLV  GLC     +      K+++TD D   +L+EG    N   N L+   
Sbjct: 167 NILELGAGTGLVSIGLC----KQYEDSIDKIYVTDGDS--QLVEGQLLKNFNENELSHND 220

Query: 141 VVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETAFPLLEKTL 188
            V  +KLWW          D +    DL++AAD  Y  +  P L +T+
Sbjct: 221 RVILQKLWW--------NVDDVPLDLDLIVAADVTYDSSVVPDLCETI 260

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 90  ILELGSGTGLVGLCAGSLARANGGNAKVHITDIDQLVRLMEGNVELNGLASVVSAEKLWW 149
           +LELG+GTGLVG+      +A     ++ +TD+  +V  +  N++LN L +V +AE  W 
Sbjct: 240 VLELGAGTGLVGISYAIAHQA--STPQIILTDLPDIVPNLRSNIKLNNLKNVHAAELDWT 297

Query: 150 GEPLKYEFGPDAISNKTDLVLAADCVY 176
                  F      +K D++L +D +Y
Sbjct: 298 DHS---TFIAQHGGDKFDMILVSDPIY 321

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 10/101 (9%)

Query: 90  ILELGSGTGLVGLCAGSLARANGGNAKVHITDIDQLVRLMEGNVELNGLASVVSAEKLWW 149
           +LELG+GTGLVG+   + A AN     V +TD+ ++V  +  N+ LN L + V A  L W
Sbjct: 232 VLELGAGTGLVGI---AYALANIDADDVFVTDLPEIVPNLRHNLALNNLTN-VRASVLDW 287

Query: 150 GEPLKY--EFGPDAISNKTDLVLAADCVYLETAFPLLEKTL 188
            +P  +  E G      + D +  AD +Y      LL +T+
Sbjct: 288 SDPTSFLHEHG----ELQFDAIFVADPIYSPNHPQLLVQTV 324

>CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129c
          Length = 327

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 75/179 (41%), Gaps = 20/179 (11%)

Query: 48  GCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSL 107
             G + W A   L  YL++    N + +              ILELGSGTGLV L    L
Sbjct: 129 STGNRTWEAAVYLGLYLIDQCASNVVAAPS-----------RILELGSGTGLVSLLYQQL 177

Query: 108 ARANGGNAKVHITDIDQLV--RLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNK 165
              +    K+ +TD D  V  + + GN+ LN L   +  ++L WG P     G +     
Sbjct: 178 YPFD----KLTMTDGDWDVVRKRIPGNLSLNDLKPGLEVKQLVWG-PRDANSGDNQWD-- 230

Query: 166 TDLVLAADCVYLETAFPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKV 224
            DL+L +D  Y +     L + L  L K +     L+    R +A    F+   + +K+
Sbjct: 231 YDLILGSDLTYDDRILEPLCQALQWLLKTDGSNEALLGATVRNEATTALFEKYMREYKL 289

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 12/97 (12%)

Query: 88  VNILELGSGTGLVGLCAGSLARANGGNAK--VHITDIDQLVRLMEGNVELNGLAS----V 141
           + ILELG+GTGLVG+         G   K  VH+TD+  +V  ++ NV+LN         
Sbjct: 248 LRILELGAGTGLVGIAFIQKILEVGSTQKFRVHLTDLPDIVPNLQKNVDLNKCNREPNVE 307

Query: 142 VSAEKLWWGEPLKYE--FGPDAISNKTDLVLAADCVY 176
           V+ + L W +P  ++  +G      K D++L AD +Y
Sbjct: 308 VAVDVLDWTDPSSFQEKYG----YKKFDVLLIADPIY 340

>AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR129C
          Length = 316

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 49/98 (50%), Gaps = 21/98 (21%)

Query: 91  LELGSGTGLVGLCAGSLARANGGNAKVHITDIDQLVRLMEG----NVELNGLASV--VSA 144
           LELG+GTGLV L   +  R+    +  +ITD D    L+EG    N+ LNGL S    S 
Sbjct: 154 LELGAGTGLVSL---AWLRSR-PESSAYITDGDSA--LLEGHLAENLALNGLRSSPRASL 207

Query: 145 EKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETAFP 182
            +LWW          D +  + D+VLAAD  Y  T  P
Sbjct: 208 RRLWW--------NVDEVP-QNDIVLAADVTYDSTVLP 236

