Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G10384g2.287ON36736719540.0
Kwal_27.115282.287ON36736718460.0
SAKL0E07656g2.287ON36836817140.0
TDEL0G021802.287ON36936916280.0
NCAS0B062502.287ON37337316140.0
KLLA0E08339g2.287ON36936815990.0
Suva_9.1052.287ON37137115880.0
YIL094C (LYS12)2.287ON37137115810.0
ZYRO0A01914g2.287ON36836815790.0
Smik_9.852.287ON37137115770.0
KNAG0A054202.287ON37237115740.0
NDAI0B035502.287ON37237215660.0
Skud_9.792.287ON37137115620.0
CAGL0G02585g2.287ON37237215420.0
KAFR0J013602.287ON37337214950.0
TPHA0C034102.287ON37137114890.0
TBLA0B059402.287ON36936914860.0
Kpol_1003.392.287ON37037014840.0
Ecym_33262.287ON36636814750.0
ADL214C2.287ON36736714080.0
ADL223W2.278ON3623804533e-52
KLTH0F15048g5.473ON3683604463e-51
Ecym_23135.473ON3703914464e-51
Ecym_33162.278ON3623804455e-51
KLLA0E03125g5.473ON3683554447e-51
TPHA0D015602.278ON3603764351e-49
Kwal_55.212735.473ON3683914351e-49
Kpol_543.85.473ON3683594299e-49
Skud_14.2932.278ON3613744291e-48
Suva_8.1885.473ON3693914282e-48
AFR137C5.473ON3673944272e-48
TBLA0B022405.473ON3733544263e-48
CAGL0I07227g5.473ON3683904254e-48
Smik_14.2902.278ON3603744244e-48
YNL037C (IDH1)2.278ON3603774236e-48
KNAG0B040705.473ON3733914237e-48
NDAI0C014105.473ON3693544239e-48
NCAS0H022505.473ON4223534251e-47
TPHA0J027705.473ON3763664221e-47
Smik_15.3165.473ON3693914212e-47
KAFR0B063705.473ON3783644212e-47
KLTH0G10186g2.278ON3603854192e-47
SAKL0G03520g5.473ON3693594193e-47
TDEL0C038402.278ON3613814159e-47
Kwal_23.50122.278ON3613854151e-46
Skud_15.3005.473ON3693594151e-46
SAKL0E07876g2.278ON3613854132e-46
KLLA0F04103g2.278ON3613504104e-46
Kpol_440.125.473ON3683544107e-46
TPHA0E014805.473ON3773544107e-46
TDEL0A033705.473ON3713594098e-46
NDAI0B035902.278ON3593514089e-46
YOR136W (IDH2)5.473ON3693974081e-45
TBLA0C015001.402ON3653614072e-45
NCAS0B062902.278ON3593534062e-45
Kpol_1039.352.278ON3593744011e-44
ZYRO0D11220g5.473ON3683523974e-44
KAFR0J014102.278ON3503733912e-43
CAGL0G02673g2.278ON3583763896e-43
ZYRO0D02838g2.278ON3613843889e-43
Skud_3.431.402ON3643673852e-42
KNAG0A052802.278ON3613793843e-42
YCL018W (LEU2)1.402ON3643673844e-42
Smik_3.661.402ON3643673783e-41
TBLA0B069102.278ON3653553773e-41
KLTH0H12188g1.402ON3643673764e-41
Kpol_1048.631.402ON3643613749e-41
Ecym_12961.402ON3633623731e-40
TDEL0B060001.402ON3623633722e-40
NDAI0G042301.402ON3633603704e-40
KNAG0I012801.402ON4473683738e-40
KLLA0D04906g1.402ON3623633671e-39
AAL012C1.402ON3723643661e-39
Kwal_0.2251.402ON3643733625e-39
Suva_3.31.402ON3643653625e-39
CAGL0H03795g1.402ON3653623512e-37
Suva_14.3022.278ON3003193472e-37
ZYRO0E04796g1.402ON3623633461e-36
NCAS0C048701.402ON3653683432e-36
KAFR0I022001.402ON3653673409e-36
SAKL0D08690g1.402ON3643723409e-36
TPHA0B037301.402ON3653643171e-32
KLTH0D14476g4.254ON4202971568e-11
KAFR0H031601.396ON4212281523e-10
CAGL0D00770g4.254ON4232701443e-09
KLLA0F12342g1.396ON4152951443e-09
Ecym_13061.396ON4152131408e-09
TPHA0B022104.254ON4332731401e-08
SAKL0D08426g1.396ON4112011372e-08
Kpol_1048.701.396ON4192151372e-08
KLTH0H12012g1.396ON4132071372e-08
AAL022W1.396ON4152951362e-08
CAGL0H03663g1.396ON4181551344e-08
TBLA0C012901.396ON4181231345e-08
SAKL0H02860g4.254ON4212031336e-08
KLLA0B03355g4.254ON4292701337e-08
Kwal_0.1911.396ON4113041328e-08
ZYRO0E05016g1.396ON4112071329e-08
TDEL0E011604.254ON4232731311e-07
KAFR0I021301.396ON4081801311e-07
Kpol_1055.784.254ON4272041301e-07
Smik_12.2351.396ON4121301301e-07
Kwal_23.42104.254ON4222121301e-07
TDEL0B061001.396ON4141421302e-07
NCAS0A087201.396ON4131301283e-07
Suva_10.2711.396ON4121301283e-07
Skud_12.2391.396ON4121301283e-07
YLR174W (IDP2)1.396ON4122221283e-07
Smik_4.1694.254ON4281441283e-07
YDL066W (IDP1)4.254ON4281441274e-07
AER061C4.254ON4252091274e-07
NDAI0D043604.254ON4242061274e-07
Skud_4.1894.254ON4291441274e-07
TPHA0B036601.396ON4221261255e-07
YNL009W (IDP3)1.396ON4201301248e-07
KNAG0I013201.396ON4121331248e-07
KNAG0H016701.396ON4241301248e-07
NCAS0A025104.254ON4262361221e-06
KAFR0G032604.254ON4211741221e-06
Suva_4.1844.254ON4291441212e-06
Smik_14.3191.396ON4181331202e-06
CAGL0B04917g1.396ON4112011202e-06
Skud_14.3181.396ON4201261193e-06
Suva_14.3391.396ON4171301193e-06
KNAG0D044104.254ON4281761193e-06
NCAS0G036201.396ON4181951168e-06
TBLA0A080104.254ON428941151e-05
Ecym_32654.254ON4241151132e-05
NDAI0G008501.396ON4191301132e-05
ZYRO0B12496g4.254ON4221441123e-05
NDAI0G051601.396ON4202501095e-05
Suva_14.303singletonON5350740.092
KAFR0A013201.253ON1765112704.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G10384g
         (367 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   757   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   715   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   664   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   631   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   626   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   620   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   616   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   613   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   612   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   612   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              610   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   607   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   606   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   598   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   580   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   578   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   577   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   576   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   572   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   546   0.0  
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   179   3e-52
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   176   3e-51
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   176   4e-51
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   176   5e-51
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   175   7e-51
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   172   1e-49
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   172   1e-49
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   169   9e-49
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   169   1e-48
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   169   2e-48
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   169   2e-48
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   168   3e-48
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   168   4e-48
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   167   4e-48
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   167   6e-48
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   167   7e-48
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   167   9e-48
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    168   1e-47
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   167   1e-47
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   166   2e-47
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   166   2e-47
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   166   2e-47
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   166   3e-47
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   164   9e-47
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   164   1e-46
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   164   1e-46
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   163   2e-46
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   162   4e-46
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   162   7e-46
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   162   7e-46
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   162   8e-46
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   161   9e-46
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   161   1e-45
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   161   2e-45
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   160   2e-45
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   159   1e-44
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   157   4e-44
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   155   2e-43
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   154   6e-43
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   154   9e-43
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   152   2e-42
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              152   3e-42
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   152   4e-42
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   150   3e-41
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            149   3e-41
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   149   4e-41
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   148   9e-41
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   148   1e-40
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   147   2e-40
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   147   4e-40
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   148   8e-40
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   145   1e-39
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   145   1e-39
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   144   5e-39
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      144   5e-39
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             139   2e-37
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   138   2e-37
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   137   1e-36
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   136   2e-36
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   135   9e-36
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   135   9e-36
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   126   1e-32
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    65   8e-11
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    63   3e-10
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    60   3e-09
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    60   3e-09
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    59   8e-09
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    59   1e-08
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    57   2e-08
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    57   2e-08
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    57   2e-08
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    57   2e-08
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    56   4e-08
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    56   5e-08
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    56   6e-08
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    56   7e-08
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    55   8e-08
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    55   9e-08
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    55   1e-07
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    55   1e-07
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    55   1e-07
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    55   1e-07
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    55   1e-07
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    55   2e-07
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    54   3e-07
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    54   3e-07
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    54   3e-07
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    54   3e-07
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    54   3e-07
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    54   4e-07
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    54   4e-07
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    54   4e-07
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    54   4e-07
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    53   5e-07
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    52   8e-07
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    52   8e-07
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    52   8e-07
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    52   1e-06
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    52   1e-06
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    51   2e-06
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    51   2e-06
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    51   2e-06
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    50   3e-06
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    50   3e-06
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    50   3e-06
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    49   8e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    49   1e-05
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    48   2e-05
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     48   2e-05
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    48   3e-05
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    47   5e-05
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    33   0.092
KAFR0A01320 Chr1 complement(252704..258001) [5298 bp, 1765 aa] {...    32   4.5  

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/367 (100%), Positives = 367/367 (100%)

Query: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60
           MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ
Sbjct: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60

Query: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV
Sbjct: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180
           RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI
Sbjct: 121 RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180

Query: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240
           ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS
Sbjct: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240

Query: 241 MVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300
           MVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD
Sbjct: 241 MVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300

Query: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVV 360
           IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVV
Sbjct: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVV 360

Query: 361 EDVLSRM 367
           EDVLSRM
Sbjct: 361 EDVLSRM 367

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/367 (92%), Positives = 358/367 (97%)

Query: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60
           MLR SF QLARRSY SA+KSLTIGLIPGDGIG+EVIPAG+ VLENLSSKHGLKF+FIDL+
Sbjct: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60

Query: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTF +TGKALPDETIDIL+N+CQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV
Sbjct: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180
           RPVKSVL QE+P+DM+IVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISE AT+NIANI
Sbjct: 121 RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180

Query: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240
           ALEIALQRQKVNG ATLTVTHKSNVLSQSDGLFRE+CRQVYESN+DKFGSI YNEQIVDS
Sbjct: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240

Query: 241 MVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300
           MVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD
Sbjct: 241 MVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300

Query: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVV 360
           IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN++KTPDLGGKSTTQQVV
Sbjct: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVV 360

Query: 361 EDVLSRM 367
           +DVLSRM
Sbjct: 361 DDVLSRM 367

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/368 (86%), Positives = 347/368 (94%), Gaps = 1/368 (0%)

Query: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60
           MLR++ +Q ARRSYASA+K LTIGLIPGDGIGKEVIPAG+ VLENLSSKH LKF+FIDLQ
Sbjct: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60

Query: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTF +TGKALPDETI+IL++ CQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV
Sbjct: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIAN 179
           RPVKSV    +RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETAT +IA 
Sbjct: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180

Query: 180 IALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVD 239
           IALEI+LQR K NG+ATLTVTHKSNVLSQSDGLFREVC+ VYESNK+++G+I YNEQIVD
Sbjct: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240

Query: 240 SMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299
           SMVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG DF+VGEPCHGSAP
Sbjct: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300

Query: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQV 359
           DIAGKGISNP+ATIRSTALMLEFMG+ EAAQDIHKAVD N+R+N IKTPDLGGKSTTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360

Query: 360 VEDVLSRM 367
           V+D+LS+M
Sbjct: 361 VDDILSKM 368

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/369 (81%), Positives = 337/369 (91%), Gaps = 2/369 (0%)

Query: 1   MLRASFTQLA-RRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDL 59
           MLR++  +LA RR+YASA KS+ IGLIPGDGIGKEVIPAG+QVLENLS KHGL FDFIDL
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60

Query: 60  QAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119
           QAGW TFQETGKALP++T+ +L+NQCQGALFGAVQSPT KVEGYSSPIVALRK+LGLYAN
Sbjct: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120

Query: 120 VRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIA 178
           VRPVKSV   ++RPVDM+IVRENTEDLYIK EKTY+D+ TGTRVAEA KRISE AT+ IA
Sbjct: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180

Query: 179 NIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIV 238
            IAL+IALQR K NG ATLTVTHKSNVLSQSDGLFRE+C+ VYESNKDK+G + YNEQIV
Sbjct: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240

Query: 239 DSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSA 298
           DSMVYRMFREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSA
Sbjct: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300

Query: 299 PDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQ 358
           PDIAGKGISNP+ATIRST LMLEF+GH + AQDI++AVDANLR++ +KTPDLGG STTQQ
Sbjct: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360

Query: 359 VVEDVLSRM 367
           VVED+LS++
Sbjct: 361 VVEDILSKL 369

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/373 (80%), Positives = 342/373 (91%), Gaps = 6/373 (1%)

Query: 1   MLRASFTQLAR---RSYASAS--KSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFD 55
           MLR + ++ A    R+YA+ +  K+LTIGLIPGDGIGKEVIPAG+QVLENL+SKHGLKFD
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 56  FIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLG 115
           FIDLQAG+QTF +TGKALPDET+ +L++QCQGALFGAVQSPT KVEGYSSPIVALRK++G
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 116 LYANVRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETAT 174
           L+ANVRPVKSV   ++RPVDM+IVRENTEDLYIK EKTYID+ TGTRVAEA KRISE AT
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180

Query: 175 KNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYN 234
           + IA IAL+IALQR KVNG+ATLTVTHKSNVLSQSDGLFRE+C+ VYESNKDK+GSI YN
Sbjct: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240

Query: 235 EQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPC 294
           EQIVDSMVYRMFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPC
Sbjct: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300

Query: 295 HGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKS 354
           HGSAPDIAGKGI+NP+ATIRSTALMLEF+GH +AAQDIH+AV+AN+R+N IKTPDLGG S
Sbjct: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360

Query: 355 TTQQVVEDVLSRM 367
           TTQQV EDVL+R+
Sbjct: 361 TTQQVTEDVLARL 373

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/368 (79%), Positives = 335/368 (91%), Gaps = 1/368 (0%)

Query: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60
           M+R  F QL+RR+YAS +K+LTIGLIPGDGIGKEVIPAG+++LE+L+ K+GL F FIDLQ
Sbjct: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60

Query: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGW+TFQ TGKALPDETIDIL+NQC+GALFGAVQSPT KVEGYSSPIVALRK LGL+ANV
Sbjct: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120

Query: 121 RPVKSV-LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIAN 179
           RPVKSV   ++R VD++IVRENTEDLYIK EK+YIDE TGTRVA+A KRI+E ATKNIA 
Sbjct: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180

Query: 180 IALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVD 239
           IAL+IA QR + NG ATLTVTHKSNVLSQSDGLFREVCR+ YE+NKDK+G ++YNEQIVD
Sbjct: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240

Query: 240 SMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299
           SMVYRMFREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300

Query: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQV 359
           DIAGKGISNP+ATIRSTALMLEF+G+PE A+DIHKAVDAN+R+    TPDLGG STTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360

Query: 360 VEDVLSRM 367
           +EDVLS++
Sbjct: 361 LEDVLSKL 368

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/371 (80%), Positives = 339/371 (91%), Gaps = 4/371 (1%)

Query: 1   MLRASFTQL-ARRSYAS--ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           M R+  T++ A R  AS  A KSLTIGLIPGDGIGKEVIPAG+Q+LENL+SKHGL F+FI
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL AG+QTFQETGKALPDETI +L++QCQGALFGAVQSPT KVEGYSSPIVALR+++GLY
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 118 ANVRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKN 176
           ANVRPVKSV   +++P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+AIKRISE AT+ 
Sbjct: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180

Query: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQ 236
           IA IAL+IALQR +  GEATLTVTHKSNVLSQSDGLFRE+C+ VYESNKDK+G IKYNEQ
Sbjct: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240

Query: 237 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296
           IVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG D V+GEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300

Query: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356
           SAPDIAGKGI+NP+ATIRSTALMLEF+GH +AAQDI+KAVDANLR+ +I TPDLGGK++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 357 QQVVEDVLSRM 367
           QQVV+DVLSR+
Sbjct: 361 QQVVDDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/371 (80%), Positives = 339/371 (91%), Gaps = 4/371 (1%)

Query: 1   MLRASFTQL-ARRSYAS--ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           M R+  T+L A R  AS  A KSLTIGLIPGDGIGKEVIPAG+QVLENL+SKHGL F+FI
Sbjct: 1   MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL AG+QTFQETGKALPDET+ +L+ QCQGALFGAVQSPT KVEGYSSPIVALR+++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANVRPVKSVLPQE-RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKN 176
           ANVRPVKSV  ++ +P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+A KRISE AT+ 
Sbjct: 121 ANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQ 236
           IA IAL+IAL+R +  G+ATLTVTHKSNVLSQSDGLFRE+C++VYESNKDK+G IKYNEQ
Sbjct: 181 IATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 237 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296
           IVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356
           SAPDIAGKGI+NP+ATIRSTALMLEF+GH EAAQDI+KAVDANLR+ SIKTPDLGGK++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAST 360

Query: 357 QQVVEDVLSRM 367
           QQVV+DVLSR+
Sbjct: 361 QQVVDDVLSRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/368 (79%), Positives = 327/368 (88%), Gaps = 1/368 (0%)

Query: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60
           M R+S  ++A R   SA KS+ IGLIPGDGIGKEVIPAG+QVLE L SKHGL+FDFIDL+
Sbjct: 1   MFRSSVAKVAARRAYSAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLK 60

Query: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGW+ FQ+ GKALPD+T+ +L+ QCQGALFGAVQSPT KV GYSSPIVALRK+LGLYANV
Sbjct: 61  AGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANV 120

Query: 121 RPVKSVLP-QERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIAN 179
           RPVKSV    +R VDMIIVRENTEDLYIKTEKTY+DE TGTRVAEAIKRISE AT+ IA 
Sbjct: 121 RPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIAT 180

Query: 180 IALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVD 239
           IAL+I+LQR K  G ATLTVTHKSNVLSQSDGLFRE+C+ VYE NKDK+G +KYNEQIVD
Sbjct: 181 IALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVD 240

Query: 240 SMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299
           SMVYRMFREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAP 300

Query: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQV 359
           DIAGKGISNP+ATIRSTALMLEF+GHPE AQDI+KAVDANL    + TPDLGGK+TTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360

Query: 360 VEDVLSRM 367
           V+D+LS++
Sbjct: 361 VDDILSKI 368

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/371 (79%), Positives = 339/371 (91%), Gaps = 4/371 (1%)

Query: 1   MLRASFTQLAR-RSYAS--ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           MLR+  T+L+  R  A+  A KSLTIGLIPGDGIGKEVIPAG+QVLENL+SKHGL F+FI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL AG+QTFQETGKALPDET+ +L+ QCQGALFGAVQSPT KVEGYSSPIVALR+++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANVRPVKSVLP-QERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKN 176
           ANVRPVKSV   +++P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+A KRISE AT+ 
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQ 236
           IA IA++IAL+R +  GEATLTVTHKSNVLSQSDGLFRE+C++VYESNKDK+G IKYNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 237 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296
           IVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356
           SAPDIAGKGI+NP+ATIRSTALMLEF+GH  AAQDI+KAVDANLR+ +IKTPDLGGK++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 357 QQVVEDVLSRM 367
           QQVVEDVLSR+
Sbjct: 361 QQVVEDVLSRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/371 (80%), Positives = 333/371 (89%), Gaps = 4/371 (1%)

Query: 1   MLRASFTQLAR-RSYAS--ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           MLR++  +LA  R  A+  A KSLTIGLIPGDGIGKEVIPAG+QVL++L+ KHGL FDFI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DLQAG+QTFQ+TGKALPDET+ IL+ +CQGALFGAVQSPT KVEGYSSPIVALRK +GLY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 118 ANVRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKN 176
           AN+RPVKSV    ERPVDMIIVRENTEDLYIK EKTYID+ TGTRVAEA KRISE AT+ 
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQ 236
           IA IAL+IALQR + NG+ATLTVTHKSNVLSQSDGLFREVCR++YE+NKDK+  I YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 237 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296
           IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356
           SAPDIAGKGI+NP+ATIRSTALMLEF+GH EAAQDIHKAVDANLRD  +KT DLGG +TT
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 357 QQVVEDVLSRM 367
           Q VV+D+L+R+
Sbjct: 362 QNVVDDILARL 372

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/372 (79%), Positives = 335/372 (90%), Gaps = 5/372 (1%)

Query: 1   MLRASFTQLAR-RSYASAS--KSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           MLR + ++LA  R YA+ +  K+LTIGLIPGDGIGKEVIPAG+QVL+NL+SKHGL FDFI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DLQAG+QTF +TGKALPDETI +L+NQCQGALFGAVQSPT KVEGYSSPIVALRK++GLY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 118 ANVRPVKSVL-PQERPVDMIIVRENTED-LYIKTEKTYIDEKTGTRVAEAIKRISETATK 175
           ANVRPVKSV    ++PVDM+IVRENT   + IK E+TYID  TGTRVAEA KRISE AT+
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 176 NIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNE 235
            IA IAL+IALQR K NG+ATLTVTHKSNVLSQSDGLFRE+C+ VYESNKDK+G I YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 236 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295
           QIVDSMVYRMFREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKST 355
           GSAPDIAGKGISNP+ATIRSTALMLEF+GH EAAQDIH+AV+ANL++N +KTPDLGGKST
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 356 TQQVVEDVLSRM 367
           TQ+V EDVL+R+
Sbjct: 361 TQEVTEDVLARL 372

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/371 (78%), Positives = 337/371 (90%), Gaps = 4/371 (1%)

Query: 1   MLRASFTQL-ARRSYAS--ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           M R+  T++ A R  A+  A KSLTIGLIPGDGIGKEVIPAG+QVLENL+SKHGL F+FI
Sbjct: 1   MFRSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL AG+QTFQETGKALPDET+++L+ QCQGALFGAVQSPT KVEGYSSPIVALR+++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANVRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKN 176
           ANVRPVKSV   + +P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+A KRISE AT+ 
Sbjct: 121 ANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQ 236
           IA IAL+IAL+R +  GEATLTVTHKSNVLSQ+DGLFRE+C++VYESNKDK+G IKYNEQ
Sbjct: 181 IATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 237 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296
           IVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356
           SAPDIAGKGI+NP+ATIRSTALMLEF+GH  AAQDI+KAVDANLR+ +I TPDLGGK++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 357 QQVVEDVLSRM 367
           QQVV+DVLSR+
Sbjct: 361 QQVVDDVLSRL 371

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/372 (77%), Positives = 328/372 (88%), Gaps = 5/372 (1%)

Query: 1   MLRASFTQL-ARRSYAS---ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDF 56
           MLR S T+L A R ++S   A K+LTIGLIPGDGIGKEVIPAG+Q+LE +  K  L F F
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 57  IDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGL 116
           IDL AGW+TFQ TGKALPDET+++LR  CQGALFGAVQSPT KVEGYSSPIVALRK +GL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 117 YANVRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATK 175
           +ANVRPVK+V    +RPVDM+IVRENTEDLYIK EKTY D  TGTRVAEA KRISE AT+
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180

Query: 176 NIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNE 235
            IA IAL+IALQR +  G ATLTVTHKSNVLSQSDGLFRE+C+ VYESNKDK+G I+YNE
Sbjct: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240

Query: 236 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295
           QIVDSMVYRMFREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKST 355
           GSAPDIAG+GI+NP+ATIRSTALMLEF+G+PEAAQ I+KAVD+N+R+N IKTPDLGGKST
Sbjct: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360

Query: 356 TQQVVEDVLSRM 367
           TQQVV+D+LS++
Sbjct: 361 TQQVVDDILSKI 372

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/372 (75%), Positives = 324/372 (87%), Gaps = 6/372 (1%)

Query: 1   MLRASFTQLARRSYASA---SKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           MLR+  T+ A   + S    +KSLTIGLIPGDGIGKEVIPAG+QVL+NLSS+HGL F+FI
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL+AG+QTF +TGKALPDET+ +L+ QCQG LFGAVQSPT +V+ YSSPIVALRK+L LY
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 118 ANVRPVKSVLPQE--RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATK 175
           AN+RPVKSV      +PVDM+IVRENTEDLYIK EK+Y D+  G RVAEA KRI+E AT+
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179

Query: 176 NIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNE 235
            IA IAL++ALQR K NG+ATLTVTHKSNVLSQSDGLFRE+C+ VY++NKDK+  I YNE
Sbjct: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239

Query: 236 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295
           QI+DSMVYRMFREPE FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG D V+GEPCH
Sbjct: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299

Query: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKST 355
           GSAPDIAGKGI+NP+ATIRSTALMLEF+GH EAAQDIHKAV++N+R+N IKTPDLGG S+
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359

Query: 356 TQQVVEDVLSRM 367
           TQ VV+DVL ++
Sbjct: 360 TQNVVDDVLEKL 371

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 319/371 (85%), Gaps = 4/371 (1%)

Query: 1   MLRAS-FTQLARRSYASASK--SLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           MLR S + +  +R+  + SK  +LTIGLIPGDGIGKEVIP+GRQVLE +  KHGL F+FI
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DLQAGWQTF +TGKALP ET+  LR  C GALFGAVQSPT KVEGYSSPIVALRK+LGLY
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 118 ANVRPVKSV-LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKN 176
           AN+RPVKSV  P  + VDM+IVRENTEDLYIK EKTYIDEKTGTRVA+A KRISE AT+ 
Sbjct: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180

Query: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQ 236
           IA IAL+IALQR K NG   LTVTHKSNVLSQSDGLFREVC++V+ESNK  +  I+YNEQ
Sbjct: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240

Query: 237 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296
           I+DSMVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG   V+GEPCHG
Sbjct: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300

Query: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356
           SAPDIAGKGISNP+ATIRSTALMLEF+GH +AAQDI  AVD+NLR++ IKTPDLGGK++T
Sbjct: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360

Query: 357 QQVVEDVLSRM 367
             VV DV+ R+
Sbjct: 361 SDVVNDVIRRL 371

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/369 (74%), Positives = 322/369 (87%), Gaps = 2/369 (0%)

Query: 1   MLRASFTQLARRSY-ASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDL 59
           MLR S  Q +  +  AS+ K+LTIGLIPGDGIGKEVIPAG+QVL+NL+ KHGL F+FIDL
Sbjct: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60

Query: 60  QAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119
           QAG+QTF +TG ALP +T+DIL+N+CQGALFGAVQSPT KVEGYSSPIV LRK+LGL+AN
Sbjct: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120

Query: 120 VRPVKSVLPQE-RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIA 178
           VRPVK+V   + +P+D++IVRENTEDLYIK EKTY D K G+R+AEA KRI+ETATK IA
Sbjct: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180

Query: 179 NIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIV 238
             AL+IALQR K  G ATLTVTHKSNVLSQSDGLFREVC++VYESNK  +  + YNEQIV
Sbjct: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240

Query: 239 DSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSA 298
           DSMVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVG + V+GEPCHGSA
Sbjct: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300

Query: 299 PDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQ 358
           PDIAGKGI+NP+ATIRSTA MLE++G+   AQDI+KAVDAN+RDN IKT DLGG STTQQ
Sbjct: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360

Query: 359 VVEDVLSRM 367
           V++D+L ++
Sbjct: 361 VIDDILGKL 369

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/370 (74%), Positives = 319/370 (86%), Gaps = 3/370 (0%)

Query: 1   MLR-ASFTQLARRSYASASKS-LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFID 58
           MLR   +   ARR+  + ++S LTIGLIPGDGIGKEVIPAG++VLE +  K+ + F FID
Sbjct: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60

Query: 59  LQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYA 118
           L AGWQTF +TGKALPDET+ IL+ QCQGALFGAVQSPT KVEGYSSPIVALRK+LGLYA
Sbjct: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120

Query: 119 NVRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNI 177
           N+RPVKSV    +RPVDM+IVRENTEDLYIK E+TYIDE TGT+VAEA KRISE AT+ I
Sbjct: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180

Query: 178 ANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQI 237
           A IAL+IALQR K  G+ATLTVTHKSNVLSQSDGLFREVCR VYE NKD +G++ YNEQI
Sbjct: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240

Query: 238 VDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGS 297
           VDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG D ++GEPCHGS
Sbjct: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300

Query: 298 APDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQ 357
           APDI+G+GISNPVATIRS ALML+F+G+ EAA+DI  AVD N+R   IKTPDLGG S+T 
Sbjct: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360

Query: 358 QVVEDVLSRM 367
           +V +D+LS++
Sbjct: 361 EVTDDILSKL 370

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/368 (75%), Positives = 320/368 (86%), Gaps = 3/368 (0%)

Query: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60
           MLR    QL+ R+Y + SKS TIGLIPGDGIGKEVIP GR+VLE +  K+G+ F +IDLQ
Sbjct: 1   MLRVGRGQLSTRTYVT-SKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQ 59

Query: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTF +TGKALPD+T++ LRN CQGALFGAVQSPT KV+GYSSPIVALRK LGLYAN+
Sbjct: 60  AGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANI 119

Query: 121 RPVKSV-LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIAN 179
           RPVKSV    +RPVD++I RENTEDLYIK+E+TYID++TG RVAEAIKRISE AT+NIAN
Sbjct: 120 RPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIAN 179

Query: 180 IALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVD 239
           IALEIALQR K  G ATLTVTHKSNVLSQSDGLFRE+C+ VY+SNK KF +++YNEQIVD
Sbjct: 180 IALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVD 238

Query: 240 SMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299
           SMVYR+F+EP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVG + V+GEPCHGSAP
Sbjct: 239 SMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAP 298

Query: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQV 359
           DI G+GI+NP+ATIRS AL+LEF+G PEAA+ I K VD N+R+N IKTPDLGG ST +QV
Sbjct: 299 DIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQV 358

Query: 360 VEDVLSRM 367
             D+LSR+
Sbjct: 359 ANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/367 (68%), Positives = 312/367 (85%)

Query: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60
           M R+S T L  ++  + SK+LTIGLIPGDGIGKEVIPAG++VLE +  KH ++F +  L 
Sbjct: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60

Query: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTF ETG ALP  T++ LR +CQGALFGAVQSPT KVEGYSSPIVALR++LGLYAN+
Sbjct: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120

Query: 121 RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180
           RPVKSV    +PVD++IVRENTEDLY++ E+TY+D  TG RVAEAIKRISE AT+ IA I
Sbjct: 121 RPVKSVSGTGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEI 180

Query: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240
           +L +ALQRQ++ G   LTVTHKSNVLSQ+DGLF+EVCR+VYE+NK  +GSI+YNEQIVDS
Sbjct: 181 SLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDS 240

Query: 241 MVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300
           MVYR+F+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG + ++GEPCHGSAPD
Sbjct: 241 MVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPD 300

Query: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVV 360
           IAG+GI+NP+ATIRS +LML+F+G  EAA DI +AV  NL+D  + +PDLGGK+TTQ+V+
Sbjct: 301 IAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVL 360

Query: 361 EDVLSRM 367
           +D+L+R+
Sbjct: 361 DDILARI 367

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  179 bits (453), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 121/380 (31%), Positives = 198/380 (52%), Gaps = 34/380 (8%)

Query: 1   MLRASFTQLARRSYASASKSL---------TIGLIPGDGIGKEVIPAGRQVLENLSSKHG 51
           M R + + + +R YA+  + L         T+ LIPGDGIGKEV  +  Q+ E  +    
Sbjct: 1   MFRNTLSHITKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFE--AENVP 58

Query: 52  LKFDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALR 111
           + ++ ++L A     +E  + +      + RN+    L G   +P ++  G+ S  VA R
Sbjct: 59  VDWESVELSA----LEENHEGVQKAVESLKRNKV--GLKGIWHTPADQT-GHGSLNVAFR 111

Query: 112 KKLGLYANVRPVKS---VLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKR 168
           K+L ++ANV   KS   V  + + VD++I+RENTE  Y     + ++ ++   V E++K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKI 166

Query: 169 ISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKF 228
           +++  ++ IA  A + AL+    N    +   HK+N++   DGLFR     V E    ++
Sbjct: 167 MTKAKSERIARFAFDFALK----NNRKAVCAVHKANIMKLGDGLFRNT---VSEIGAKEY 219

Query: 229 GSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDF 288
             +  +  IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G ++
Sbjct: 220 PEVNVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREY 279

Query: 289 VVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKT 347
            V EP C     DI G+ ++NP A I S+ LML  +G  E A  I +A    + +    T
Sbjct: 280 AVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKRTT 339

Query: 348 PDLGGKSTTQQVVEDVLSRM 367
            D+GG +TT +    V+ ++
Sbjct: 340 KDIGGTATTTEFTNAVIDKL 359

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  176 bits (446), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 127/360 (35%), Positives = 191/360 (53%), Gaps = 32/360 (8%)

Query: 17  ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDE 76
           A+   T+  I GDG+G E+  A + +    ++K  ++++  D+      F      +P  
Sbjct: 32  ATGKYTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWESCDVSP---LFINGLTTIPQP 86

Query: 77  TIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQERP---V 133
             D + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV   +     V
Sbjct: 87  AQDSI-NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNV 143

Query: 134 DMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIA--LQRQKV 191
           D++++RENTE  Y     + I+      V ++IK I++ A++ +   A E A  ++R KV
Sbjct: 144 DLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITQDASERVIRYAFEYARAVERPKV 198

Query: 192 NGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPEC 251
                  V HKS +   +DGLF  V  Q+ +   D    I+   +++D+ V    R+P  
Sbjct: 199 ------VVVHKSTIQRLADGLFVSVAEQLSKEYPD----IELQTELIDNTVLHTVRDPTK 248

Query: 252 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISN 308
           +   V+V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +N
Sbjct: 249 YSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKAN 308

Query: 309 PVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
           P A + S+ +ML  MG  E A  I KAV   +      +T DLGG ++T    E V+SR+
Sbjct: 309 PTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  176 bits (446), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 199/391 (50%), Gaps = 45/391 (11%)

Query: 1   MLRASFTQLARRSYASASKS-----------------LTIGLIPGDGIGKEVIPAGRQVL 43
           M + S  + +RR  ASAS+                   T+  I GDGIG E+  + + + 
Sbjct: 1   MFKQSIFKGSRRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIF 60

Query: 44  ENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGY 103
              ++K  +++++ D+      F      +PD  +  + N+   AL G + +P  K  G+
Sbjct: 61  S--AAKVPVEWEYCDVTP---IFINGLTTIPDPAVQSI-NKNLVALKGPLATPIGK--GH 112

Query: 104 SSPIVALRKKLGLYANVRPVKSV---LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGT 160
            S  + LRK  GL+ANVRP KS+         VD++++RENTE  Y     + I+     
Sbjct: 113 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHVVSP 167

Query: 161 RVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQV 220
            V ++IK I+  A++ +   A E A    +  G   + V HKS +   +DGLF  V ++V
Sbjct: 168 GVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVVVVHKSTIQRLADGLFVNVAQEV 223

Query: 221 YESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLG 277
            +   D    I+   +++D+ V  +  +PE +   V V PNLYGDILSD  + L  GSLG
Sbjct: 224 GKEYPD----IELQPELIDNTVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLG 279

Query: 278 VVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVD 337
           + PSAN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I  AV 
Sbjct: 280 LTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVL 339

Query: 338 ANL-RDNSIKTPDLGGKSTTQQVVEDVLSRM 367
           A +  D   +T DL G +TT    + V+ R+
Sbjct: 340 ATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  176 bits (445), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 202/380 (53%), Gaps = 34/380 (8%)

Query: 1   MLRASFTQLARRSYASASKSL---------TIGLIPGDGIGKEVIPAGRQVLENLSSKHG 51
           MLR +F Q+++R +A AS  L         T+ LIPGDG+GKEV  +   + E  +    
Sbjct: 1   MLRNTFVQISKRRFALASGQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVNIFE--AENVP 58

Query: 52  LKFDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALR 111
           + ++ ++L    +  +   KA+      + RN+    L G   +P ++  G+ S  VA R
Sbjct: 59  IDWESVELSGLEENMEGVQKAVES----LKRNKV--GLKGIWSTPADQT-GHGSLNVAFR 111

Query: 112 KKLGLYANVRPVKS---VLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKR 168
           K+L ++ANV   KS   V  + + VD++I+RENTE  Y     + ++ ++   V E++K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKI 166

Query: 169 ISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKF 228
           +++  ++ IA  A + AL+    N   ++   HK+N++   DGLFR    ++      ++
Sbjct: 167 MTKAKSERIARFAFDFALK----NNRRSVCAVHKANIMKLGDGLFRNTVNEI---GAKEY 219

Query: 229 GSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDF 288
             ++    IVD+   +   +P  FDV+V PNLYG IL +  AAL+GS G+VP AN G ++
Sbjct: 220 PELEVKSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNVGAALIGSPGLVPGANFGREY 279

Query: 289 VVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKT 347
            V EP       DI G+ ++NP A I S+ LML  +G  + A  I KA    + +    T
Sbjct: 280 AVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEGKHTT 339

Query: 348 PDLGGKSTTQQVVEDVLSRM 367
            D+GG ++T Q  + ++ ++
Sbjct: 340 KDIGGHASTTQFTKAIVDKL 359

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  175 bits (444), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 121/355 (34%), Positives = 193/355 (54%), Gaps = 32/355 (9%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDIL 81
           T+  I GDG+G E+  + + +    ++K  ++++  D+      F      +PD  +  +
Sbjct: 37  TVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91

Query: 82  RNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQERP---VDMIIV 138
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+   +     V+++++
Sbjct: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148

Query: 139 RENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIA--LQRQKVNGEAT 196
           RENTE  Y     + I+      V ++IK I++ A++ +   A E A  + R KV     
Sbjct: 149 RENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSKV----- 198

Query: 197 LTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--V 254
             V HKS +   +DGLF +V +++      ++  I+   +++D+ V +  + PE +D  V
Sbjct: 199 -LVVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVV 253

Query: 255 IVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATI 313
           +V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP A +
Sbjct: 254 VVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALL 313

Query: 314 RSTALMLEFMGHPEAAQDIHKAVDANL-RDNSIKTPDLGGKSTTQQVVEDVLSRM 367
            S+ +ML  MG  E A  I KAV   +  D   +T DLGG ++T    + V+ R+
Sbjct: 314 LSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 201/376 (53%), Gaps = 41/376 (10%)

Query: 9   LARRSYASASKS-----------LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDF- 56
           +++RS AS +K+            T+ LIPGDGIGKEV  +  ++     +  GL  D+ 
Sbjct: 6   VSKRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDSVVKIF----ASQGLPIDWE 61

Query: 57  -IDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLG 115
            ID+  G     E  KA+      + RN+    L G   +  ++  GY S  VALRK+L 
Sbjct: 62  RIDV-PGMSNENEVKKAVES----LKRNKI--GLKGIWHTSADQT-GYGSLNVALRKQLD 113

Query: 116 LYANV---RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISET 172
           ++ANV   + +K V  +   VD++++RENTE  Y     + ++ ++   V E++K I++ 
Sbjct: 114 IFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEY-----SGLEHESVPGVVESLKIITKP 168

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIK 232
            T+ IA  A + AL+    N  +T+T  HK+N++  SDGLF+    +V E    ++  IK
Sbjct: 169 KTERIARFAFDFALE----NNRSTVTAVHKANIMKLSDGLFKNTVAEVGEK---EYPDIK 221

Query: 233 YNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGE 292
            N  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G++P AN G +  V E
Sbjct: 222 VNTIIVDNASMQAVAKPHQFDVMVTPSMYGTILGNIGAALIGGPGLIPGANYGREHAVFE 281

Query: 293 P-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLG 351
           P       DI  + I+NP A I S  LML  +G  E ++ I  AV A + +    T D+G
Sbjct: 282 PGSRHVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVIEEGKTTTKDIG 341

Query: 352 GKSTTQQVVEDVLSRM 367
           G ++T +  + V+ ++
Sbjct: 342 GNASTTEFTDAVIDKL 357

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 201/391 (51%), Gaps = 47/391 (12%)

Query: 1   MLRASFTQLARRSYAS---------------ASKSLTIGLIPGDGIGKEVIPAGRQVLEN 45
           M R+ F +   R +A+               A+   T+  I GDG+G E+  A + +   
Sbjct: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA- 59