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 58/102 (56%), Gaps = 12/102 (11%)

Query: 79  NLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNAKVHITDIDQLVRLMEGNVELNGL 138
           N  G  KP V  LELGSGTGLVG+   +++ +N   ++V +TD+ ++V  +  N +LN L
Sbjct: 228 NCSGSSKPRV--LELGSGTGLVGITY-TISHSNEF-SQVFLTDLPEIVPNLRTNAKLNDL 283

Query: 139 AS--VVSAEKLWWGEPLKY--EFGPDAISNKTDLVLAADCVY 176
           ++   V A+ L W     +  ++G      + D++L AD +Y
Sbjct: 284 STHNSVIADVLDWTNHDSFVEKYG----DIQFDIILIADPIY 321

>Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to
           Ashbya gossypii AER161C
          Length = 320

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 60/139 (43%), Gaps = 35/139 (25%)

Query: 50  GGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKP-FVNILELGSGTGLVGLCAGSLA 108
           G + W A   LC YL E+                 +P F  +LELG+GTG+V L   +  
Sbjct: 131 GFRTWEAALYLCHYLCES-----------------RPRFGTMLELGAGTGIVSL---TWH 170

Query: 109 RANGGNAKVHITDIDQLV--RLMEGNVELNGL---ASVVSAEKLWWGEPLKYEFGPDAIS 163
           +   G    + TD D+ +  + ++     NG+      V  ++L W          D+I 
Sbjct: 171 KLQSGQFMTYATDGDKNIIGKQLKETFISNGVDLDKGNVHLQRLLWN--------VDSIP 222

Query: 164 NKTDLVLAADCVYLETAFP 182
            K D++LAAD  Y  TA P
Sbjct: 223 -KNDIILAADVTYDHTAIP 240

>ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa]
           {ON} weakly similar to uniprot|P47163 Saccharomyces
           cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 298

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 61/139 (43%), Gaps = 38/139 (27%)

Query: 50  GGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVN-ILELGSGTGLVGLC---AG 105
           G + W A   LC+YL           +Q  L     P VN +LE+G+GTGLV      AG
Sbjct: 117 GHRTWEASLYLCQYLF----------RQDWL-----PQVNEVLEIGAGTGLVSTALALAG 161

Query: 106 SLARANGGNAKVHITDIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNK 165
               +  G+  V    ++QL +    N E+N     + A+ L WG     +  P     K
Sbjct: 162 HQVTSTDGDPMV----VEQLRKTFNLN-EVN-----IEAQVLEWG----LQKPP-----K 202

Query: 166 TDLVLAADCVYLETAFPLL 184
           +DLV+AAD  Y     P L
Sbjct: 203 SDLVVAADVTYDTAVIPSL 221

>ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} similar
           to uniprot|Q05874 Saccharomyces cerevisiae YLR285W NNT1
           Putative nicotinamide N-methyltransferase has a role in
           rDNA silencing and in lifespan determination
          Length = 263

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 97/236 (41%), Gaps = 45/236 (19%)

Query: 12  TDLVPSRPLEHFGDSDLTFGGRIFPA----LKIHEDGGESGCGGKLWIAGELLCEYLLEN 67
           TD +P  P  HF D +  +  +   +    +++   G     G  LW AG    ++L ++
Sbjct: 17  TDFLPPPPEAHFADYEREYVSKESDSQNKKVQLRLVGKSPLWGHMLWNAGIYTAKHLDKH 76

Query: 68  SDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNAKVHITDIDQ--L 125
               G++  +           N+LELG+   L  +  G +     G  KV  TD  +  L
Sbjct: 77  P---GLVKGK-----------NVLELGAAAALPTVVCGLI-----GANKVVSTDYPEPEL 117

Query: 126 VRLMEGNV--ELNGLASV--------VSAEKLWWG---EPLKYEFGPDAISNKTDLVLAA 172
           ++ ++ NV  EL G            V  E   WG   EP+    G     +K DL++ +
Sbjct: 118 IQNIQYNVDHELYGGKPFSQDSNDRKVVVEGYIWGNEYEPILSHTG----GSKFDLIILS 173

Query: 173 DCVYLETAFPLLEKTLLDLTKGETPPVVLMSYRKRR--KADRIFFKAIRKNFKVVP 226
           DCV+  T    L + + DL   +   +V+ S  + R    D  FF+   K F + P
Sbjct: 174 DCVFNHTEHRKLLRCIKDLLANDGKALVVFSPHRPRLLDVDLSFFETA-KEFGLAP 228

>CAGL0M09801g Chr13 complement(970260..971030) [771 bp, 256 aa] {ON}
           similar to uniprot|Q05874 Saccharomyces cerevisiae
           YLR285w
          Length = 256

 Score = 35.8 bits (81), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 78/218 (35%), Gaps = 28/218 (12%)

Query: 13  DLVPSRPLEHFGDSDLT----FGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENS 68
           D  P +P EH+ + +              LK+   G     G  LW AG     +L    
Sbjct: 19  DFRPEKPKEHYANYERIDVPDISKSKITNLKLQLVGSSPLWGHLLWNAGIYTARHL---- 74

Query: 69  DDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNAKVHITDIDQLVRL 128
                  K   L+       N+LELG+ + L  L AG +             D+   ++ 
Sbjct: 75  ------DKYPELVSNK----NVLELGAASALPSLVAGLIGAKRAVVTDYPDADLMANIQY 124

Query: 129 MEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAIS----NKTDLVLAADCVYLETAFPLL 184
               +  + L   V  E   WG     E+ P  I      K DL++ +D V+       L
Sbjct: 125 NVNTIIPDELKENVRVEGYIWGN----EYDPLTIHLDGDKKFDLIILSDLVFNHNQHDKL 180

Query: 185 EKTLLDLTKGETPPVVLMSYRKRR--KADRIFFKAIRK 220
            +T  DL       +V+ S  +    +AD  FF+  ++
Sbjct: 181 LQTTKDLLATNGKALVVFSPHRPHLLEADLQFFETCKE 218

>TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4.352
           YJR129C
          Length = 316

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 14/94 (14%)

Query: 89  NILELGSGTGLVGLCAGSLARANGGN-AKVHITDIDQLV--RLMEGNVELNGLA--SVVS 143
           N++E+G+GTG+V +    + +  G N + V +TD D+ V  + +  N +LNG+   + V 
Sbjct: 148 NVVEIGAGTGMVSI---GIMKMQGQNISSVLVTDGDEYVANKQLPKNFQLNGIVDDTRVK 204

Query: 144 AEKLWWGEP-LKYEFGPDAISNKTDLVLAADCVY 176
            +K+ W E  L    GP+      D ++ AD  Y
Sbjct: 205 FQKIRWNEDHLVNGDGPNV-----DYLVGADVTY 233

>TDEL0F04630 Chr6 (869804..870772) [969 bp, 322 aa] {ON} Anc_8.339
           YLR137W
          Length = 322

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 45/108 (41%), Gaps = 13/108 (12%)

Query: 37  ALKIHEDGGESGCGGKLWIAGELLCEYLLENSD-----DNGILSKQMNLLGRDKPFVNIL 91
           +L  + D   S  G  LW       ++LL +         GI+   + + G  KP   IL
Sbjct: 83  SLHSNRDNSNSTTGYVLWSTTPFFLKWLLYDPQAISFRQGGIVDANV-IYGMLKPSTGIL 141

Query: 92  ELGSGTGLVGLCAGSLARANGGNAKVHI-TDIDQLVRLMEGNVELNGL 138
           ELG GT      AG +    G     +I TD   L+  M+ N++ N L
Sbjct: 142 ELGGGT------AGIMPVVLGNYVGTYICTDQRSLINRMQSNIKNNLL 183

>CAGL0E00231g Chr5 complement(15452..21046) [5595 bp, 1864 aa] {OFF}
           no similarity
          Length = 1864

 Score = 32.7 bits (73), Expect = 1.1,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 10/87 (11%)

Query: 112 GGNAKVHITDIDQLVR---LMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKT-D 167
           GG+    IT   Q VR   L+ G V+++  +S V     + G  L Y  GPDA++N   D
Sbjct: 72  GGSTLTIITPGGQSVRNELLINGKVKIDSGSSFV-----YDGSKLTYASGPDAVTNYNFD 126

Query: 168 LVLAADCVYLETAFPLLEKTLLDLTKG 194
           +   AD VY+ +   ++  TL  L KG
Sbjct: 127 INTGADGVYVSSDSSMI-ITLPALLKG 152