Query: 46  LSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSS 105
            ++K  ++++  D+      F      +P    D + N+   AL G + +P  K  G+ S
Sbjct: 60  -AAKAPIQWETCDVTP---LFINGLTTIPQPAQDSI-NKNLIALKGPLATPIGK--GHRS 112

Query: 106 PIVALRKKLGLYANVRPVKSVLPQERP---VDMIIVRENTEDLYIKTEKTYIDEKTGTRV 162
             + LRK  GL+ANVRP KS+   +     VD++++RENTE  Y     + I+      V
Sbjct: 113 LNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEY-----SGIEHVVAPGV 167

Query: 163 AEAIKRISETATKNIANIALEIA--LQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQV 220
            ++IK I++ A++ +   A E A  ++R KV       V HKS +   +DGLF  V  ++
Sbjct: 168 VQSIKLITQDASERVIRYAFEYARAVERPKV------LVVHKSTIQRLADGLFVSVAEKL 221

Query: 221 YESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLG 277
            +   D    I+   +++D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG
Sbjct: 222 AKEYPD----IELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLG 277

Query: 278 VVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVD 337
           + PSAN+G +  + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I KAV 
Sbjct: 278 LTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVF 337

Query: 338 ANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
           + +      +T DL G ++T    E V+SR+
Sbjct: 338 STIASGPENRTGDLAGSASTSSFAEAVISRL 368

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  169 bits (429), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 120/359 (33%), Positives = 187/359 (52%), Gaps = 30/359 (8%)

Query: 17  ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDE 76
           A+   T+  I GDG+G E+  + +++     S   +  +++    G   F      +P+ 
Sbjct: 32  ATGKFTVPFIEGDGVGPEISESVKKIF----SAAKVPIEWVPCDVG-PIFVNGQTTIPEP 86

Query: 77  TIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQERP---- 132
            ++++ N+   AL G + +P  K  G+ S  + LRK   L+ANVRP +S+ P  +     
Sbjct: 87  AVELI-NKHLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSI-PNYKSTYEN 142

Query: 133 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVN 192
           VD++++RENTE  Y     + I+      V ++IK I+  AT+ +   A E      +  
Sbjct: 143 VDLVLIRENTEGEY-----SGIEHVITPGVIQSIKLITREATERVVRYAFEYT----QAI 193

Query: 193 GEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECF 252
           G   L V HKS +   +DGLF +V  ++     D    IK   +I+D  +  +  +PE +
Sbjct: 194 GRPRLLVIHKSTIQRMADGLFVKVAEELASEYPD----IKLETEIIDKSILNVVSKPELY 249

Query: 253 D--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNP 309
              V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP
Sbjct: 250 SDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANP 309

Query: 310 VATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNS-IKTPDLGGKSTTQQVVEDVLSRM 367
            A + S+ +ML+ MG  E A  I  AV   +   S  +T DL G ++T    E+V+ R+
Sbjct: 310 TALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  169 bits (429), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/374 (32%), Positives = 207/374 (55%), Gaps = 37/374 (9%)

Query: 9   LARRSYASASKS-----------LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           +A+R+ A+A+++            T+ LIPGDG+GKE+  + R + E  + +  + ++ I
Sbjct: 6   IAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFE--AERIPVDWETI 63

Query: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           +++   QT  + G     E++   RN+    L G   +P ++  G+ S  VALRK+L +Y
Sbjct: 64  NIK---QTDHKEGVYEAVESLK--RNKI--GLKGLWHTPADQT-GHGSLNVALRKQLDIY 115

Query: 118 ANV---RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETAT 174
           ANV   + +K V  +   +D+I++RENTE      E + ++ ++   V E++K +++  T
Sbjct: 116 ANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESLKVMTKPKT 170

Query: 175 KNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYN 234
           + IA  A + A   +K N +A +T  HK+N++   DGLFR +  ++ ++   ++  I  +
Sbjct: 171 ERIARFAFDFA---KKYNRKA-VTAVHKANIMKLGDGLFRNIITEIGQT---EYPDIDVS 223

Query: 235 EQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP- 293
             IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D+ V EP 
Sbjct: 224 SIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPG 283

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGK 353
                 DI G+ ++NP A I S+ LML  +G  E A  I KAV   + +    T D+GG 
Sbjct: 284 SRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKHTTRDIGGS 343

Query: 354 STTQQVVEDVLSRM 367
           S+T     +V++++
Sbjct: 344 SSTTDFTNEVINKL 357

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  169 bits (428), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 128/391 (32%), Positives = 193/391 (49%), Gaps = 46/391 (11%)

Query: 1   MLRASFTQLARRSYASASKSLTIG----------------LIPGDGIGKEVIPAGRQVLE 44
           MLR +F +   R + S  K  +IG                 I GDGIG E+  + +++  
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 45  NLSSKHGLKFDFIDLQAGWQTFQETGKALPDETI-DILRNQCQGALFGAVQSPTNKVEGY 103
             ++   + ++F D+      F      +PD  +  I +N    AL G + +P  K  G+
Sbjct: 61  --AADVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111

Query: 104 SSPIVALRKKLGLYANVRPVKSV---LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGT 160
            S  + LRK  GL+ANVRP KS+         VD++++RENTE  Y     + I+     
Sbjct: 112 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCP 166

Query: 161 RVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQV 220
            V ++IK I+  A++ +   A E A    +  G   + V HKS +   +DGLF  V +++
Sbjct: 167 GVVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKEL 222

Query: 221 YESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLG 277
            +   D    I +  +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG
Sbjct: 223 SKEYPD----ITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLG 278

Query: 278 VVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVD 337
           + PSAN+G    + E  HGSAPDIAGK  +NP A + S+ +ML  MG    A  I  AV 
Sbjct: 279 LTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVL 338

Query: 338 ANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
           + +      +T DL G +TT    E V+ R+
Sbjct: 339 STIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  169 bits (427), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 132/394 (33%), Positives = 198/394 (50%), Gaps = 54/394 (13%)

Query: 1   MLRASFTQLARRSYAS--------------ASKSLTIGLIPGDGIGKEVIPAGRQVLENL 46
           MLR    Q +RR  AS              A+   T+  I GDG+G E+  + + +    
Sbjct: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60

Query: 47  SSKHGLKFDFID----LQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEG 102
           S    +++++ D    L  G  T  E   A       I +N    AL G + +P  K  G
Sbjct: 61  SVP--VEWEYCDVTPLLVNGLTTIPEPAVA------SINKNLV--ALKGPLATPIGK--G 108

Query: 103 YSSPIVALRKKLGLYANVRPVKSVLPQERP---VDMIIVRENTEDLYIKTEKTYIDEKTG 159
           + S  + LRK  GL+ANVRP KS+   +     VD++++RENTE  Y     + I+    
Sbjct: 109 HRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEY-----SGIEHVVS 163

Query: 160 TRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQ 219
             V ++IK I+  A++ +   A E A    +  G   + V HKS +   +DGLF  V ++
Sbjct: 164 PGVVQSIKLITREASERVIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQE 219

Query: 220 VYESNKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVA--PNLYGDILSDGAAAL-VGSL 276
           +     D    I+   +++D+ V  +  +PE +  +VA  PNLYGDILSD  + L  GSL
Sbjct: 220 LGREYPD----IELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSL 275

Query: 277 GVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAV 336
           G+ PSAN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I KAV
Sbjct: 276 GLTPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAV 335

Query: 337 DANL---RDNSIKTPDLGGKSTTQQVVEDVLSRM 367
            + +   R+N  +T DL G ++T      V+ R+
Sbjct: 336 LSTIASSREN--RTADLAGTASTSSFTNAVIERL 367

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  168 bits (426), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 189/354 (53%), Gaps = 28/354 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDI 80
            T+  I GDG+G E+  + + + +  +++  + +++ D+         T   +P+  +  
Sbjct: 41  FTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQ 95

Query: 81  LRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQE---RPVDMII 137
           + N+ + AL G + +P  K  G+ S  + LRK  GL+ANVRP +S+   E   + VD+++
Sbjct: 96  I-NKHKIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152

Query: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATL 197
           +RENTE  Y     + I+      V ++IK I+  A++ +   A E A    +  G   L
Sbjct: 153 IRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203

Query: 198 TVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VI 255
            V HKS +   +DGLF  + +++      +F  IK   +++D+ V  + R+P  +   V 
Sbjct: 204 VVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVT 259

Query: 256 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIR 314
           V PNLYGDILSD  + L  GSLG+ PSAN+G +  + E  HGSAPDIAG+  +NP A + 
Sbjct: 260 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319

Query: 315 STALMLEFMGHPEAAQDIHKAVDANLRDNS-IKTPDLGGKSTTQQVVEDVLSRM 367
           S+ +ML +MG    +  I  A+   +   S  +T DL G +TT    E V+  +
Sbjct: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  168 bits (425), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 127/390 (32%), Positives = 190/390 (48%), Gaps = 54/390 (13%)

Query: 5   SFTQLARRSYASASKSL--------------TIGLIPGDGIGKEVIPAGRQVLENLSSKH 50
           SF   ARR  A+A  S+              T+  I GDGIG E+  + +++        
Sbjct: 6   SFRLNARRFLATAQPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRI-------- 57

Query: 51  GLKFDFIDLQAGWQT------FQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYS 104
              F   D+   W+T      F      +PD  +  + N+   AL G + +P  K  G+ 
Sbjct: 58  ---FQAADVPVEWETCDVTPIFVNGLTTIPDPAVQSI-NKNLVALKGPLATPIGK--GHR 111

Query: 105 SPIVALRKKLGLYANVRPVKSV---LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTR 161
           S  + LRK   L+ANVRP KS+         VD++++RENTE  Y     + I+      
Sbjct: 112 SLNLTLRKTFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHLVSPG 166

Query: 162 VAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY 221
           V ++IK I+  A++ +   A E A    +  G   L V HKS +   +DGLF  V +++ 
Sbjct: 167 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLIVVHKSTIQRLADGLFVNVAKELA 222

Query: 222 ESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGV 278
               D    I+   +++D+    +   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 223 AEYPD----IQLETELIDNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGL 278

Query: 279 VPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDA 338
            PSAN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I KAV  
Sbjct: 279 TPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLG 338

Query: 339 NLRDNS-IKTPDLGGKSTTQQVVEDVLSRM 367
            +   S  +T DLGG ++T    + ++ ++
Sbjct: 339 TIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  167 bits (424), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 118/374 (31%), Positives = 205/374 (54%), Gaps = 37/374 (9%)

Query: 9   LARRSYASASKS-----------LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           +A+R+ A+A+++            T+ LIPGDG+GKE+  + + + E  + K  + ++ +
Sbjct: 6   IAKRTLATAAQAERALPKKYGGRFTVTLIPGDGVGKEITDSVKTIFE--AEKIPVDWETV 63

Query: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           +++   QT  + G     E++   RN+    L G   +P ++  G+ S  VALRK+L +Y
Sbjct: 64  NIK---QTDHKEGVYEAVESLK--RNKI--GLKGLWHTPADQT-GHGSLNVALRKQLDIY 115

Query: 118 ANV---RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETAT 174
           ANV   + +K V  +   +D+I++RENTE      E + ++ ++   V E++K ++   T
Sbjct: 116 ANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESLKIMTRPKT 170

Query: 175 KNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYN 234
           + IA  A + A   +K N +A +T  HK+N++   DGLFR +  ++    + ++  I  +
Sbjct: 171 ERIARFAFDFA---KKYNRKA-VTAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVS 223

Query: 235 EQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP- 293
             IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D+ V EP 
Sbjct: 224 SIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPG 283

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGK 353
                 DI G+ ++NP A I S+ LML  +G  E A  I KAV   + +    T D+GG 
Sbjct: 284 SRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGS 343

Query: 354 STTQQVVEDVLSRM 367
           S+T     ++++++
Sbjct: 344 SSTTDFTNEIINKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  167 bits (423), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 199/377 (52%), Gaps = 43/377 (11%)

Query: 9   LARRSYASASKS-----------LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           +A+R+ A+A+++            T+ LIPGDG+GKE+  + R +           F+  
Sbjct: 6   IAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTI-----------FEAE 54

Query: 58  DLQAGWQTF---QETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKL 114
           ++   W+T    Q   K    E ++ L+    G L G   +P ++  G+ S  VALRK+L
Sbjct: 55  NIPIDWETINIKQTDHKEGVYEAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQL 112

Query: 115 GLYANV---RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISE 171
            +YANV   + +K V  +   +D+I++RENTE      E + ++ ++   V E++K ++ 
Sbjct: 113 DIYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESLKVMTR 167

Query: 172 TATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSI 231
             T+ IA  A + A   +K N   ++T  HK+N++   DGLFR +  ++    + ++  I
Sbjct: 168 PKTERIARFAFDFA---KKYN-RKSVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDI 220

Query: 232 KYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVG 291
             +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D+ V 
Sbjct: 221 DVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVF 280

Query: 292 EP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDL 350
           EP       DI G+ ++NP A I S+ LML  +G  E A  I KAV   + +    T D+
Sbjct: 281 EPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDI 340

Query: 351 GGKSTTQQVVEDVLSRM 367
           GG S+T     ++++++
Sbjct: 341 GGSSSTTDFTNEIINKL 357

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  167 bits (423), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 127/391 (32%), Positives = 200/391 (51%), Gaps = 47/391 (12%)

Query: 1   MLRASFTQLARRSYASASKS-----------------LTIGLIPGDGIGKEVIPAGRQVL 43
           +LR SFT  ARR  A++ K+                   +  I GDGIG E+  + + + 
Sbjct: 6   LLRNSFT--ARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIF 63

Query: 44  ENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGY 103
           +  +++  + ++F D+      F      +PD  +  + N+   AL G + +P  K  G+
Sbjct: 64  K--AAEVPINWEFCDVT---PIFVNGLTTIPDPAVASI-NKNLIALKGPLATPIGK--GH 115

Query: 104 SSPIVALRKKLGLYANVRPVKSV---LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGT 160
            S  + LRK   L+ANVRP KS+         VD++++RENTE  Y     + I+     
Sbjct: 116 RSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEY-----SGIEHVVAP 170

Query: 161 RVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQV 220
            V ++IK I+  A++ +   A E A    K  G   + V HKS +   +DGLF  V +++
Sbjct: 171 GVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVVVHKSTIQRLADGLFVNVAKEL 226

Query: 221 YESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLG 277
            +    ++  IK   +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG
Sbjct: 227 SK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLG 282

Query: 278 VVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVD 337
           + PSAN+G +  + E  HGSAPDIAG+  +NP A + S+ +ML  MG  + A  I +AV 
Sbjct: 283 LTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVL 342

Query: 338 ANLRDNSI-KTPDLGGKSTTQQVVEDVLSRM 367
             +  +S  +T DLGG +TT    + V+  +
Sbjct: 343 TTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  167 bits (423), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 120/354 (33%), Positives = 188/354 (53%), Gaps = 28/354 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDI 80
            T+  I GDGIG E+  + +Q+ +  ++K  + ++  D+      F      +P+  +  
Sbjct: 37  FTVSFIEGDGIGPEISQSVKQIFD--AAKVPIDWEPCDVSP---LFINGLTTIPEPAVQS 91

Query: 81  LRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQER---PVDMII 137
           + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+   +     VD++I
Sbjct: 92  I-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148

Query: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATL 197
           +RENTE  Y     + I+      V ++IK I+  A++ +   A E A    +  G   +
Sbjct: 149 IRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRV 199

Query: 198 TVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VI 255
            V HKS +   +DGLF +V +++ +   D    I+   +++D+ V  +   P  +   V 
Sbjct: 200 IVVHKSTIQRLADGLFVDVAKELSQEYPD----IQLETELIDNTVLNVVSNPSSYSNAVS 255

Query: 256 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIR 314
           V PNLYGDILSD  + L  GSLG+ PSAN+G +  + E  HGSAPDIAG+  +NP A + 
Sbjct: 256 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315

Query: 315 STALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
           S+ +ML  MG    A  I KAV + +      +T DL GK+TT    + V+ R+
Sbjct: 316 SSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  168 bits (425), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 118/353 (33%), Positives = 188/353 (53%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDIL 81
           T+  I GDGIG E+  + +Q+    ++K  ++++  D+      F +    +P+  +  +
Sbjct: 91  TVSFIEGDGIGPEISNSVKQIFS--AAKVPIEWETCDVTP---LFIDGLTTIPEPAVQSI 145

Query: 82  RNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV--LPQERP-VDMIIV 138
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP +SV       P VD++++
Sbjct: 146 -NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202

Query: 139 RENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLT 198
           RENTE  Y     + I+      V ++IK I+  A++ +   A E      +  G   L 
Sbjct: 203 RENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEYC----RAIGRPRLV 253

Query: 199 VTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIV 256
           V HKS +   SDGLF  V +++ +   D    I++  +++D+ V ++   P  +   V V
Sbjct: 254 VVHKSTIQRLSDGLFVNVAKELSKEYPD----IQFETELIDNTVLKVVSNPSSYTDAVSV 309

Query: 257 APNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRS 315
            PNLYGDILSD  + L  GSLG+ PS N+G +  + E  HGSAPDIAGK ++NP A + S
Sbjct: 310 CPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369

Query: 316 TALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
           + +ML  MG  + A  I  AV + +      +T DL G +TT    + V+ ++
Sbjct: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  167 bits (422), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 185/366 (50%), Gaps = 42/366 (11%)

Query: 16  SASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQ------TFQET 69
           ++S + T+  I GDG+G E+  + + +           F   ++   WQ       F   
Sbjct: 39  NSSGTYTVPFIEGDGVGPEISKSVKDI-----------FSAANVPIQWQPCDVGPIFVNG 87

Query: 70  GKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQ 129
              +P+  +  ++     AL G + +P  K  G+ S  + LRK   L+ANVRP KSV P 
Sbjct: 88  LTTIPEPAVKAIKESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAKSV-PN 143

Query: 130 ERP----VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIA 185
            +     VD++++RENTE  Y     + I+      V ++IK I+  A++ +   A E A
Sbjct: 144 YKSTYENVDLVLIRENTEGEY-----SGIEHIVTPGVVQSIKLITREASEKVIRYAYEYA 198

Query: 186 LQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRM 245
           +      G   L V HKS +    DGLF ++  ++    + ++ SIK   QI+D+ V  +
Sbjct: 199 IAV----GRPRLIVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQILDNTVLNV 250

Query: 246 FREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIA 302
              P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIA
Sbjct: 251 VSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIA 310

Query: 303 GKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVE 361
           G+  +NP A + S+ +ML  MG  E A  I  AV + +      +T DLGG +TT    E
Sbjct: 311 GQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTE 370

Query: 362 DVLSRM 367
            V+ ++
Sbjct: 371 CVIKKL 376

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  166 bits (421), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 127/391 (32%), Positives = 194/391 (49%), Gaps = 46/391 (11%)

Query: 1   MLRASFTQLARRSYASASKSLTIG----------------LIPGDGIGKEVIPAGRQVLE 44
           MLR +F +   R + +  K  +IG                 I GDGIG E+  + +++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 45  NLSSKHGLKFDFIDLQAGWQTFQETGKALPDETI-DILRNQCQGALFGAVQSPTNKVEGY 103
             ++   ++++F D+      F      +PD  +  I +N    AL G + +P  K  G+
Sbjct: 61  --AANVPIEWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111

Query: 104 SSPIVALRKKLGLYANVRPVKSV---LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGT 160
            S  + LRK  GL+ANVRP KSV         VD++++RENTE  Y     + I+     
Sbjct: 112 RSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCP 166

Query: 161 RVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQV 220
            V ++IK I+  A++ +   A E A    +  G   + V HKS +   +DGLF  V +++
Sbjct: 167 GVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL 222

Query: 221 YESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLG 277
            +   D    I    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG
Sbjct: 223 SKEYPD----ITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLG 278

Query: 278 VVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVD 337
           + PSAN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG    A  I  AV 
Sbjct: 279 LTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVL 338

Query: 338 ANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
           + +      +T DL G +TT    E V+ R+
Sbjct: 339 STIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  166 bits (421), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 122/364 (33%), Positives = 184/364 (50%), Gaps = 38/364 (10%)

Query: 17  ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQT------FQETG 70
           A+   T+  I GDGIG E+  + + + +  S           +   W+T        +  
Sbjct: 40  ATGKYTVSFIEGDGIGPEISRSVKDIFQAAS-----------VPITWETCDVSPILVDGL 88

Query: 71  KALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQE 130
             +PDE +  +     G L G + +P  K  G+ S  + LRK   L+ANVRP KSV   +
Sbjct: 89  TTIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFK 145

Query: 131 RP---VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQ 187
                VD++++RENTE  Y     + I+      V ++IK I+  A++ +   A E A  
Sbjct: 146 TTYDNVDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA-- 198

Query: 188 RQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFR 247
             K  G   + V HKS +   SDGLF  V +++ +  +  F +I+ + +++D+ V  +  
Sbjct: 199 --KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVM 254

Query: 248 EPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGK 304
            P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+
Sbjct: 255 NPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQ 314

Query: 305 GISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSI-KTPDLGGKSTTQQVVEDV 363
             +NP A + S+ +ML  MG  E    I  AV   +  +S  +T DLGG +TT    E V
Sbjct: 315 NKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374

Query: 364 LSRM 367
           +  +
Sbjct: 375 IDNL 378

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  166 bits (419), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 200/385 (51%), Gaps = 46/385 (11%)

Query: 1   MLRASFTQLARRSYASASKSL---------TIGLIPGDGIGKEVIPAGRQVLENLSSKHG 51
           MLR  F  +++RS A+ ++ L         T+ LIPGDG+GKEV  +   + E+      
Sbjct: 1   MLRNGFG-ISKRSLATVAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESE----- 54

Query: 52  LKFDFIDLQAGWQTFQETGKALPDE-----TIDILRNQCQGALFGAVQSPTNKVEGYSSP 106
                 ++   W+T + +G  L +E      +D L+    G L G   +P+++  G+ S 
Sbjct: 55  ------NVPIDWETVEISG--LDNEEGVQKAVDSLKRNKVG-LKGIWHTPSDQT-GHGSL 104

Query: 107 IVALRKKLGLYANVRPVKSV--LPQERP-VDMIIVRENTEDLYIKTEKTYIDEKTGTRVA 163
            VALRK+L ++ANV   K+V  +P     VD++++RENTE  Y     + ++ ++   V 
Sbjct: 105 NVALRKQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEY-----SGLEHESVPGVV 159

Query: 164 EAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYES 223
           E++K +++  +  I   A + AL+    N   ++   HK+N++   DGLFR    ++   
Sbjct: 160 ESLKIMTKAKSDRIGRFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRNCINEI--- 212

Query: 224 NKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSAN 283
              ++  I+    IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN
Sbjct: 213 GAKEYPEIEVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGAN 272

Query: 284 VGFDFVVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRD 342
            G +F V EP       DI G+ ++NP A I S+ALML  +G    A  I KA    + +
Sbjct: 273 FGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAE 332

Query: 343 NSIKTPDLGGKSTTQQVVEDVLSRM 367
               T D+GG ++T    + ++ ++
Sbjct: 333 AKNTTKDIGGSASTTDFTQAIIEKL 357

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  166 bits (419), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 182/359 (50%), Gaps = 40/359 (11%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQT------FQETGKALPD 75
           T+  I GDG+G E+  + + +           F   ++   W++      F      +P 
Sbjct: 38  TVSFIEGDGVGPEISKSVKDI-----------FAAAEVPVEWESCDVTPLFINGLTTIPQ 86

Query: 76  ETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LPQERP 132
             +D + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV         
Sbjct: 87  PAVDSI-NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYEN 143

Query: 133 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVN 192
           VD++++RENTE  Y     + I+      V ++IK I+  A++ +   A E A    +  
Sbjct: 144 VDLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERVIRYAFEYA----RAV 194

Query: 193 GEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECF 252
           G   + V HKS +   +DGLF +V +++      ++  I+   Q++D+ V  +   P  +
Sbjct: 195 GRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAY 250

Query: 253 --DVIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNP 309
              V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP
Sbjct: 251 ADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANP 310

Query: 310 VATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
            A + S+ +ML  MG  E A  I KAV + +      +T DL G ++T    E V+ R+
Sbjct: 311 TALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  164 bits (415), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 128/381 (33%), Positives = 199/381 (52%), Gaps = 37/381 (9%)

Query: 1   MLRASFTQLARRSYASASKSL--------TIGLIPGDGIGKEVIPAGRQVLE--NLSSKH 50
           MLR++  +    S A+A K L         + LIPGDG+GKEV  +   + E  NL    
Sbjct: 1   MLRSAVGKRMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLP--- 57

Query: 51  GLKFDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVAL 110
            + +D +D+       +E  +A  D    + RN+    L G   +      G  S  VAL
Sbjct: 58  -IDWDRVDISG--LDHEEGVQAAVDS---LKRNKI--GLKGIWHTSAADQAGKGSLNVAL 109

Query: 111 RKKLGLYANVRPVKSV--LPQERP-VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIK 167
           RK+L +YANV   KSV  +  + P VD++++RENTE  Y     + ++ ++   V E++K
Sbjct: 110 RKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEY-----SGLEHESVPGVVESLK 164

Query: 168 RISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDK 227
            ++E  T+ IA  A + A   +K N  A +T  HK+N++   DGLFR V  +V E    +
Sbjct: 165 IMTEDKTERIARFAFDFA---KKYNRHA-VTAVHKANIMKLGDGLFRNVVTRVGEQ---E 217

Query: 228 FGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD 287
           +  +K    IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +
Sbjct: 218 YPDVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGRE 277

Query: 288 FVVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIK 346
           + V EP       DI  K I+NP A I S +LML+ +G   +A  I  AV   + +    
Sbjct: 278 YAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEGKST 337

Query: 347 TPDLGGKSTTQQVVEDVLSRM 367
           TPD+GG ++T +  + V+ ++
Sbjct: 338 TPDIGGSASTTEFTQAVIEKL 358

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 201/385 (52%), Gaps = 45/385 (11%)

Query: 1   MLRASFTQLARRSYAS-ASKSL---------TIGLIPGDGIGKEVIPAGRQVLENLSSKH 50
           MLR+    +++RS A+ A++ L         T+ LIPGDG+GKEV  +   + E+     
Sbjct: 1   MLRSGLG-VSKRSLATMAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESE---- 55

Query: 51  GLKFDFIDLQAGWQTFQETG----KALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSP 106
                  ++   W+T + +G    + +      + RN+    L G   +P+++  G+ S 
Sbjct: 56  -------NIPIDWETVEISGLDNQEGVQKAVESLKRNKV--GLKGIWHTPSDQT-GHGSL 105

Query: 107 IVALRKKLGLYANVRPVKSV--LPQERP-VDMIIVRENTEDLYIKTEKTYIDEKTGTRVA 163
            VALRK+L ++ANV   KSV  +P     VDM+++RENTE  Y     + ++ ++   V 
Sbjct: 106 NVALRKQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEY-----SGLEHESVPGVV 160

Query: 164 EAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYES 223
           E++K +++  ++ I   A + A++    N   ++   HK+N++   DGLFR    +V   
Sbjct: 161 ESLKIMTKAKSERIGRFAFDFAVK----NNRKSVCAVHKANIMKLGDGLFRNCINEV--- 213

Query: 224 NKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSAN 283
              ++  I     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN
Sbjct: 214 GAKEYPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGAN 273

Query: 284 VGFDFVVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRD 342
            G ++ V EP       DI G+ ++NP A I S++LML  +G    A  I KA    + +
Sbjct: 274 FGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAE 333

Query: 343 NSIKTPDLGGKSTTQQVVEDVLSRM 367
               T D+GG ++T +  E ++S++
Sbjct: 334 AKTTTQDIGGSASTTEFTEAIISKL 358

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 180/359 (50%), Gaps = 40/359 (11%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQT------FQETGKALPD 75
           T+  I GDGIG E+  + +++           F+  ++   W++      F      +PD
Sbjct: 38  TVSFIEGDGIGPEISKSVKKI-----------FNAANVPIEWESCDVNPIFVNGLTTIPD 86

Query: 76  ETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LPQERP 132
             +  + N    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV         
Sbjct: 87  AAVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYEN 143

Query: 133 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVN 192
           VD++++RENTE  Y     + I+      V ++IK I+  A++ +   A E A    +  
Sbjct: 144 VDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAI 194

Query: 193 GEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECF 252
           G   + V HKS +   +DGLF  V +++ +   D    I    +++D+ V ++   P  +
Sbjct: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPD----IILETELIDNSVLKVVTNPSAY 250

Query: 253 D--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNP 309
              V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP
Sbjct: 251 TNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANP 310

Query: 310 VATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
            A + S+ +ML  MG    A  I  AV + +      +T DL G +TT    E V+ R+
Sbjct: 311 TALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  163 bits (413), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 197/385 (51%), Gaps = 45/385 (11%)

Query: 1   MLRASFTQLARRSYAS-ASKSL---------TIGLIPGDGIGKEVIPAGRQVLENLSSKH 50
           M R +F  +++RS A+ A++ L         T+ LIPGDG+GKEV  +   +        
Sbjct: 1   MFRNTFA-VSKRSLATVATEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSI-------- 51

Query: 51  GLKFDFIDLQAGWQTFQETG----KALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSP 106
              F+  ++   W+T   TG    + +      + RN+    L G   +P ++  G+ S 
Sbjct: 52  ---FEAENVPIDWETINITGVDSEEGVQKAVESLKRNKI--GLKGIWHTPADQT-GHGSL 105

Query: 107 IVALRKKLGLYANV---RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVA 163
            VA RK+L ++ANV   + V  V  +   +D++++RENTE  Y     + ++ ++   V 
Sbjct: 106 NVAFRKQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEY-----SGLEHESVPGVV 160

Query: 164 EAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYES 223
           E++K I++  ++ IA  A + AL+    N   ++   HK+N++   DGLFR    +V  S
Sbjct: 161 ESLKIITKAKSERIARFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRNTVNEVGAS 216

Query: 224 NKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSAN 283
              ++  I     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN
Sbjct: 217 ---EYPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGAN 273

Query: 284 VGFDFVVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRD 342
            G ++ V EP       DI GK ++NP A I S+ LML  +G    A  I KA    + +
Sbjct: 274 FGREYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAE 333

Query: 343 NSIKTPDLGGKSTTQQVVEDVLSRM 367
               T D+GG S+T +  + V+ ++
Sbjct: 334 GKHTTKDIGGSSSTTEFTKSVIDKL 358

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  162 bits (410), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 111/350 (31%), Positives = 187/350 (53%), Gaps = 26/350 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDIL 81
           T+ LIPGDG+GKEV  +  ++ EN +    + ++ ID+ +G +  +   +A+      + 
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFENENIP--IDWETIDI-SGLENTENVQRAVES----LK 83

Query: 82  RNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKS---VLPQERPVDMIIV 138
           RN+    L G   +P ++  G+ S  VALRK+L ++ANV   KS   V  +   +DM+I+
Sbjct: 84  RNKV--GLKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVII 140

Query: 139 RENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLT 198
           RENTE  Y     + ++ ++   V E++K ++   ++ IA  A + AL+    N   ++ 
Sbjct: 141 RENTEGEY-----SGLEHESVPGVVESLKIMTRAKSERIARFAFDFALK----NNRKSVC 191

Query: 199 VTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVAP 258
             HK+N++   DGLFR    ++     +++  +     IVD+   +   +P  FDV+V P
Sbjct: 192 AVHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 259 NLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATIRSTA 317
           NLYG IL +  +AL+G  G+VP AN G ++ V EP       DI G+ ++NP A I S+ 
Sbjct: 249 NLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 308

Query: 318 LMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVVEDVLSRM 367
           LML  +G    A  I KA    + +    T D+GG ++T +    V+ ++
Sbjct: 309 LMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  162 bits (410), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 188/354 (53%), Gaps = 30/354 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDIL 81
           T+  I GDG+G E+  + + +    ++K  ++++  D+      F      +PD  +  +
Sbjct: 37  TVPFIEGDGVGPEISKSVKDIFA--AAKVPIEWEPCDV---GPIFVNGLTTIPDAAVQSI 91

Query: 82  RNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQERP----VDMII 137
            N+   AL G + +P  K  G+ S  + LRK   L+ANVRP +SV P  +     VD+++
Sbjct: 92  -NKHLVALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSV-PNYKTTYQNVDLVL 147

Query: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATL 197
           +RENTE  Y     + I+      V ++IK I++ A++ +    +  A +  +  G   L
Sbjct: 148 IRENTEGEY-----SGIEHVISPGVIQSIKLITKDASERV----IRYAFEYTRAIGRPRL 198

Query: 198 TVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VI 255
            V HKS +   +DGLF  V +++      ++  I+   +++D+ +  +   PE +   V 
Sbjct: 199 VVVHKSTIQRMADGLFVNVAKEL----ASEYPDIELQTELIDNTILNVVTHPESYTDAVS 254

Query: 256 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIR 314
           V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP A + 
Sbjct: 255 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 315 STALMLEFMGHPEAAQDIHKAVDANLRDNS-IKTPDLGGKSTTQQVVEDVLSRM 367
           S+ +ML  MG  E A  I  A+ + +   S  +T DL G +TT    E V++++
Sbjct: 315 SSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  162 bits (410), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 117/354 (33%), Positives = 185/354 (52%), Gaps = 31/354 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQ-ETGKALPDETIDI 80
           T+  I GDG+G E+  + R + +       +  D+++   G      ET   +P   +D 
Sbjct: 46  TVPFIEGDGVGPEISKSVRTIFK----AAKVPIDWVNCDIGPLLINGET--TIPQTAVDQ 99

Query: 81  LRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LPQERPVDMII 137
           + N    AL G + +P    +G+ S  + LRK  GL+ANVRP KS+         VD+I+
Sbjct: 100 INNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLIV 156

Query: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATL 197
           +RENTE  Y     + I+ +    V ++IK I+  A++ +    ++ A +  +  G + L
Sbjct: 157 IRENTEGEY-----SGIEHEIVPGVVQSIKLITRKASEKV----IKYAFEYTRSIGRSNL 207

Query: 198 TVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECF--DVI 255
            V HK+ +  + DGLF +  +++     DK+  +    +++D+ V      PE +   V 
Sbjct: 208 IVVHKATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEKYADSVS 263

Query: 256 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIR 314
           V PNLYGDILSD  + L  GSLG+ PSAN+G + V+ E  HGSAPDIAG+  +NP A + 
Sbjct: 264 VCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTALLL 322

Query: 315 STALMLEFMGHPEAAQDIHKAVDANLRD-NSIKTPDLGGKSTTQQVVEDVLSRM 367
           S+ +ML  MG  + A  I  AV   +      +T DLGG +TT    + V+  +
Sbjct: 323 SSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  162 bits (409), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 179/359 (49%), Gaps = 40/359 (11%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETG------KALPD 75
           T+  I GDG+G E+  + + +           F    +   W++   T         +P+
Sbjct: 40  TVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVTPLLVNGVTTIPE 88

Query: 76  ETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LPQERP 132
           +  + + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV         
Sbjct: 89  QAQESI-NRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYED 145

Query: 133 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVN 192
           VD++++RENTE  Y   E   +       V ++IK I+  A++ +   A E A    +  
Sbjct: 146 VDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAV 196

Query: 193 GEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECF 252
           G   L V HKS +   +DGLF  V +++      +F  I+   +++D+ V  +   P  +
Sbjct: 197 GRPKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKY 252

Query: 253 D--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNP 309
              V V PNLYGDILSD  + L  GSLG+ PS N+G    + E  HGSAPDIAG+  +NP
Sbjct: 253 SDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANP 312

Query: 310 VATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
            A + S+ +ML  MG  E A  I KAV   +      +T DL G ++T    E V+SR+
Sbjct: 313 TALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  161 bits (408), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 111/351 (31%), Positives = 194/351 (55%), Gaps = 26/351 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDI 80
            T+ L+PGDG+GKE+  +   + +  S    + ++ +D+     T  E  KA  D    +
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSIFK--SENVPIDWETVDISGLDHT--EGVKAAVDS---L 80

Query: 81  LRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV--LPQERP-VDMII 137
            RN+    L G   +P ++V G+ S  VA RK+L +YANV   KS+  +  + P VD+++
Sbjct: 81  KRNKI--GLKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATL 197
           +RENTE  Y     + ++ ++   V E++K I+++ ++ IA  A + A    K N   ++
Sbjct: 138 IRENTEGEY-----SGLEHESVPGVVESLKIITKSKSERIARFAFDFA----KRNNRKSV 188

Query: 198 TVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVA 257
           T  HK+N++  SDGLFR    ++ E   +++  I+ +  IVD+   +   +P  FDV+V 
Sbjct: 189 TAVHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFDVMVT 245

Query: 258 PNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATIRST 316
           P++YG I+ +  AAL+G  G+VP  N G D+ V EP       DI G+ ++NP A + S 
Sbjct: 246 PSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSA 305

Query: 317 ALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVVEDVLSRM 367
            L+L+ +G  ++A  I  AV   + +    T D+GG ++T +  + V++++
Sbjct: 306 TLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 125/397 (31%), Positives = 191/397 (48%), Gaps = 58/397 (14%)

Query: 1   MLRASFTQLARRSYASASKSLTIG----------------LIPGDGIGKEVIPAGRQVLE 44
           MLR +F +   R + +  K  +IG                 I GDGIG E+  + +++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKI-- 58

Query: 45  NLSSKHGLKFDFIDLQAGWQT------FQETGKALPDETI-DILRNQCQGALFGAVQSPT 97
                    F   ++   W++      F      +PD  +  I +N    AL G + +P 
Sbjct: 59  ---------FSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLV--ALKGPLATPI 107

Query: 98  NKVEGYSSPIVALRKKLGLYANVRPVKSV---LPQERPVDMIIVRENTEDLYIKTEKTYI 154
            K  G+ S  + LRK  GL+ANVRP KS+         VD++++RENTE  Y     + I
Sbjct: 108 GK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGI 160

Query: 155 DEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFR 214
           +      V ++IK I+  A++ +   A E A    +  G   + V HKS +   +DGLF 
Sbjct: 161 EHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFV 216

Query: 215 EVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAAL 272
            V +++ +   D    +    +++D+ V ++   P  +   V V PNLYGDILSD  + L
Sbjct: 217 NVAKELSKEYPD----LTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGL 272

Query: 273 -VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQD 331
             GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG    A  
Sbjct: 273 SAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQ 332

Query: 332 IHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
           I  AV + +      +T DL G +TT    E V+ R+
Sbjct: 333 IQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  161 bits (407), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/361 (33%), Positives = 191/361 (52%), Gaps = 39/361 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSK-HGLKFDFIDLQAGWQTFQETGKALPDETIDI 80
            I ++PGD +G+E++    +VL+ +  K HG+KF+F     G     +TG  LPDET++ 
Sbjct: 6   NIVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEA 65

Query: 81  LRNQCQGALFGAVQSP---TNKVEGYSSPIVALRKKLGLYANVRPVK---------SVLP 128
            + Q    L GAV  P   T KV      ++ +RK+LGLY N+RP K         S L 
Sbjct: 66  AK-QSDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLSPLK 123

Query: 129 QE--RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIAL 186
           +E  +  D ++VRE    +Y    +    E  G+ VA   ++ S    K I  +A  ++L
Sbjct: 124 EEVCKGTDFVVVRELVGGIYFGERQ----EDDGSGVAWDSEKYSIEEVKRITKMAAFLSL 179

Query: 187 QRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMF 246
           Q    +    +    K+NVL+ S      + R   +    +F ++K   Q++DS    + 
Sbjct: 180 QN---DPPLPIWSLDKANVLASS-----RLWRAAVDETIAEFPNLKVQHQLIDSAAMMLV 231

Query: 247 REPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGF------DFVVGEPCHGSAP 299
           + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAP
Sbjct: 232 KNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAP 291

Query: 300 DIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQ 358
           D+A +G  NPVATI S A+ML+  +   +  + I +AV   L D  I+T DLGG STT +
Sbjct: 292 DLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVL-DRGIRTADLGGNSTTSE 349

Query: 359 V 359
           +
Sbjct: 350 L 350

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  160 bits (406), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 112/353 (31%), Positives = 195/353 (55%), Gaps = 31/353 (8%)

Query: 21  LTIGLIPGDGIGKEVIPAGRQVL--ENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETI 78
           +T+ L+PGDG+GKE+  +   +   EN+     + ++ +D+    Q   E G     E++
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQAENVP----IDWETVDIS---QLDHEDGVNAAVESL 81