>KLLA0B07117g Chr2 (618368..619414) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38074 Saccharomyces cerevisiae
           YBR034C HMT1 Nuclear SAM-dependent mono- and asymmetric
           arginine dimethylating methyltransferase that modifies
           hnRNPs including Npl3p and Hrp1p thus facilitating
           nuclear export of these proteins required for viability
           of npl3 mutants
          Length = 348

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 79  NLLGRDKPFVN---ILELGSGTGLVGLCAGSLARANGGNAKVHITDIDQLVRLMEGNVEL 135
           N + ++K F     +L++G GTG++ + A     A  G   V   D+  ++ + +  VEL
Sbjct: 48  NAIAQNKDFFKGKVVLDVGCGTGILSMFA-----AKNGAKHVIGVDMSSIIEMAKQIVEL 102

Query: 136 NGLASVVS 143
           NGL+  ++
Sbjct: 103 NGLSDKIT 110

>TPHA0F00400 Chr6 (91892..97645) [5754 bp, 1917 aa] {ON} Anc_4.50
            YLR305C
          Length = 1917

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 139  ASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVY-LETAFPLL 184
            +S+V     W+ +PL + FG D + N+ DL ++ + +  LE   P L
Sbjct: 1270 SSIVIGNLSWFKKPLSWPFGADQLRNEADLAVSVELLSKLEHIMPTL 1316

>Kpol_505.36 s505 (83512..84702) [1191 bp, 396 aa] {ON}
           (83512..84702) [1191 nt, 397 aa]
          Length = 396

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 183 LLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVV 225
           LL+ TL D      P  +L+ YR ++  D + FK I KN +V+
Sbjct: 316 LLKNTLDDFV---VPLTILLRYRYQQTNDNVSFKPIEKNVEVI 355

>SAKL0D04466g Chr4 (357282..358328) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38074 Saccharomyces cerevisiae
           YBR034C HMT1 Nuclear SAM-dependent mono- and asymmetric
           arginine dimethylating methyltransferase that modifies
           hnRNPs including Npl3p and Hrp1p thus facilitating
           nuclear export of these proteins required for viability
           of npl3 mutants
          Length = 348

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 90  ILELGSGTGLVGLCAGSLARANGGNAKVHITDIDQLVRLMEGNVELNGLASVVS 143
           +L++G GTG++ + A     A  G   V   D+  ++ + +  VELNGL+  ++
Sbjct: 62  VLDVGCGTGILSMFA-----AKNGAKHVIGVDMSSVIEMAKQIVELNGLSDKIT 110

>Kpol_414.3 s414 (8196..13925) [5730 bp, 1909 aa] {ON} (8196..13925)
            [5730 nt, 1910 aa]
          Length = 1909

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 148  WWGEPLKYEFGPDAISNKTDLVLAAD 173
            W+  P+ + FG + + NK DL +A D
Sbjct: 1288 WYKSPISWPFGANELRNKADLAVAID 1313

>TPHA0B00750 Chr2 complement(170775..171875) [1101 bp, 366 aa] {ON}
           Anc_4.255 YLR394W
          Length = 366

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 197 PPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHL 243
           PP V ++      AD IF K ++KN   +  +SF +  D + + T +
Sbjct: 203 PPTVDLTIDDDNNADEIFLKKLKKNANSLNTSSFPKTPDIVAESTQI 249

>Smik_7.317 Chr7 (529500..530882) [1383 bp, 460 aa] {ON} YFR012W
           (REAL)
          Length = 460

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 16/98 (16%)

Query: 159 PDAISNK-------TDLVLAADCVYLETAFPLLEKTLLDLTKGETPPVVLMSYRKRRKAD 211
           P A+S+K       T L  ++  VYL T+F    +  LD  + E PP ++ S +K    +
Sbjct: 215 PSALSDKSSQATKSTVLSPSSKSVYLSTSFSNNLQRTLDPNQDELPPEIIPSVKKATSVN 274

Query: 212 ---------RIFFKAIRKNFKVVPITSFDRCDDFLKQR 240
                     +F    + N K + I   D  + F+KQ 
Sbjct: 275 FFIPNLHGAPMFSDRSKSNQKTLSIHEIDIANLFVKQE 312

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.141    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,053,833
Number of extensions: 1180422
Number of successful extensions: 2448
Number of sequences better than 10.0: 72
Number of HSP's gapped: 2412
Number of HSP's successfully gapped: 72
Length of query: 251
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 144
Effective length of database: 41,212,137
Effective search space: 5934547728
Effective search space used: 5934547728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)