Query: 79  DILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV--LPQERP-VDM 135
              RN+    L G   +  ++V G+ S  VA RK+L +YANV   KS+  +  + P VD+
Sbjct: 82  K--RNKI--GLKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDL 136

Query: 136 IIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEA 195
           +I+RENTE  Y     + ++ ++   V E++K +++  ++ IA  A + A++  +     
Sbjct: 137 VIIRENTEGEY-----SGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMRHDR----K 187

Query: 196 TLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFDVI 255
            +T  HK+N++  SDGLFR    +V E+    +  IK +  IVD+   +   +P  FDV+
Sbjct: 188 MVTAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVM 243

Query: 256 VAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATIR 314
           V P++YG IL +  AAL+G  G+VP  N G ++ V EP       DI G+ ++NP A I 
Sbjct: 244 VTPSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMIL 303

Query: 315 STALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVVEDVLSRM 367
           S+ L+L+ +G  + A  I KAV   +++ +  T D+GG ++T +  + V+ ++
Sbjct: 304 SSTLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  159 bits (401), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 116/374 (31%), Positives = 192/374 (51%), Gaps = 34/374 (9%)

Query: 3   RASFTQLARRSYASASK---SLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDL 59
           + +FT +A R      K     T+ L+PGDG+G+E+  +   +           F+  +L
Sbjct: 8   KRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSI-----------FEAENL 56

Query: 60  QAGWQTFQETGKALPD--ETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
              W+  + +G    D    ++ L+    G L G   +  +  +G++S  VALRK+L +Y
Sbjct: 57  PIDWERVELSGLEQEDVHTAVESLKRNKIG-LKGIWHTSADH-DGHTSWNVALRKELDIY 114

Query: 118 ANV---RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETAT 174
           ANV   +  K V  +   VD++I+RENTE  Y     + ++ ++   V E++K ++   T
Sbjct: 115 ANVAIFKSFKGVDTRIPDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKIMTAQKT 169

Query: 175 KNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYN 234
           + IA  A + A++  +     ++T  HK+N++   DGLFR +   V E    ++  +  +
Sbjct: 170 ERIARFAFDYAMKYNR----KSVTAVHKANIMKLGDGLFRNL---VTEIGAKEYPEVGVS 222

Query: 235 EQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP- 293
             IVD+   +   +P  FDV+VAP++YG IL +  AAL+G  G+VP AN G D+ V EP 
Sbjct: 223 SIIVDNASMQAVAKPHQFDVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPG 282

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGK 353
                 DI  + I+NP A I S  LML  +G    A  I KAV   + +    T D+GG 
Sbjct: 283 SRHVGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGS 342

Query: 354 STTQQVVEDVLSRM 367
           +TT +    V++++
Sbjct: 343 ATTTEFTNAVIAKL 356

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  157 bits (397), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 182/352 (51%), Gaps = 28/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDILR 82
           +  I GDGIG E+  + + +    ++K  + F+ + ++           ++P+E    + 
Sbjct: 38  VSFIEGDGIGPEISKSVKDIFA--AAKVPVDFESVVVKP---ILVNGVTSIPEEAQKSI- 91

Query: 83  NQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQER---PVDMIIVR 139
           N    AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV   +     V+++++R
Sbjct: 92  NTNLVALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIR 149

Query: 140 ENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTV 199
           ENTE  Y   E   +       V ++IK I+  A++ +   A E A   ++      L V
Sbjct: 150 ENTEGEYAGIEHAIVPG-----VVQSIKLITREASERVIRFAYEYARAAER----PRLIV 200

Query: 200 THKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVA 257
            HKS +   SDGLF +V +++    + +F  IK   +++D+ V     +P  +   V V 
Sbjct: 201 VHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVC 256

Query: 258 PNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRST 316
           PNLYGDILSD  + L  GSLG+ PS N+G    + E  HGSAPDIAGK  +NP A + S+
Sbjct: 257 PNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSS 316

Query: 317 ALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367
            +ML  MG  E A  I KAV   +      +T DL G ++T    E V+ ++
Sbjct: 317 VMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  155 bits (391), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/373 (31%), Positives = 196/373 (52%), Gaps = 38/373 (10%)

Query: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVL--ENLSSKHGLKFDFID 58
           +LR S + ++ + Y        I LIPG+GIGKEV  + R +   ENL     + ++ ++
Sbjct: 6   LLRRSISTISPKKYGG---RFQITLIPGNGIGKEVTDSVRSIFQAENLP----IDWEIVN 58

Query: 59  LQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYA 118
           ++    + ++  K   D    I RN+   AL G   S  + ++G  S  VALRK+L ++A
Sbjct: 59  IE----SHRDGIKTAVDS---IKRNKI--ALKGIWSS--DPIDG--SLNVALRKQLDIFA 105

Query: 119 NVRPVKS---VLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATK 175
           NV   KS   V  +   VD++++RENTE  +   E   +D      V E++K +++  T+
Sbjct: 106 NVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDG-----VVESLKIVTKPKTE 160

Query: 176 NIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNE 235
            IA  A + A +  + +    +T  HK+N++   DGLF+ +   +     +++  IK + 
Sbjct: 161 RIARFAFDFAKKHNRNH----VTAVHKANIMKLGDGLFKNIVAHI---GNNEYPEIKNSS 213

Query: 236 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-C 294
            IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN G D+ V EP  
Sbjct: 214 IIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYAVFEPGS 273

Query: 295 HGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKS 354
                DI G+ ++NP A I S   ML  +G    A+ I  AV   +   +  T D+GG +
Sbjct: 274 RHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTKDIGGTA 333

Query: 355 TTQQVVEDVLSRM 367
           +T +  + V++ +
Sbjct: 334 STTEFTDAVINEL 346

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  154 bits (389), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 114/376 (30%), Positives = 197/376 (52%), Gaps = 36/376 (9%)

Query: 6   FTQLARRSYASASKSL----------TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFD 55
           F  + RR  AS +K L          T+ LIPGDG+GKE+  +   + E  +    + ++
Sbjct: 2   FRTVQRRGMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFE--AENIPVDWE 59

Query: 56  FIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLG 115
            +D+       Q+  +A+      + RN+        +   +  +  + S  VALRK+L 
Sbjct: 60  RVDISTS-DNIQDVSQAVES----LKRNKIG---LKGIWHTSADIADHGSFNVALRKQLD 111

Query: 116 LYANVRPVKSV--LPQERP-VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISET 172
           ++A+V   KSV  +  + P VD++++RENTE  Y     + ++ ++   V E++K I++ 
Sbjct: 112 MFAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEY-----SGLEHESVPGVVESLKIITKA 166

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIK 232
            ++ IA  A + A   +K N ++   V HK+N++   DGLFR     V E   +++  I+
Sbjct: 167 KSERIARFAFDFA---KKYNRKSVCAV-HKANIMKMGDGLFRNT---VTEIGANEYPDIQ 219

Query: 233 YNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGE 292
            +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  A+ G +  V E
Sbjct: 220 TSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIIGNIGAALIGGPGLVAGAHYGREHAVFE 279

Query: 293 P-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLG 351
           P       DI GK ++NP A I S+ LML+ +G  E+A+ I KA    +    + T D+G
Sbjct: 280 PGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQVTTKDIG 339

Query: 352 GKSTTQQVVEDVLSRM 367
           G ++T +  E ++ R+
Sbjct: 340 GSASTTEFTEAIIKRL 355

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  154 bits (388), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 119/384 (30%), Positives = 199/384 (51%), Gaps = 43/384 (11%)

Query: 1   MLRASFTQLARRSYASASKSL--------TIGLIPGDGIGKEVIPAGRQVL--ENLSSKH 50
           M R S T+    + A+  K L        T+ LIPGDG+GKEV  +   +   EN+    
Sbjct: 1   MFRHSLTKRTLATVATTEKMLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENVP--- 57

Query: 51  GLKFDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVAL 110
            + +D +D+ +G    ++   A+  E++   R   +G       SP ++  G+ S  VAL
Sbjct: 58  -VDWDRVDI-SGVDRAEDVKSAV--ESLKRNRIGLKGIWH---TSPADQA-GHGSLNVAL 109

Query: 111 RKKLGLYANVRPVKSV------LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAE 164
           RK+L +YANV   KS+      +P    VD++++RENTE      E + ++ ++   V E
Sbjct: 110 RKELDIYANVARFKSIPGVQVKIPD---VDLVVIRENTEG-----EFSGLEHESVPGVVE 161

Query: 165 AIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN 224
           ++K +++   + IA  A + A    K N    +   HK+N++   DGLF+ + ++V E  
Sbjct: 162 SLKIMTQDNIERIARFAFDYA----KKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEK- 216

Query: 225 KDKFGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANV 284
             ++  ++    IVD+   +    P  FDV+V P++YG IL +  AAL+G  G+V  AN 
Sbjct: 217 --EYPELQVGNIIVDNASMQTVANPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANY 274

Query: 285 GFDFVVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN 343
           G D  + EP       DI G+ ++NP A I S+ L+L  +G   +A  I KAV A + + 
Sbjct: 275 GRDVALFEPGSRHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEG 334

Query: 344 SIKTPDLGGKSTTQQVVEDVLSRM 367
              T D+GG ++T +  E V++++
Sbjct: 335 KSVTRDIGGTASTTEFTEAVINKL 358

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  152 bits (385), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 192/367 (52%), Gaps = 40/367 (10%)

Query: 16  SASKSLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALP 74
           SA K + +  +PGD +G+E+     +VL+ +S  +  +KFDF +   G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLP 59

Query: 75  DETIDILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP--------- 122
           DE ++  + +    L GAV  P     G   P   ++ +RK+L LYAN+RP         
Sbjct: 60  DEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 123 -VKSVLPQ-ERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180
            +  + PQ  +  D ++VRE    +Y    K    E  G  VA   ++ +    + I  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240
           A  +ALQ +       +    K+NVL+ S  L+R   + V E+ K++F ++K   Q++DS
Sbjct: 174 AAFMALQHEP---PLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDS 226

Query: 241 MVYRMFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               + + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGG 352
           CHGSAPD+  K   NPVATI S A+ML+  +  PE  + I  AV   L D  I+T DLGG
Sbjct: 287 CHGSAPDLP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVL-DAGIRTGDLGG 344

Query: 353 KSTTQQV 359
            ++T +V
Sbjct: 345 SNSTTEV 351

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  152 bits (384), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 112/379 (29%), Positives = 190/379 (50%), Gaps = 48/379 (12%)

Query: 9   LARRSYASASKSL---------TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDL 59
           +++RS A+  ++L         T+ L+PGDG+GKE   +   V           F+  ++
Sbjct: 6   VSKRSLATLPETLFPNKYGGRYTVTLLPGDGVGKECTDSVVSV-----------FNAENI 54

Query: 60  QAGWQTFQETG----KALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLG 115
              W+    +G    + +      + RN+    L G   +      G+ S  VA RK+L 
Sbjct: 55  PIDWEIVNISGLDHKEGVAAAVQSLRRNKI--GLKGLWHTSNADQSGHGSLNVAFRKQLD 112

Query: 116 LYANV------RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRI 169
           +YANV      + VK+++P    VD++++RENTE  +   E   ++      V E++K  
Sbjct: 113 IYANVAVFKSLKGVKTMIPD---VDLVVIRENTEGEFSGLEHESVEG-----VVESLKVT 164

Query: 170 SETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFG 229
           +   T+ IA  A   A   QK NG   +   HK+N++   DGLFR     + E    ++ 
Sbjct: 165 TLPKTERIARFAFNYA---QK-NGRKAVCAVHKANIMKLGDGLFRNTVTSIGEK---EYP 217

Query: 230 SIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFV 289
            I+ +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  AN G ++ 
Sbjct: 218 DIETSSIIVDNASMQAVAKPHQFDVLVTPSMYGTIIGNIGAALIGGPGLVAGANFGREYA 277

Query: 290 VGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTP 348
           V EP       DI G+ I+NP A + S+ALML  +G  ++ + I  AV   + +  ++T 
Sbjct: 278 VFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEGDVRTK 337

Query: 349 DLGGKSTTQQVVEDVLSRM 367
           D+GG +TT +  + V+ ++
Sbjct: 338 DIGGDATTTEFTQAVIEKL 356

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  152 bits (384), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 121/367 (32%), Positives = 192/367 (52%), Gaps = 40/367 (10%)

Query: 16  SASKSLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALP 74
           SA K + +  +PGD +G+E+     +VL+ +S  +  +KFDF +   G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLP 59

Query: 75  DETIDILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP--------- 122
           DE ++  + +    L GAV  P     G   P   ++ +RK+L LYAN+RP         
Sbjct: 60  DEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLL 117

Query: 123 -VKSVLPQ-ERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180
            +  + PQ  +  D ++VRE    +Y    K    E  G  VA   ++ +    + I  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240
           A  +ALQ +       +    K+NVL+ S  L+R   + V E+ K++F ++K   Q++DS
Sbjct: 174 AAFMALQHEP---PLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDS 226

Query: 241 MVYRMFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               + + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGG 352
           CHGSAPD+  K   NP+ATI S A+ML+  +  PE  + I  AV   L D  I+T DLGG
Sbjct: 287 CHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGG 344

Query: 353 KSTTQQV 359
            ++T +V
Sbjct: 345 SNSTTEV 351

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  150 bits (378), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 120/367 (32%), Positives = 191/367 (52%), Gaps = 40/367 (10%)

Query: 16  SASKSLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALP 74
           SA K + +  +PGD +G+E+     +VL+ +S  +  + FDF +   G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLP 59

Query: 75  DETIDILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP--------- 122
           DE ++  + +    L GAV  P     G   P   ++ +RK+L LYAN+RP         
Sbjct: 60  DEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLL 117

Query: 123 -VKSVLPQ-ERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180
            +  + PQ  +  D ++VRE    +Y    K    E  G  VA   ++ +    + I  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240
           A  +ALQ +       +    K+NVL+ S  L+R   + V E+ K++F ++K   Q++DS
Sbjct: 174 AAFMALQHEP---PLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDS 226

Query: 241 MVYRMFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               + + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGG 352
           CHGSAPD+  K   NP+ATI S A+ML+  +  PE  + I  AV   L D  I+T DLGG
Sbjct: 287 CHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGG 344

Query: 353 KSTTQQV 359
            ++T +V
Sbjct: 345 SNSTTEV 351

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  149 bits (377), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 108/355 (30%), Positives = 184/355 (51%), Gaps = 36/355 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETG----KALPDET 77
           T+ LIPGDG+GKEV  +   +           F+  +L   W+    +G    + +    
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSI-----------FNAENLPIDWERVDISGLDHEEGVEAAV 83

Query: 78  IDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQERP----V 133
             + RN+    L G   +   + + + S  VALRK+L +YANV   K+ LP  +     V
Sbjct: 84  NSLKRNKI--GLKGIWHTSAGQSD-HGSLNVALRKQLDIYANVAHFKT-LPGVKTRIPDV 139

Query: 134 DMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNG 193
           D++I+RENTE  Y     + ++ ++   V E++K I++  ++ IA  A + A +  +   
Sbjct: 140 DLVIIRENTEGEY-----SGLEHESVPGVVESLKIITKEKSERIARFAFDFAKRFDR--- 191

Query: 194 EATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD 253
              +T  HK+N++   DGLFR     + E+   ++  IK +  IVD+   +   +P  FD
Sbjct: 192 -KLVTAVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFD 247

Query: 254 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVAT 312
           V+V P++YG IL +  AAL+G  G+VP AN G +  V EP       DI G+ ++NP A 
Sbjct: 248 VLVTPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAM 307

Query: 313 IRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVVEDVLSRM 367
           I S+ L+L+ +G    A+ I  AV   + +  + T D+GG ++T +   +++ ++
Sbjct: 308 ILSSTLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  149 bits (376), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 123/367 (33%), Positives = 192/367 (52%), Gaps = 40/367 (10%)

Query: 16  SASKSLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALP 74
           SA K + +  +PGD +G+E+     +VL+ +S  +  +KF+F     G      TG+ LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLP 59

Query: 75  DETIDILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPV----KSVL 127
           D +++  + +    L GAV  P     G   P   ++ +RK+L LYAN+RP     +S+L
Sbjct: 60  DASLEAAK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 128 -------PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180
                     R  D ++VRE    +Y    K    E  G  VA   ++ S    + I  +
Sbjct: 118 DLSPLKAEHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240
           A  +ALQ    N    +    K+NVL+ S  L+R   + V E+ K++F ++    Q++DS
Sbjct: 174 AAFLALQH---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDS 226

Query: 241 MVYRMFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               M + P   + VI+  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMIMVKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGG 352
           CHGSAPD+  KG  NP+ATI S A+MLE  +   E    + +AV   L D+ I+T DL G
Sbjct: 287 CHGSAPDLE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVL-DSGIRTGDLRG 344

Query: 353 KSTTQQV 359
            ++TQ+V
Sbjct: 345 SNSTQEV 351

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  148 bits (374), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 121/361 (33%), Positives = 188/361 (52%), Gaps = 39/361 (10%)

Query: 23  IGLIPGDGIGKEVIPAGRQVLENL--SSKHGLKFDFIDLQAGWQTFQETGKALPDETIDI 80
           I ++PGD +G+E++    +VLE +  SS  G+KF+F     G  +   TG  LPDE +D 
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 81  LRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV---------LP 128
            +N     L GAV  P     G   P   ++ +RK+L LYAN+RP   V         L 
Sbjct: 66  AKNS-DAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 129 QE--RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIAL 186
           +E  +  D  +VRE    +Y    K    E  G   A   ++ +    + I  +A  +AL
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRK----EDDGDGSAWDCEKYTIPEVQRITRMAAFLAL 179

Query: 187 QRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMF 246
           Q    +    +    K+NVL+ S  L+R   + V E+ K++F ++K   Q++DS    + 
Sbjct: 180 QH---DPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMILV 232

Query: 247 REPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGSAP 299
           + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAP
Sbjct: 233 KSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 300 DIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQ 358
           D+  KG  NP+ATI S A+ML+  +   +    I +AV   L D  I+T DL G ++T +
Sbjct: 293 DLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVL-DAGIRTADLKGSNSTSE 350

Query: 359 V 359
           V
Sbjct: 351 V 351

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  148 bits (373), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 190/362 (52%), Gaps = 38/362 (10%)

Query: 25  LIPGDGIGKEVIPAGRQVLENL-SSKHGLKFDFIDLQAGWQTFQETGKALPDETIDILRN 83
           ++PGD IG+EVI    +VL  +  ++  + F+F     G      TG  L D+TI+  + 
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAK- 67

Query: 84  QCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPV----KSVL------PQ- 129
                L GAV  P     G   P   ++A+RK+LGLYAN+RP     KS+L      P+ 
Sbjct: 68  AADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEI 126

Query: 130 ERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQ 189
            +  D +I+RE    +Y    K    E  G  VA   ++ + +  + I  +   +ALQ  
Sbjct: 127 AQGTDFVILRELVGGIYFGERK----EDDGDGVAWDSEKYTVSEVERITRMGAFLALQHD 182

Query: 190 KVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREP 249
                  L    K+NVL+ S  L+R   R V E+ K +F  +    Q++DS    M + P
Sbjct: 183 P---PLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIKNP 235

Query: 250 ECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD------FVVGEPCHGSAPDIA 302
             F+ +++  N++GDI+SD A+ + GSLG++PSA++  +      F + EPCHGSAPD+ 
Sbjct: 236 RKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDLE 295

Query: 303 GKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVVE 361
            KG +NP+A I S A+ML+  +   +  + I  AV   + ++ I+T DLGG +TT +V +
Sbjct: 296 -KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVK-QVIESGIRTGDLGGNNTTTEVGD 353

Query: 362 DV 363
            V
Sbjct: 354 AV 355

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 122/363 (33%), Positives = 188/363 (51%), Gaps = 38/363 (10%)

Query: 20  SLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALPDETI 78
           S  I ++PGD +G+E+     +VL+ +S  +    F+F     G      TG  LPDE +
Sbjct: 2   SKNIVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEAL 61

Query: 79  DILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVK---SVLPQERP 132
           +  + +    L GAV  P     G   P   ++ +RK+L LYAN+RP       L +  P
Sbjct: 62  EASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSP 119

Query: 133 V--------DMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEI 184
           +        D ++VRE    +Y    K    E  G  VA   ++ S    + I  +A  +
Sbjct: 120 LKAQYAQGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEQYSVPEVQRITRMAAFL 175

Query: 185 ALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYR 244
           ALQ    N    +    K+NVL+ S  L+R   + V ++ K++F ++  N Q++DS    
Sbjct: 176 ALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMI 228

Query: 245 MFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGS 297
           + + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 229 LVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGS 288

Query: 298 APDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356
           APD+A KG  NPVATI S A+ML+  +   E    I KAV   L D+ I+T DLGG ++T
Sbjct: 289 APDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVL-DDGIRTGDLGGSNST 346

Query: 357 QQV 359
            +V
Sbjct: 347 SEV 349

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  147 bits (370), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 185/360 (51%), Gaps = 38/360 (10%)

Query: 23  IGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALPDETIDIL 81
           I ++PGD +G+E+     +VL+ ++   + + FDF     G      TG  LPDE ++  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 82  RNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV------LPQERP 132
           +N     L GAV  P     G   P   ++ +RK+LGLYAN+RP          L   RP
Sbjct: 66  KN-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 133 -----VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQ 187
                 D ++VRE    +Y    K    E  G  VA   ++ S    + I  +A  +ALQ
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 179

Query: 188 RQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFR 247
               N    +    K+NVL+ S  L+R   + V E+ K++F ++    Q++DS    + +
Sbjct: 180 H---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVK 232

Query: 248 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGSAPD 300
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAPD
Sbjct: 233 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 292

Query: 301 IAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQV 359
           +  KG  NP+ATI S A+ML+  +   +    I +AV   L D  I+T DLGG ++T +V
Sbjct: 293 LP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVL-DAGIRTGDLGGSNSTTEV 350

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  148 bits (373), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 124/368 (33%), Positives = 190/368 (51%), Gaps = 38/368 (10%)

Query: 15  ASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKAL 73
           A A  +  I ++PGD +G+E+     +VL  +SS +  + FDF     G      TG  L
Sbjct: 82  AMAQTTKHIVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPL 141

Query: 74  PDETIDILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVK------ 124
           PDE ++  + +    L GAV  P     G   P   ++ +RK+L LYAN+RP        
Sbjct: 142 PDEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSL 199

Query: 125 ---SVLPQE--RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIAN 179
              S L  E  +  D+ IVRE    +Y    K    E  G  VA   ++ S +  + I  
Sbjct: 200 LDLSPLKPEIVKGTDICIVRELVGGIYFGERK----EDEGDGVAWDSEKYSVSEVQRITR 255

Query: 180 IALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVD 239
           +A  +ALQ    N    +    K+NVL+ S  L+R   + V E+ K++F ++    Q++D
Sbjct: 256 MAGFLALQH---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLID 308

Query: 240 SMVYRMFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGE 292
           S    + + P   + V++A N++GDI+SD A+ + GSLG++PSA++         F + E
Sbjct: 309 SAAMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYE 368

Query: 293 PCHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLG 351
           PCHGSAPD+  KG  NPVATI S A+ML+  +   E    + KAV   L D+ ++T DL 
Sbjct: 369 PCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVL-DSGVRTADLR 426

Query: 352 GKSTTQQV 359
           G ++T +V
Sbjct: 427 GSNSTSEV 434

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  145 bits (367), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 187/363 (51%), Gaps = 38/363 (10%)

Query: 20  SLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALPDETI 78
           S  I ++PGD +GKEV     +VL  ++  +  +KF+F     G      TG  LPDE +
Sbjct: 2   SKNIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEAL 61

Query: 79  DILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVK---------SV 126
           +  + +    L GAV  P     G   P   ++ +RK+LGLYAN+RP           S 
Sbjct: 62  EASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSP 119

Query: 127 LPQE--RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEI 184
           L  E  +  D ++VRE    +Y    K    E  G  VA   ++ S    + I  +A  +
Sbjct: 120 LKPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFL 175

Query: 185 ALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYR 244
           ALQ+   N    +    K+NVL+ S  L+R   + V E+ K +F  +    Q++DS    
Sbjct: 176 ALQQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMI 228

Query: 245 MFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGF------DFVVGEPCHGS 297
           + + P   + V++  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 229 LVKSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGS 288

Query: 298 APDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356
           APD+    + NP+ATI S A+ML+  +   E  + + +AV  N+ D  ++T DLGG ++T
Sbjct: 289 APDLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAVR-NVLDAGVRTGDLGGSNST 346

Query: 357 QQV 359
            +V
Sbjct: 347 TEV 349

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  145 bits (366), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 190/364 (52%), Gaps = 46/364 (12%)

Query: 23  IGLIPGDGIGKEVIPAGRQVL----ENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETI 78
           I ++PGD IG+EV+    +VL    ++LS  H   FDF     G      TG ALPDE +
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVH---FDFQYHLVGGAAIDATGSALPDEAL 63

Query: 79  DILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKS 125
              + +    L GAV  P  +  G   P   ++ LR++LG+YAN+RP          +  
Sbjct: 64  GAAK-EADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSP 121

Query: 126 VLPQ-ERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEI 184
           + P+  R  D+++VRE     Y         E  G  VA    + +    + IA +A  +
Sbjct: 122 LRPEIARDTDIMVVRELLGGSYFGERH----EDEGDGVAWDTDKYTVKEVQRIARMAGFL 177

Query: 185 ALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYR 244
           ALQ    +    +    K+NVL+ S  L+R+   + ++S   +F +++   Q++DS    
Sbjct: 178 ALQH---DPPLPVWSLDKANVLASSR-LWRKTVEETFQS---EFPNVQLQHQLIDSAAMI 230

Query: 245 MFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGS 297
           + + P  F+ V+V  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 231 LVKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGS 290

Query: 298 APDI-AGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKST 355
           APD+ AGK  +NP+  I S A+ML+  +    A + + +AV   L D+ ++T DL G S+
Sbjct: 291 APDLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVL-DSGVRTGDLLGSSS 347

Query: 356 TQQV 359
           T +V
Sbjct: 348 TSEV 351

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  144 bits (362), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 124/373 (33%), Positives = 192/373 (51%), Gaps = 38/373 (10%)

Query: 18  SKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLK-FDFIDLQAGWQTFQETGKALPDE 76
           S +  I ++PGD +G+E+     +VL+ +S     K F+F     G      TG+ LPD 
Sbjct: 2   STTKKIVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDA 61

Query: 77  TIDILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVK--------- 124
           +++  + +    L GAV  P     G   P   ++ +RK+L LYAN+RP           
Sbjct: 62  SLEAAK-KSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDL 119

Query: 125 SVLPQE--RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIAL 182
           S L  E  R  D ++VRE    +Y    K    E TG  VA   ++ S    + I  +A 
Sbjct: 120 SPLKPECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRMAA 175

Query: 183 EIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMV 242
            +ALQ        +L    K+NVL+ S  L+R   + V E+ K++F ++    Q++DS  
Sbjct: 176 FLALQHSPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAA 228

Query: 243 YRMFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCH 295
             + + P   + VI+  N++GDI+SD A+ + GSLG++PSA++         F + EPCH
Sbjct: 229 MILVKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCH 288

Query: 296 GSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKS 354
           GSAPD+  KG  NP+ATI S A+ML+  +   E    + +AV   L D+ ++T DL G S
Sbjct: 289 GSAPDLP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVL-DSGVRTADLKGTS 346

Query: 355 TTQQVVEDVLSRM 367
           TT +V E V+  +
Sbjct: 347 TTSEVGEAVVKAL 359

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  144 bits (362), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 120/365 (32%), Positives = 187/365 (51%), Gaps = 38/365 (10%)

Query: 18  SKSLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALPDE 76
           S +  I ++PGD +G+E+     +VL+ +S  +  +KFDF     G      TG  L DE
Sbjct: 2   STTKKIVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDE 61

Query: 77  TIDILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------V 123
            ++  + +    L GAV  P     G   P   ++ +RK+L LYAN+RP          +
Sbjct: 62  ALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLEL 119

Query: 124 KSVLPQ-ERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIAL 182
             + PQ  R  D ++VRE    +Y    K    E  G  VA   ++ +    + I  +A 
Sbjct: 120 SPIKPQFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAA 175

Query: 183 EIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMV 242
            +ALQ Q       +    K+NVL+ S  L+R   + V E+ K++F ++K   Q++DS  
Sbjct: 176 FMALQHQP---PLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAA 228

Query: 243 YRMFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCH 295
             + + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCH
Sbjct: 229 MILVKNPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCH 288

Query: 296 GSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKS 354
           GSAPD+  K   NP+ATI S A+ML+  +      Q I  AV   L D  I+T DLGG +
Sbjct: 289 GSAPDLP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVL-DAGIRTGDLGGSN 346

Query: 355 TTQQV 359
           +T +V
Sbjct: 347 STIEV 351

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  139 bits (351), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 120/362 (33%), Positives = 182/362 (50%), Gaps = 39/362 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSS--KHGLKFDFIDLQAGWQTFQETGKALPDETID 79
           TI ++PGD +G+E+     +VL  +       + F F     G      TG  LPDE ++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 80  ILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVK---------SVL 127
             + +    L GAV  P     G   P   ++ +RK+L LYAN+RP           S L
Sbjct: 66  ASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 128 PQE--RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIA 185
             E  R  D ++VRE    +Y    K    E  G  VA   ++ S    + I  +A  +A
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFMA 179

Query: 186 LQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRM 245
           LQ    N    +    K+NVL+ S  L+R   + V E+ K++F  +    Q++DS    +
Sbjct: 180 LQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMIL 232

Query: 246 FREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGSA 298
            + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSA
Sbjct: 233 VKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 292

Query: 299 PDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQ 357
           PD+  KG  NPVATI S A+ML+  +   E  + I +AV   L D+ I+T DL G ++T 
Sbjct: 293 PDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVL-DSGIRTADLKGTNSTT 350

Query: 358 QV 359
           +V
Sbjct: 351 EV 352

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  138 bits (347), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/319 (31%), Positives = 170/319 (53%), Gaps = 43/319 (13%)

Query: 9   LARRSYASASK-----------SLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57
           +A+RS A+A++             T+ LIPGDG+GKEV  + + +           F+  
Sbjct: 6   IAKRSLATAAQVEHILPKKYGGRFTVTLIPGDGVGKEVTDSVKTI-----------FEAE 54

Query: 58  DLQAGWQTF---QETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKL 114
           ++   W+T    Q   K   +E ++ LR    G L G   +P ++  G+ S  VALRK+L
Sbjct: 55  NIPIDWETINIKQTDHKEGVNEAVESLRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQL 112

Query: 115 GLYANV---RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISE 171
            +YANV   + +K V  +   +D+I++RENTE      E + ++ ++   V E++K +++
Sbjct: 113 DIYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESLKIMTK 167

Query: 172 TATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSI 231
             T+ IA  A + A   +K N +A +T  HK+N++   DGLFR +  ++    + ++  I
Sbjct: 168 PKTERIARFAFDFA---KKYNRKA-VTAVHKANIMKLGDGLFRNIITEI---GQKEYPDI 220

Query: 232 KYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVG 291
             +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D+ V 
Sbjct: 221 DVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVF 280

Query: 292 EP-CHGSAPDIAGKGISNP 309
           EP       DI G+ ++NP
Sbjct: 281 EPGSRHVGLDIKGQNVANP 299

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  137 bits (346), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 188/363 (51%), Gaps = 38/363 (10%)

Query: 20  SLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALPDETI 78
           S  I ++PGD  G+E+     +VLE +S      KF+F     G      TG  LPD+ +
Sbjct: 2   SKNIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDAL 61

Query: 79  DILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPV----KSVL---- 127
              +      L GAV  P     G   P   ++ +RK+L LYAN+RP     +S+L    
Sbjct: 62  AAAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSP 119

Query: 128 --PQE-RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEI 184
             PQ  +  D ++VRE    +Y    K    E  G  VA   ++ ++   + +  +A  +
Sbjct: 120 LKPQHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMAAFL 175

Query: 185 ALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYR 244
           ALQ    N    +    K+NVL+ S  L+R   + V E+ K++F  +K N Q++DS    
Sbjct: 176 ALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMI 228

Query: 245 MFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGF------DFVVGEPCHGS 297
           + + P   + +++  NL+GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 229 LVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGS 288

Query: 298 APDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356
           APD+  KG  NP+A I S A+ML+  +   +  + + KAV   L D+ ++T DLGG ++T
Sbjct: 289 APDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVL-DSGVRTGDLGGSNST 346

Query: 357 QQV 359
            +V
Sbjct: 347 SEV 349

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  136 bits (343), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 186/368 (50%), Gaps = 43/368 (11%)

Query: 18  SKSLTIGLIPGDGIGKEVIPAGRQVLENL----SSKHGLKFDFIDLQAGWQTFQETGKAL 73
           S +  I ++PGD +G E+     +VL+ +    SSK  +KFDF     G       G  L
Sbjct: 2   STTKKIVVLPGDHVGGEITEEAIKVLKAIEQVESSK--VKFDFQYHLIGGAAIDAAGVPL 59

Query: 74  PDETIDILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV---- 126
            DE ++  + +    L GAV  P     G   P   ++ +RK+LGLYAN+RP        
Sbjct: 60  TDEALEASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPL 117

Query: 127 --LPQERP-----VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIAN 179
             L   RP      D ++VRE    +Y    K    E  G  VA   ++ S    + I  
Sbjct: 118 LGLSPLRPEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITR 173

Query: 180 IALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVD 239
           +A  +ALQ    N    +    K+NVL+ S  L+R   + V  + K++F ++    Q++D
Sbjct: 174 MAAFLALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLID 226

Query: 240 SMVYRMFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGE 292
           S    + + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + E
Sbjct: 227 SAAMILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYE 286

Query: 293 PCHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLG 351
           PCHGSAPD+  K   NPVATI S A+ML+  +   +  + + +AV   L D  ++T DLG
Sbjct: 287 PCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVL-DAGVRTGDLG 344

Query: 352 GKSTTQQV 359
           G ++TQ+V
Sbjct: 345 GSNSTQEV 352

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  135 bits (340), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 187/367 (50%), Gaps = 40/367 (10%)

Query: 16  SASKSLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALP 74
           S+ K++T+   PGD IG E++    +VL+ ++     + F +     G      TG+ L 
Sbjct: 2   SSVKNITV--FPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLT 59

Query: 75  DETIDILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSVL---- 127
           DE + + +N     L GAV  P     G   P   ++ +RK+LG+YAN+RP + V     
Sbjct: 60  DEALQVAKNS-DAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLL 117

Query: 128 ---PQERPV----DMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180
              P +R +    D +IVRE    +Y    +   D+     VA   +  S    + I  +
Sbjct: 118 DLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDDG----VAWDKESYSVPEIQRITRM 173

Query: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240
           A  +ALQ    N    +    K+NVL+ S  L+R   + V E+ K++F ++  N  ++DS
Sbjct: 174 AAFLALQH---NPPLPVWSLDKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDS 226

Query: 241 MVYRMFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGF------DFVVGEP 293
               + + P   + V++  N++GDI+SD A+ + GSLG++PSA++           + EP
Sbjct: 227 AAMTLVQNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGG 352
           CHGSAPD+     +NP+ATI S A+M +  +   +    I +AV   + D  IKT DLGG
Sbjct: 287 CHGSAPDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDLGG 344

Query: 353 KSTTQQV 359
           K+TT +V
Sbjct: 345 KNTTTEV 351

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  135 bits (340), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 120/372 (32%), Positives = 192/372 (51%), Gaps = 40/372 (10%)

Query: 16  SASKSLTIGLIPGDGIGKEVIPAGRQVLENLSS-KHGLKFDFIDLQAGWQTFQETGKALP 74
           SA K + +  +PGD +G+E+     +VL+ +S  +  +KFD+     G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLP 59

Query: 75  DETIDILRNQCQGALFGAVQSP---TNKVEGYSSPIVALRKKLGLYANVRPVK------- 124
           DE +D  +      L GAV  P   T +V      ++ +RK+L LYAN+RP         
Sbjct: 60  DEALDAAKKADA-VLLGAVGGPKWGTGQVRPEQG-LLKIRKELQLYANLRPCNFASDSLL 117

Query: 125 --SVLPQE--RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180
             S L  E  +  D ++VRE    +Y    K    E  G  VA   ++ S    + I  +
Sbjct: 118 DLSPLKPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240
           A  +ALQ+   N    +    K+NVL+ S  L+R   + V E+ K++F ++    Q++DS
Sbjct: 174 AAFLALQQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDS 226

Query: 241 MVYRMFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               + + P   + +++  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMILVKSPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGG 352
           CHGSAPD+  K   NP+ATI S A+ML+  +   E    + +AV   L D  I+T DL G
Sbjct: 287 CHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVL-DAGIRTADLRG 344

Query: 353 KSTTQQVVEDVL 364
           +++T +V + V+
Sbjct: 345 ENSTSEVGDAVV 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  126 bits (317), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 181/364 (49%), Gaps = 43/364 (11%)

Query: 22  TIGLIPGDGIGKEVIPAGRQVLENLSS--KHGLKFDFIDLQAGWQTFQETGKALPDETID 79
            I ++PGD +G EV     ++L+ +     + +KF+F     G      TG  LPDE+++
Sbjct: 6   NIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLE 65

Query: 80  ILRNQCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVK---------SVL 127
             + +    L GAV  P     G   P   ++ +RK+L LYAN+RP           S L
Sbjct: 66  ASK-RADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 128 PQE--RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIA 185
            ++  +  D  +VRE    +Y    K    E  G  VA   ++ S    + I  +A  +A
Sbjct: 124 KEKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRMAAFLA 179

Query: 186 LQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRM 245
           +Q    N    +    K+NVL+ S  L+R   + V E+ +++F S+K + Q++DS    +
Sbjct: 180 MQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSAAMIL 232

Query: 246 FREPECFD-VIVAPNLYGDILSDGAAALVG--------SLGVVPSANVGFDFVVGEPCHG 296
            + P   + +I+  N++GDI+SD A+ + G        SL  +P  N  F     EPCHG
Sbjct: 233 VKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLY--EPCHG 290

Query: 297 SAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNSIKTPDLGGKST 355
           SAPD+  KG  NP+ TI S A+ML+  +   E    + +AV   L DN+I+T DLGG ++
Sbjct: 291 SAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVL-DNNIRTADLGGSNS 348

Query: 356 TQQV 359
           T  +
Sbjct: 349 TSDI 352

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 126/297 (42%), Gaps = 41/297 (13%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTG 159
           V G+  PI+  R   G     R   +++P   P  + +V              ++ +  G
Sbjct: 129 VPGWQQPIIIGRHAHG--DQYRATDTLVPG--PGKLELVFRPAGRGAAAARTLHVHDFEG 184

Query: 160 TRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQ 219
             VA A+    E+  +  A+ +  +AL +Q       L +  K+ +L Q DG F+++ +Q
Sbjct: 185 AGVALAMYNTDES-IRGFAHASFRLALSKQ-----LNLFLATKNTILKQYDGRFKDLFQQ 238

Query: 220 VYESN-KDKF--GSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSL 276
           +Y++  ++ F    I Y  +++D MV +M +    F V+   N  GD+ SD  A   GSL
Sbjct: 239 LYDAEYREAFERAGISYEHRLIDDMVAQMIKSRGGF-VLALKNYDGDVQSDIVAQGFGSL 297

Query: 277 GVVPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTALMLEFMG 324
           G++ S  +  D      E  HG+            + +   I++  A  R  A   +  G
Sbjct: 298 GLMSSVLITPDGNAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLARRADLDG 357

Query: 325 HPEAAQDIHKAVDANLR---DNSIKTPDLG---GKS------TTQ---QVVEDVLSR 366
            P  A   H    A LR   D++I T DL    GK+      TT    Q VED L R
Sbjct: 358 TPAVADFAHALEGATLRTVQDDAIMTKDLALACGKTDRTAYVTTDEFLQAVEDRLQR 414

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 102/228 (44%), Gaps = 22/228 (9%)

Query: 81  LRNQCQGALFGA---VQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQER-PVDMI 136
           +RN   G +F     +      V  +  PI+  R   G     +    V+P+E   + +I
Sbjct: 100 IRNILDGTVFREPIIIPKIPRLVRHWEKPIIIGRHAFG--DQYKATDVVIPEEEGKLKLI 157

Query: 137 IVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEAT 196
              ++T    I T+    D   G  +A    R S    K  A  + E+AL+R+       
Sbjct: 158 FQPKDTNKPAIATDVFEFDGDGGVALAMYNTRKS---IKGFARASFEMALKRK-----MP 209

Query: 197 LTVTHKSNVLSQSDGLFREVCRQVYESNK----DKFGSIKYNEQIVDSMVYRMFREPECF 252
           L  T K+ VL + DG F+++ +++YES+     D+ G I Y  +++D MV +M +    F
Sbjct: 210 LFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQFDEIG-ILYEHRLIDDMVAQMLKSTGGF 268

Query: 253 DVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVGEPCHGSA 298
            +I   N  GD+ SD  A   GSLG++ S  V  D      E  HG+ 
Sbjct: 269 -IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAPDGKTFESEAAHGTV 315

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 122/270 (45%), Gaps = 30/270 (11%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTG 159
           V G+  PI+  R   G     +   +V+P +  ++++           K E   + +  G
Sbjct: 133 VPGWEKPIIIGRHAHG--DQYKATDAVIPGQGKLELVYKPNGDAS---KAEVMEVYDYKG 187

Query: 160 TRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQ 219
             VA A+    E+  +  A+ + ++ALQ+ K+N    L ++ K+ +L + DG F+++ ++
Sbjct: 188 PGVALAMYNTDES-IRGFAHSSFKLALQK-KLN----LFLSTKNTILKKYDGRFKDIFQE 241

Query: 220 VYESN-KDKFG--SIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSL 276
           VY+S  K KF   +I Y  +++D MV +M +    F ++   N  GD+ SD  A   GSL
Sbjct: 242 VYDSEYKQKFAELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSL 300

Query: 277 GVVPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTALMLEFMG 324
           G++ S  +  D      E  HG+            + +   I++  A  R  A   E  G
Sbjct: 301 GLMTSILITPDGKTFESEAAHGTVTRHYRKHQQGEETSTNSIASIFAWTRGLAKRGELDG 360

Query: 325 HPEA---AQDIHKAVDANLRDNSIKTPDLG 351
            P+    A  +  A    ++ + I T DL 
Sbjct: 361 TPDVVRFANILESATLNTVQQDGIMTKDLA 390

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 130/295 (44%), Gaps = 36/295 (12%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTG 159
           V  +  PI+  R   G     R    V+P    + ++   +++    I+      DE++ 
Sbjct: 121 VTNWEKPIIIGRHAFG--DQYRATDVVIPGAGKLKLVFESDDSNTENIELSVYDFDEESK 178

Query: 160 TRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQ 219
             VA A+    E+ T   A+ + ++AL+R        L  T K+ +L + DG F++V   
Sbjct: 179 GGVAMAMYNTLESIT-GFAHASFKMALERG-----LPLYSTTKNTILKKYDGKFKDVFES 232

Query: 220 VYESN-KDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSL 276
           +YES  K  F +  I Y  +++D MV +M +    + +I   N  GD+ SD  A   GSL
Sbjct: 233 LYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSL 291

Query: 277 GVVPSANVGFD--FVVGEPCHGSAP-----DIAGKGIS-NPVATIRSTALMLEFMGHPEA 328
           G++ S  +  D      E  HG+          GK  S N +A+I +    L   G  ++
Sbjct: 292 GLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLIQRGKLDS 351

Query: 329 AQDIHK-------AVDANLRDNSIKTPDLG---GKS------TTQQVVEDVLSRM 367
             D+ K       A    ++++ I T DL    GK+      TT++ +E V  R+
Sbjct: 352 TPDVVKFAELVESATVNTVQEDEIMTKDLALILGKTDRSSYVTTEEFIEAVHKRL 406

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 95/213 (44%), Gaps = 35/213 (16%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKT----EKTYID 155
           V G+  PI+  R   G             Q +  D++I  E T  L  K+    E   ID
Sbjct: 121 VSGWKEPIIIGRHAFG------------DQYKATDVVIPGEGTLKLVFKSKDGDESKDID 168

Query: 156 ------EKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQS 209
                  K G  VA ++   +E+ T   A  + E+AL+R+       L  T K+ +L + 
Sbjct: 169 LDVFEFPKDGG-VAMSMYNTAESIT-GFAKSSFELALERK-----MPLYSTTKNTILKKY 221

Query: 210 DGLFREVCRQVYESN-KDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILS 266
           DG F+++   +YE   K KF +  I Y  +++D MV +M +    F +I   N  GD+ S
Sbjct: 222 DGQFKDIFEGMYEREYKQKFEAVGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQS 280

Query: 267 DGAAALVGSLGVVPSANVGFD--FVVGEPCHGS 297
           D  A   GSLG++ S  V  D      E  HG+
Sbjct: 281 DIVAQGFGSLGLMTSVLVSPDGKTFESEAAHGT 313

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 132/273 (48%), Gaps = 35/273 (12%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVK---SVLPQERPVDMIIVRENTEDLYIKTEKTYIDE 156
           V+ +  PI+     +G +A+    K   +++P   P  + +V ++ ++   KT+   + +
Sbjct: 142 VKNWEKPII-----IGRHAHADQYKATDTLIPG--PGTLELVYKSKDNDPSKTQVLNVYD 194

Query: 157 KTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREV 216
              + VA A+    E+ T   A+ + ++A+ ++       L ++ K+ +L + DG F++V
Sbjct: 195 YKSSGVALAMYNTDESIT-GFAHSSFKLAIDKK-----LDLFLSTKNTILKKYDGRFKDV 248

Query: 217 CRQVYESN-KDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALV 273
            ++V++S  KDKF +  IKY  +++D MV +M +    + ++   N  GD+ SD  A   
Sbjct: 249 FQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY-IMALKNYDGDVQSDIVAQGF 307

Query: 274 GSLGVVPSANVGFD--FVVGEPCHGSAP-----DIAGKGIS-NPVATI----RSTALMLE 321
           GSLG++ S  V  D      E  HG+          GK  S N +A+I    R  A   E
Sbjct: 308 GSLGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQTSTNSIASIFAWSRGLAKRGE 367

Query: 322 FMGHPEA---AQDIHKAVDANLRDNSIKTPDLG 351
               P+    AQ + KA    ++++ I T DL 
Sbjct: 368 LDNTPDVMKFAQTLEKATLDTVQEDGIMTKDLA 400

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 93/201 (46%), Gaps = 19/201 (9%)

Query: 103 YSSPIVALRKKLGLYANVRPVKSVLPQERPVDMII-VRENTEDLYIKTEKTYIDEKTGTR 161
           +  PI+  R   G     +    V+P E  + ++    +  ED+ +K      D      
Sbjct: 124 WEKPIIIGRHAFG--DQYKATDVVIPGEGELKLVFKSSDGGEDIDLKV----FDFPKHGG 177

Query: 162 VAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY 221
           VA A+   +E+ T   A  + E+AL+R+       L  T K+ +L + DG F+++   +Y
Sbjct: 178 VAMAMYNTTESIT-GFAKASFELALERK-----LPLYSTTKNTILKRYDGKFKDIFESMY 231

Query: 222 ESN-KDKFG--SIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGV 278
            S+ +DKF    I Y  +++D MV +M +    + +I   N  GD+ SD  A   GSLG+
Sbjct: 232 ASDYQDKFEVIGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGL 290

Query: 279 VPSANVGFD--FVVGEPCHGS 297
           + S  V  D      E  HG+
Sbjct: 291 MSSVLVTPDGKTFESEAAHGT 311

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 95/215 (44%), Gaps = 36/215 (16%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTG 159
           V G+  PI+  R   G             Q +  DM+I  +N + + +K   T  D KT 
Sbjct: 121 VPGWEKPIIIGRHAYG------------DQYKAADMVIPEDNNKGI-VKLVYTSDDGKTN 167

Query: 160 TRV-----------AEAIKRISET-ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLS 207
             +             A+   + T + K  A+ + E AL++        L  T K+ +L 
Sbjct: 168 IELPVHQFDGNDDGGIALGMFNTTRSIKGFAHSSFEFALEKG-----LPLYSTTKNTILK 222

Query: 208 QSDGLFREVCRQVYESN-KDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDI 264
           + DG ++++   +YE + KDKF +  I Y  +++D MV +M +    F VI   N  GD+
Sbjct: 223 KYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF-VIAMKNYDGDV 281

Query: 265 LSDGAAALVGSLGVVPSANVGFD--FVVGEPCHGS 297
            SD  A   GSLG++ S  +  D      E  HG+
Sbjct: 282 QSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 93/207 (44%), Gaps = 25/207 (12%)

Query: 162 VAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY 221
           VA A+   +E+  +  A  + E+ALQR+       L  T K+ +L + DG F++    +Y
Sbjct: 180 VALAMYNTTES-IRGFARASFELALQRK-----MPLYSTTKNTILKRYDGRFKDEFEAMY 233

Query: 222 ESN-KDKF--GSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGV 278
           E+  +++F    I Y  +++D MV +M +    F VI   N  GD+ SD  A   GSLG+
Sbjct: 234 EAEYRERFERAGIWYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGL 292

Query: 279 VPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTALMLEFMGHP 326
           + S  V  D      E  HG+            + +   I++  A  R         G P
Sbjct: 293 MTSVLVTPDGRAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLLQRGRLDGTP 352

Query: 327 EA---AQDIHKAVDANLRDNSIKTPDL 350
           E    A+ +  A  A + ++ I T DL
Sbjct: 353 EVEGFARALETATVATVNEDGIMTKDL 379

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 131/295 (44%), Gaps = 37/295 (12%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTG 159
           V G++ PI+  R   G     +    V+P E  + ++   ++ +       + +   K G
Sbjct: 121 VPGWNEPIIVGRHAFG--DQYKATDVVIPGEGTLKLVFESKDGDKSKNLDLEVFEYPKDG 178

Query: 160 TRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQ 219
             VA  +   +++ T   A  + E+ALQR+       L  T K+ +L + DG F+++   
Sbjct: 179 G-VAMTMYNTTDSIT-GFAKSSFELALQRK-----MPLYSTTKNTILKKYDGKFKDIFEG 231

Query: 220 VYESN-KDKF--GSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSL 276
           +Y +  K+KF    I Y  +++D MV +M +    F +I   N  GD+ SD  A   GSL
Sbjct: 232 MYAAEYKEKFEAAGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSL 290

Query: 277 GVVPSANVGFD--FVVGEPCHGSAP-----DIAGKGIS-NPVATIRSTALMLEFMGHPEA 328
           G++ S  V  D      E  HG+          GK  S N +A+I +    +   G  + 
Sbjct: 291 GLMTSVLVSPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGIIHRGKVDG 350

Query: 329 AQDI-------HKAVDANLRDNSIKTPDLG---GKS------TTQQVVEDVLSRM 367
             D+        K+    +++++I T DL    GK+      TT++ +  V +R+
Sbjct: 351 TPDVVKFGELLEKSTLDTVQEDNIMTKDLALILGKTDRASYVTTEEFITAVANRL 405

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 78/155 (50%), Gaps = 14/155 (9%)

Query: 148 KTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLS 207
           KT K Y  +  G  VA A+    E+ T   A  + E+A++R+       L  T K+ +L 
Sbjct: 167 KTIKVYDYKSPG--VALAMYNTDESIT-GFARASFELAIKRK-----LPLFFTTKNTILK 218

Query: 208 QSDGLFREVCRQVY-ESNKDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDI 264
           + DG F+++ +++Y E  K KF    I Y  +++D MV +M +    F +I   N  GD+
Sbjct: 219 KYDGRFKDIFQKMYDEDYKGKFKELGISYEHRLIDDMVAQMIKSKGGF-IIAMKNYDGDV 277

Query: 265 LSDGAAALVGSLGVVPSANVGFDFVV--GEPCHGS 297
            SD  A   GSLG++ S  +  D  +   E  HG+
Sbjct: 278 QSDIVAQGFGSLGLMTSTLLTPDGKIFESEAAHGT 312

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 66/123 (53%), Gaps = 10/123 (8%)

Query: 162 VAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY 221
           VA  +   +E+ T + A  + E AL+R+       L  T K+ +L Q DG F+++  ++Y
Sbjct: 184 VAMTMYNTTESIT-DFAKASFEFALERK-----IPLYSTTKNTILKQYDGKFKDIFEEMY 237

Query: 222 -ESNKDKFG--SIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGV 278
            +  +DKF   +I Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG+
Sbjct: 238 AKEYEDKFKVLNIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGL 296

Query: 279 VPS 281
           + S
Sbjct: 297 MTS 299

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 101/203 (49%), Gaps = 19/203 (9%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTG 159
           V G+  PI+  R   G     +   +V+P    ++++   EN  +   K  + Y  +  G
Sbjct: 133 VPGWEKPIIIGRHAHG--DQYKATDAVIPGPGKLELVYKPENGPE---KVMEVY--DYKG 185

Query: 160 TRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQ 219
             VA A+   +E + +  A+ + ++AL + K+N    L ++ K+ +L + DG F+++ ++
Sbjct: 186 PGVALAMYN-TEESIRGFAHASFKLALTK-KLN----LYLSTKNTILKKYDGRFKDIFQE 239

Query: 220 VYESN-KDKF--GSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSL 276
           +Y++  K +F    I Y  +++D MV +M +    F ++   N  GD+ SD  A   GSL
Sbjct: 240 LYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSL 298

Query: 277 GVVPSANVGFD--FVVGEPCHGS 297
           G++ S  V  D      E  HG+
Sbjct: 299 GLMTSVLVTPDGKTFESEAAHGT 321

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 123/270 (45%), Gaps = 33/270 (12%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTG 159
           V G+  PIV  R   G     +    V+P   P  + +V + T+    KT + Y  +  G
Sbjct: 140 VPGWEKPIVIGRHAHG--DQYKATDLVVPG--PGKLELVYKPTDGSETKTLEVY--DYKG 193

Query: 160 TRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQ 219
             +A A+    E + +  A+ + ++A+ + K+N    L ++ K+ +L + DG F+++ ++
Sbjct: 194 PGIALAMYNTDE-SIRGFAHASFKLAITK-KLN----LYLSTKNTILKKYDGRFKDIFQE 247

Query: 220 VYESNK----DKFGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           +Y+S      +K G I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 248 IYDSEYKSEFEKLG-IWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGS 305

Query: 276 LGVVPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTALMLEFM 323
           LG++ S  V  D      E  HG+            + +   I++  A  R  A   E  
Sbjct: 306 LGLMTSVLVTPDGKAFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGELD 365

Query: 324 GHPEA---AQDIHKAVDANLRDNSIKTPDL 350
             PE    A  + K+    ++++ I T DL
Sbjct: 366 NTPEVVEFANLLEKSTLNTVQEDGIMTKDL 395

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 126/304 (41%), Gaps = 57/304 (18%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEK-- 157
           V  +S PIV  R   G             Q +  DM++  E    L  K++    D +  
Sbjct: 121 VPQWSKPIVIGRHAFG------------DQYKASDMVVKGEGDLKLVFKSKNGDNDSELD 168

Query: 158 ------TGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDG 211
                 TG  VA A+   SE+     A  + E+ALQR+       L  T K+ +L + DG
Sbjct: 169 VFHFPPTGG-VALAMYNTSESIA-GFARASFELALQRR-----MPLYSTTKNTILKKYDG 221

Query: 212 LFREVCRQVY----ESNKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSD 267
            F++V   +Y    +S  ++ G I Y  +++D MV +M +    F +I   N  GD+ SD
Sbjct: 222 KFKDVFEAMYAAEYQSRFEELG-IWYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSD 279

Query: 268 GAAALVGSLGVVPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRS 315
             A   GSLG++ S  V  D      E  HG+            + +   I++  A  R 
Sbjct: 280 IVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRLHQQGKETSTNSIASIFAWTRG 339

Query: 316 TALMLEFMGHPEA---AQDIHKAVDANLRDNSIKTPDLG---GKS------TTQQVVEDV 363
                +    PE    A+ +  A  A +  + + T DL    GK+      TT++ +E V
Sbjct: 340 ILQRGKLDNTPEVVHFAESLEAATIATVDQDGVMTKDLALMLGKTDRASYVTTEEFIEAV 399

Query: 364 LSRM 367
             R+
Sbjct: 400 ERRL 403

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 95/207 (45%), Gaps = 25/207 (12%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVREN---TEDLYIKTEKTYIDE 156
           V  +  PI   R   G     +   +V+P E  + ++   ++    +DL +       + 
Sbjct: 122 VSQWEKPITIGRHAFG--DQYKATDTVIPDEGELKLVFKSKDGKHDQDLQV------FEF 173

Query: 157 KTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREV 216
             G  VA A+   +E + +  A  + E+AL+R++      L  T K+ +L + DG F+++
Sbjct: 174 PKGGGVAMAMYNTTE-SIEGFAKASFELALERKQ-----PLYSTTKNTILKKYDGKFKDI 227

Query: 217 CRQVYE----SNKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAAL 272
              +YE    S  +K G I Y  +++D MV +M +    + +I   N  GD+ SD  A  
Sbjct: 228 FEAMYEKEYRSQFEKLG-IWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQG 285

Query: 273 VGSLGVVPSANVGFD--FVVGEPCHGS 297
            GSLG++ S  V  D      E  HG+
Sbjct: 286 FGSLGLMTSVLVTPDGKTFESEAAHGT 312

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 124/273 (45%), Gaps = 37/273 (13%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKS---VLPQERPVDMIIVRENTEDLYIKTEKTYIDE 156
           V G+  PI+     +G +A+    K+   ++P    ++++   E+  +      K  + +
Sbjct: 134 VPGWEKPII-----IGRHAHADQYKATDAIIPGPGKLELVYKPEDGSE----PTKLEVYD 184

Query: 157 KTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREV 216
             G  VA A+    E+  +  A+ + ++AL     N +  L ++ K+ +L + DG F+++
Sbjct: 185 YKGAGVALAMYNTDES-IRGFAHASFKLAL-----NKKLNLFLSTKNTILKKYDGRFKDI 238

Query: 217 CRQVYESN-KDKF--GSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALV 273
            ++++++  K +F   +I Y  +++D MV +M +    F ++   N  GD+ SD  A   
Sbjct: 239 FQEIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 297

Query: 274 GSLGVVPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTALMLE 321
           GSLG++ S  V  D      E  HG+            + +   I++  A  R  A   E
Sbjct: 298 GSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGE 357

Query: 322 FMGHPEA---AQDIHKAVDANLRDNSIKTPDLG 351
             G PE    A  +  A    ++++ I T DL 
Sbjct: 358 LDGTPEVTKFANLLESATLNTVQEDGIMTKDLA 390

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 84/180 (46%), Gaps = 17/180 (9%)

Query: 129 QERPVDMIIVRENTEDLYIKTEKT-----YIDEKTGTRVAEAIKRISETATKNIANIALE 183
           Q R  D+II  +    L  ++EK        +   G  +A  +    E + ++ A  +  
Sbjct: 138 QYRATDVIIPSDGILKLTFESEKNGFEIPVFEYPKGGGIAMVMYNTRE-SIESFARASFT 196

Query: 184 IALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKFGS--IKYNEQIVDS 240
           +A++R+       L  T K+ +L Q DG F+++ + VYE+  K+ F    I Y  +++D 
Sbjct: 197 MAIERK-----LPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWYEHRLIDD 251

Query: 241 MVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVGEPCHGSA 298
           MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  D      E  HG+ 
Sbjct: 252 MVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFESEAAHGTV 310

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 99/204 (48%), Gaps = 28/204 (13%)

Query: 191 VNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKFGS--IKYNEQIVDSMVYRMFR 247
           +N +  L ++ K+ +L + DG F+++ +++YES+ K +F +  I Y  +++D MV +M +
Sbjct: 212 INKKLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQMIK 271

Query: 248 EPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVGEPCHGSAPDI---- 301
               F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+        
Sbjct: 272 SKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQY 330

Query: 302 -AGKGIS-NPVATIRSTALMLEFMGHPEAAQDIHK-------AVDANLRDNSIKTPDLG- 351
             GK  S N +A+I + +  L   G  ++  D+ K       A    ++ + I T DL  
Sbjct: 331 EQGKETSTNSIASIFAWSRGLAKRGELDSTPDVIKFANLLESATLNTVQQDGIMTKDLAL 390

Query: 352 --GKS------TTQQVVEDVLSRM 367
             GK+      TT + ++ V +R+
Sbjct: 391 ACGKTERSAYVTTDEFLDAVATRL 414

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 67/130 (51%), Gaps = 11/130 (8%)

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY-ESNKDKFGS- 230
           + +  A  + E+A++R+       L  T K+ +L + DG F++V   +Y ES K+KF S 
Sbjct: 188 SIEGFAKASFELAIERK-----LPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESL 242

Query: 231 -IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGK 301

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 102/212 (48%), Gaps = 26/212 (12%)

Query: 158 TGTR-VAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREV 216
           TG R VA A+    E+  +  A+ + ++AL ++       L ++ K+ +L Q DG F+++
Sbjct: 183 TGARGVALAMYNTDES-IRGFAHASFKLALSKR-----LNLFMSTKNTILKQYDGRFKDI 236

Query: 217 CRQVY-ESNKDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALV 273
            ++VY +  + +F    I Y  +++D MV +M +    F V+   N  GD+LSD  A   
Sbjct: 237 FQEVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGF 295

Query: 274 GSLGVVPSANVGFD--FVVGEPCHGSAP-----DIAGKGIS-NPVATIRSTALML----E 321
           GSLG++ S  V  D      E  HG+          GK  S N +A+I + +  L    E
Sbjct: 296 GSLGLMTSMLVTPDGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGLGKRGE 355

Query: 322 FMGHP---EAAQDIHKAVDANLRDNSIKTPDL 350
             G P   E A+ +  A    ++ + I T DL
Sbjct: 356 LDGTPDVVEFARKLEAATIETVQQHGIMTKDL 387

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 14/142 (9%)

Query: 162 VAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY 221
           V  A+   +E+ T   A  + E+AL+R+       L  T K+ +L + DG F++V  Q+Y
Sbjct: 177 VGMAMYNTTESIT-GFAKASFELALERK-----LPLYSTTKNTILKKYDGKFKDVFEQMY 230

Query: 222 ----ESNKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLG 277
               +S  ++ G I Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG
Sbjct: 231 ADQYQSRFEELG-IWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLG 288

Query: 278 VVPSANVGFD--FVVGEPCHGS 297
           ++ S  V  D      E  HG+
Sbjct: 289 LMTSVLVTPDGKTFESEAAHGT 310

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 11/130 (8%)

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKFGS- 230
           A +  A  + ++AL+RQ       L  T K+ +L + DG F+ V   +YE   K +F   
Sbjct: 190 AIEGFARSSFQLALERQ-----LPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDL 244

Query: 231 -IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V  D  
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGK 303

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 304 TFESEAAHGT 313

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY-ESNKDKFGS- 230
           + K  A  + E+AL+R+       L  T K+ +L + DG F++V   +Y E  K+KF + 
Sbjct: 188 SIKGFAKASFELALERK-----LPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEAL 242

Query: 231 -IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGK 301

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKFGS- 230
           + +  A  + E+A++R+       L  T K+ +L + DG F++V   +Y  N K+KF S 
Sbjct: 188 SIEGFAKASFELAIERK-----LPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESL 242

Query: 231 -IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGK 301

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 103/222 (46%), Gaps = 33/222 (14%)

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY-ESNKDKFGS- 230
           + +  A  + E+A++R+       L  T K+ +L + DG F++V   +Y  S K+KF S 
Sbjct: 188 SIEGFAKASFELAIERK-----LPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESL 242

Query: 231 -IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGK 301

Query: 288 FVVGEPCHGSAP-----DIAGKGIS-NPVATIRSTALMLEFMGHPEAAQDIHK------- 334
               E  HG+          GK  S N +A+I +    +   G  +   D+ K       
Sbjct: 302 TFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILES 361

Query: 335 AVDANLRDNSIKTPDLG---GKS------TTQQVVEDVLSRM 367
           A    ++++ I T DL    GKS      TT++ ++ V SR+
Sbjct: 362 ATVNTVQEDGIMTKDLALILGKSERSAYVTTEEFIDAVESRL 403

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 78/144 (54%), Gaps = 12/144 (8%)

Query: 159 GTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCR 218
           G+ VA A+    E+  +  A+ + ++A+ + K+N    L ++ K+ +L + DG F+++ +
Sbjct: 192 GSGVAMAMYNTDES-IEGFAHSSFKLAIDK-KLN----LFLSTKNTILKKYDGRFKDIFQ 245

Query: 219 QVYESN-KDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           +VYE+  K KF +  I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 246 KVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 276 LGVVPSANVGFD--FVVGEPCHGS 297
           LG++ S  V  D      E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 77/144 (53%), Gaps = 12/144 (8%)

Query: 159 GTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCR 218
           G+ VA A+    E+  +  A+ + ++A+ + K+N    L ++ K+ +L + DG F+++ +
Sbjct: 192 GSGVAMAMYNTDES-IEGFAHSSFKLAIDK-KLN----LFLSTKNTILKKYDGRFKDIFQ 245

Query: 219 QVYESN-KDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           +VYE+  K KF    I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 246 EVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 276 LGVVPSANVGFD--FVVGEPCHGS 297
           LG++ S  V  D      E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 93/209 (44%), Gaps = 30/209 (14%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTE------KTY 153
           V G+  PI+  R   G             Q +  D ++    T DL  +          +
Sbjct: 139 VPGWEKPIIIGRHAHG------------DQYKATDAVVPGAGTLDLVFRPADGSAPTSLH 186

Query: 154 IDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLF 213
           + +  G  VA A+   +E + +  A+ +  +AL +Q       L ++ K+ +L Q DG F
Sbjct: 187 VYDFAGPGVALAMYN-TEESIRGFAHASFRLALAKQ-----LNLFLSTKNTILKQYDGRF 240

Query: 214 REVCRQVYESN-KDKFG--SIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAA 270
           ++V  ++Y++  K +F    I Y  +++D MV +M +    F ++   N  GD+ SD  A
Sbjct: 241 KDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVA 299

Query: 271 ALVGSLGVVPSANVGFD--FVVGEPCHGS 297
              GSLG++ S  V  D      E  HG+
Sbjct: 300 QGFGSLGLMTSVLVTPDGKTFESEAAHGT 328

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 103/206 (50%), Gaps = 22/206 (10%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVK---SVLPQERPVDMIIVRENTEDLYIKTEKTYIDE 156
           + G+  PI+     +G +A+    K   +++P    + +  +  N ++    T   Y  +
Sbjct: 137 IPGWEKPII-----IGRHAHADQYKATDTLIPGPGKLQLNFIPSNAQENSPITLDVY--D 189

Query: 157 KTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREV 216
             G+ VA A+    E+  +  A+ + ++A+ + K+N    L ++ K+ +L + DG F+++
Sbjct: 190 YKGSGVALAMYNTDES-IEGFAHSSFKLAIDK-KLN----LFLSTKNTILKKYDGRFKDI 243

Query: 217 CRQVYESN-KDKFG--SIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALV 273
            + +YE++ K KF   +I Y  +++D MV +M +    F ++   N  GD+ SD  A   
Sbjct: 244 FQSIYETHYKAKFQQLNINYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 302

Query: 274 GSLGVVPSANVGFD--FVVGEPCHGS 297
           GSLG++ S  V  D      E  HG+
Sbjct: 303 GSLGLMTSILVTPDGKTFESEAAHGT 328

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 77/144 (53%), Gaps = 12/144 (8%)

Query: 159 GTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCR 218
           G+ VA A+    E+  +  A+ + ++A+ + K+N    L ++ K+ +L + DG F+++ +
Sbjct: 193 GSGVAMAMYNTDES-IEGFAHSSFKLAIDK-KLN----LFLSTKNTILKKYDGRFKDIFQ 246

Query: 219 QVYESN-KDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           +VYE+  K KF    I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 247 EVYEAEYKSKFEKLGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 305

Query: 276 LGVVPSANVGFD--FVVGEPCHGS 297
           LG++ S  V  D      E  HG+
Sbjct: 306 LGLMTSILVTPDGKTFESEAAHGT 329

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY-ESNKDKFGS--IKY 233
            A  + E AL+R+       L  T K+ +L + DG F+++   +Y E  ++KF +  I Y
Sbjct: 203 FARSSFEFALERK-----LPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 234 NEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVG 291
             +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 317 EAAHGT 322

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 65/130 (50%), Gaps = 11/130 (8%)

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKFGSI 231
           + K  A  + E+AL+R+       L  T K+ +L   D  F+++   +++   K+KF ++
Sbjct: 188 SIKGFAKASFELALKRK-----LPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQAL 242

Query: 232 K--YNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
           K  Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 243 KITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGK 301

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 68/133 (51%), Gaps = 11/133 (8%)

Query: 170 SETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKF 228
           ++ + +  A  + ++A++R+       L  T K+ +L + DG+F+++   +YE   K+KF
Sbjct: 188 TKESIEGFAKASFQLAVERK-----MPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKF 242

Query: 229 GS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGF 286
               I Y  +++D MV +M +    + +I   N  GD+ SD  A   GSLG++ S  +  
Sbjct: 243 EELGIWYEHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITP 301

Query: 287 D--FVVGEPCHGS 297
           D      E  HG+
Sbjct: 302 DGKTFESEAAHGT 314

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 68/130 (52%), Gaps = 11/130 (8%)

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKFGS- 230
           + ++ A  + E+AL+R+       L    K+ +L + DGLF+++  ++Y+ + K KF   
Sbjct: 191 SIESFAKSSFELALKRK-----LPLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEEL 245

Query: 231 -IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFV 289
            I +  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V  D  
Sbjct: 246 GITFEHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDS 304

Query: 290 V--GEPCHGS 297
           V   E  HG+
Sbjct: 305 VFESEAAHGT 314

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 110/236 (46%), Gaps = 34/236 (14%)

Query: 159 GTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCR 218
           G+ VA A+    E + +  A+ + ++AL + K+N    L ++ K+ +L + DG F+++ +
Sbjct: 190 GSGVALAMYNTDE-SIRGFAHSSFKLALTK-KLN----LFLSTKNTILKKYDGRFKDIFQ 243

Query: 219 QVYESN-KDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           ++++   K KF +  I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 244 EIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 302

Query: 276 LGVVPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTALMLEFM 323
           LG++ S  V  D      E  HG+            + +   I++  A  R  A   E  
Sbjct: 303 LGLMTSILVTPDGKTFESEAAHGTVTRHYRKFQKGEETSTNSIASIFAWSRGLAKRGELD 362

Query: 324 GHPEA---AQDIHKAVDANLRDNSIKTPDLG---GKS------TTQQVVEDVLSRM 367
           G P+    A  +  A    ++ + I T DL    GK+      TT + ++ V  R+
Sbjct: 363 GTPDVVRFANLLEAATLNTVQQDGIMTKDLALAQGKTDRSSYVTTDEFIDAVEKRL 418

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 83/174 (47%), Gaps = 17/174 (9%)

Query: 170 SETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKF 228
           ++ + +  A+ + ++AL     N +  L +  K+ +L + DG F+++ +Q+Y    K KF
Sbjct: 197 TDESIEGFAHSSFQVAL-----NKKLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKF 251

Query: 229 G--SIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGF 286
               I Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V  
Sbjct: 252 EQLGITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSP 310

Query: 287 D--FVVGEPCHGSAP------DIAGKGISNPVATIRSTALMLEFMGHPEAAQDI 332
           D      E  HG+         +  +  +N +A+I + +  L   G  +  +D+
Sbjct: 311 DGKTFESEAAHGTVTRHFRRHQMGEETSTNSIASIFAWSRGLAKRGELDGTKDV 364

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 76/144 (52%), Gaps = 12/144 (8%)

Query: 159 GTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCR 218
           G+ VA A+    E+  +  A+ + ++A+ + K+N    L ++ K+ +L + DG F+++ +
Sbjct: 193 GSGVAMAMYNTDES-IEGFAHSSFKMAIDK-KLN----LFLSTKNTILKKYDGRFKDIFQ 246

Query: 219 QVYESN-KDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGS 275
            +YE+  K KF    I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 247 NIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGS 305

Query: 276 LGVVPSANVGFD--FVVGEPCHGS 297
           LG++ S  V  D      E  HG+
Sbjct: 306 LGLMTSILVTPDGKTFESEAAHGT 329

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 170 SETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY-ESNKDKF 228
           +  + +  A  + E+AL+R+       L  T K+ +L   D  F+++   ++ E  ++KF
Sbjct: 185 TNNSIEGFAKASFELALKRK-----LPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKF 239

Query: 229 GS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGF 286
            +  IKY  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V  
Sbjct: 240 QALGIKYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTP 298

Query: 287 D--FVVGEPCHGS 297
           D      E  HG+
Sbjct: 299 DGKTFESEAAHGT 311

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 91/201 (45%), Gaps = 19/201 (9%)

Query: 103 YSSPIVALRKKLGLYANVRPVKSVLPQERPVDMII-VRENTEDLYIKTEKTYIDEKTGTR 161
           +  PI+  R   G     R    V+P E  V ++   ++   D+ I     Y   K G  
Sbjct: 124 WKEPIIIGRHAFG--DQYRATDVVIPDEGEVRLVYKSKDGKTDIDIPV---YNFPKEGG- 177

Query: 162 VAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVY 221
           VA  +   +E + +  A  +  +AL+      E  L  T K+ +L + DG F++    +Y
Sbjct: 178 VAMMMYNTTE-SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMY 231

Query: 222 ESN-KDKFGS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGV 278
           E+  K++F +  I Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG+
Sbjct: 232 EAEYKEQFEAKGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGL 290

Query: 279 VPSANVGFD--FVVGEPCHGS 297
           + S  +  D      E  HG+
Sbjct: 291 MTSVLISPDGKTFESEAAHGT 311

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKFGS--IKY 233
            A  + E+AL+R+       L  T K+ +L   D  F+E+  +++++  K+KF +  I Y
Sbjct: 192 FAKASFELALKRR-----LPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 234 NEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVV--G 291
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 306 EAAHGT 311

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKFGS- 230
           + K  A  + E+AL+R+       L  T K+ +L   D  F+++  +++++  K++F + 
Sbjct: 188 SIKGFAKASFELALKRK-----LPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQAL 242

Query: 231 -IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 243 GITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGK 301

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 86/176 (48%), Gaps = 21/176 (11%)

Query: 170 SETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKF 228
           ++ + +  A+ + ++AL ++       L ++ K+ +L + DG F+++ ++++++  K +F
Sbjct: 202 TDESIRGFAHASFKLALSKK-----LDLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQF 256

Query: 229 --GSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGF 286
               I+Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V  
Sbjct: 257 EESGIQYQHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 315

Query: 287 D--FVVGEPCHGSAPDIAGK------GISNPVATI----RSTALMLEFMGHPEAAQ 330
           D      E  HG+      K        +NP+A+I    R  A   E  G P+  +
Sbjct: 316 DGKTFESEAAHGTVTRHYRKYQRGEETSTNPIASIFAWTRGIAKRGELDGTPDVVR 371

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 90/195 (46%), Gaps = 25/195 (12%)

Query: 197 LTVTHKSNVLSQSDGLFREVCRQVY-ESNKDKFGS--IKYNEQIVDSMVYRMFREPECFD 253
           L  T K+ +L + DG F+++  ++Y    KD+F    I Y  +++D MV +M +    F 
Sbjct: 211 LYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQMLKSKGGF- 269

Query: 254 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVGEPCHGSAP-----DIAGKGI 306
           +I   N  GD+ SD  A   GSLG++ S  +  D      E  HG+         AGK  
Sbjct: 270 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGTVTRHYRLHQAGKPT 329

Query: 307 S-NPVATIRSTALMLEFMGHPEAAQDIHK-------AVDANLRDNSIKTPDL------GG 352
           S N +A+I + +  L   G  +   D+ K       +    ++ + I T DL      G 
Sbjct: 330 STNSIASIFAWSRGLIQRGKLDNNPDLVKFGELLEQSTLDTVQIDGIMTKDLALLIGQGK 389

Query: 353 KSTTQQVVEDVLSRM 367
            +TT+  ++ V +RM
Sbjct: 390 YATTEGFIDAVTNRM 404

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 53/94 (56%), Gaps = 4/94 (4%)

Query: 191 VNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKFG--SIKYNEQIVDSMVYRMFR 247
           VN    L +  K+ +L + DG F+++ +++YE+  K +F   +I Y  +++D MV +M +
Sbjct: 216 VNKNMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQMIK 275

Query: 248 EPECFDVIVAPNLYGDILSDGAAALVGSLGVVPS 281
               + ++   N  GD+ SD  A   GSLG++ S
Sbjct: 276 SKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTS 308

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 66/115 (57%), Gaps = 9/115 (7%)

Query: 170 SETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKF 228
           ++ + +  A+ + ++AL + K+N    L ++ K+ +L   DG F+++ +++Y++  K +F
Sbjct: 198 TDESIRGFAHASFKLALTK-KLN----LFLSTKNTILKTYDGRFKDIFQELYDTQYKTEF 252

Query: 229 GS--IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPS 281
            +  I Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S
Sbjct: 253 ENHGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTS 306

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 173 ATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESN-KDKFGSI 231
           + K  A  +  +AL+R+       L +  K+ +L + DG F+ +   +Y++  K+KF  +
Sbjct: 191 SIKGFAKASFIMALKRK-----LPLFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKL 245

Query: 232 --KYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
              Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 246 GLTYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGK 304

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 305 TFQSEAAHGT 314

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 75/144 (52%), Gaps = 12/144 (8%)

Query: 159 GTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCR 218
           G  VA A+    E + +   + + ++AL + K+N    L ++ K+ +L + DG F+++ +
Sbjct: 186 GPGVALAMYNTDE-SIRGFGHASFKLALDK-KLN----LYLSTKNTILKKYDGRFKDIFQ 239

Query: 219 QVYESN-KDKF--GSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           ++Y++  K +F    I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 240 ELYDTQYKAEFEKAGIFYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGS 298

Query: 276 LGVVPSANVGFD--FVVGEPCHGS 297
           LG++ S  +  D      E  HG+
Sbjct: 299 LGLMTSVLITPDGKTFESEAAHGT 322

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 103/250 (41%), Gaps = 30/250 (12%)

Query: 57  IDLQAGWQTFQETGKALPDETIDILRNQCQGALFG---AVQSPTNKVEGYSSPIVALRKK 113
            DL+  W++        P+ TI   RN   G LF     + +    V  +  PI+  R  
Sbjct: 93  FDLKKMWKS--------PNGTI---RNVLGGTLFREPIVIDNIPRLVPNWEKPIIIGRHA 141

Query: 114 LGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETA 173
            G     + +  V+P +  + ++       D  I        E  G  VA  +    E +
Sbjct: 142 FGDQYKAKDL--VIPHDGQLKIVFKSNKGPDQDIDLNVFQFPECGG--VAMMMYNTIE-S 196

Query: 174 TKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFG---S 230
            +  A  + ++AL+R+       L  T K+ +L + DG F+++   +YE    +      
Sbjct: 197 IEGFALSSFKLALERK-----MPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELG 251

Query: 231 IKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--F 288
           I Y  +++D MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  D   
Sbjct: 252 IWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKS 310

Query: 289 VVGEPCHGSA 298
              E  HG+ 
Sbjct: 311 FESEAAHGTV 320

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 33.1 bits (74), Expect = 0.092,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 318 LMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVVEDVLSRM 367
           LML  +G  E+A  I KAV   + +    T D+GG S+T     ++++++
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>KAFR0A01320 Chr1 complement(252704..258001) [5298 bp, 1765 aa] {ON}
           Anc_1.253 YJL109C
          Length = 1765

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 12/112 (10%)

Query: 150 EKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQS 209
           E T I +K  T    AI R   +   NI NI  ++ L++ +V     + + H S +L   
Sbjct: 341 EGTLICDKFITSYIRAIARYDHSKLSNIVNILEKVKLEKFEVRM-LIIDLIHLSEILDDK 399

Query: 210 DGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLY 261
             L      Q++E        IK NE++V + +  +   PE F++ +  +L+
Sbjct: 400 SQLI-----QLFE------YFIKINEKLVINCLKSLNLTPELFEIRLTTSLF 440

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,445,968
Number of extensions: 1486939
Number of successful extensions: 4703
Number of sequences better than 10.0: 145
Number of HSP's gapped: 4493
Number of HSP's successfully gapped: 145
Length of query: 367
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 256
Effective length of database: 40,753,473
Effective search space: 10432889088
Effective search space used: 10432889088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)