Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G10362g2.286ON52952926890.0
Kwal_27.115322.286ON47948321510.0
SAKL0E07678g2.286ON47748418620.0
KLLA0E08361g2.286ON49149318240.0
KAFR0H033102.286ON48849216920.0
Ecym_33252.286ON49648816650.0
NDAI0G006602.286ON49649616630.0
TPHA0C034002.286ON49449316450.0
CAGL0M06941g2.286ON49249216380.0
ADL215W2.286ON48448816300.0
KNAG0H020002.286ON49849616170.0
Kpol_1003.382.286ON49649615860.0
TDEL0G021702.286ON48448915800.0
TBLA0B069602.286ON50850815710.0
ZYRO0A01892g2.286ON46548715620.0
Suva_14.3252.286ON49048915590.0
YNL022C2.286ON49049015580.0
Skud_14.3072.286ON49048915580.0
NCAS0G037902.286ON49249415270.0
Smik_14.3092.286ON49048915120.0
ADL254W2.247ON6032401616e-11
ZYRO0G08998g8.171ON6832981601e-10
ZYRO0A01562g2.247ON6172401554e-10
KLLA0F03399g2.247ON6192361536e-10
TBLA0E038502.247ON6322361537e-10
TPHA0H001508.171ON6492941528e-10
SAKL0E08624g2.247ON6112401521e-09
KAFR0J009702.247ON6102361502e-09
Ecym_32842.247ON6062401492e-09
KLTH0G09460g2.247ON6372401492e-09
Smik_14.2662.247ON6182601492e-09
TDEL0C041502.247ON6142601492e-09
NCAS0G030302.247ON4902361482e-09
CAGL0J10032g2.247ON6192401492e-09
TDEL0B043908.171ON6733001492e-09
Kpol_1003.152.247ON6332401482e-09
KNAG0I018702.247ON6292401483e-09
NDAI0D010502.247ON6252401464e-09
YNL061W (NOP2)2.247ON6182361464e-09
KNAG0D020508.171ON6822991465e-09
Suva_2.978.171ON6703001456e-09
TPHA0C031502.247ON6082401456e-09
Suva_14.2802.247ON6202361456e-09
NDAI0B018308.171ON6862991457e-09
Kpol_1002.1098.171ON6703001431e-08
Kwal_23.48412.247ON6272661431e-08
Skud_2.818.171ON6812991421e-08
Skud_14.2712.247ON6192451412e-08
SAKL0H19448g8.171ON6912951403e-08
NCAS0B056408.171ON6593011403e-08
AFR179C8.171ON7002951393e-08
Smik_2.928.171ON6743001393e-08
NCAS0B043908.171ON6712971375e-08
YBL024W (NCL1)8.171ON6842991375e-08
KAFR0B022208.171ON6862991322e-07
Ecym_23538.171ON6902931313e-07
TBLA0A087408.171ON6863061313e-07
KLTH0H08096g8.171ON6882951295e-07
KNAG0G015108.171ON6663021271e-06
KLLA0F12562g8.171ON7043021252e-06
CAGL0K01991g8.171ON6722931242e-06
TPHA0C028708.171ON6742981224e-06
NDAI0B029808.171ON6793031181e-05
Kwal_14.20818.171ON272128780.47
AGR036W3.277ON30683770.74
SAKL0A05478g6.174ON57832723.6
Ecym_30036.1ON31971705.0
Kpol_392.78.260ON2995169706.8
ZYRO0B13992g4.315ON1220191697.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G10362g
         (529 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...  1040   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   833   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   721   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   707   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   656   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   645   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   645   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   638   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   635   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   632   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   627   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   615   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   613   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   609   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   606   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   605   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   604   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   604   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   592   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   587   0.0  
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    67   6e-11
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    66   1e-10
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    64   4e-10
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    64   6e-10
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    64   7e-10
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    63   8e-10
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    63   1e-09
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    62   2e-09
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    62   2e-09
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    62   2e-09
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    62   2e-09
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    62   2e-09
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    62   2e-09
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    62   2e-09
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    62   2e-09
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    62   2e-09
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    62   3e-09
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    61   4e-09
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    61   4e-09
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    61   5e-09
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    60   6e-09
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    60   6e-09
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    60   6e-09
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    60   7e-09
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    60   1e-08
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    60   1e-08
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    59   1e-08
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    59   2e-08
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    59   3e-08
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    59   3e-08
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    58   3e-08
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    58   3e-08
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    57   5e-08
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    57   5e-08
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    55   2e-07
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    55   3e-07
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    55   3e-07
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    54   5e-07
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    54   1e-06
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    53   2e-06
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    52   2e-06
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    52   4e-06
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    50   1e-05
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    35   0.47 
AGR036W Chr7 (774273..775193) [921 bp, 306 aa] {ON} Syntenic hom...    34   0.74 
SAKL0A05478g Chr1 (498526..500262) [1737 bp, 578 aa] {ON} simila...    32   3.6  
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    32   5.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...    32   6.8  
ZYRO0B13992g Chr2 complement(1137166..1140828) [3663 bp, 1220 aa...    31   7.8  

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score = 1040 bits (2689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/529 (95%), Positives = 505/529 (95%)

Query: 1   MDAQVFLVTTQFIKNFIDNMXXXXXXXXXXXXXXPNTADKRLDVPIMNFYRDATWVLEYV 60
           MDAQVFLVTTQFIKNFIDNM              PNTADKRLDVPIMNFYRDATWVLEYV
Sbjct: 1   MDAQVFLVTTQFIKNFIDNMKSKLIAKKHLLLKKPNTADKRLDVPIMNFYRDATWVLEYV 60

Query: 61  ESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEFLDKLLKRSGILKDI 120
           ESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEFLDKLLKRSGILKDI
Sbjct: 61  ESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEFLDKLLKRSGILKDI 120

Query: 121 PKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKARLSSELVRLKIKLKV 180
           PKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKARLSSELVRLKIKLKV
Sbjct: 121 PKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKARLSSELVRLKIKLKV 180

Query: 181 TDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTRVNSWTNIAPGCIYHD 240
           TDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTRVNSWTNIAPGCIYHD
Sbjct: 181 TDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTRVNSWTNIAPGCIYHD 240

Query: 241 EYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTT 300
           EYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTT
Sbjct: 241 EYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTT 300

Query: 301 HVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEVHVGDFTQLAKPGKFP 360
           HVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEVHVGDFTQLAKPGKFP
Sbjct: 301 HVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEVHVGDFTQLAKPGKFP 360

Query: 361 DVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKL 420
           DVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPV          DISDKDLKNRLEKL
Sbjct: 361 DVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEKEEEREDISDKDLKNRLEKL 420

Query: 421 ASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVRKRAGVIP 480
           ASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVRKRAGVIP
Sbjct: 421 ASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVRKRAGVIP 480

Query: 481 TWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGFFAVCFERD 529
           TWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGFFAVCFERD
Sbjct: 481 TWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGFFAVCFERD 529

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/483 (80%), Positives = 432/483 (89%), Gaps = 4/483 (0%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           MNFYRDATWVLEYVE AE  GRVAGSLQTLVLNSCKKY LKTNPKH+YAAVYSCWRYNEF
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+KLLK+S ILKD+PKKKGKE+FNPTTIKLLVHDLLF+KNKRIQMGKHPLKEFVLK+K R
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 167 LSSELVRLKIKLKVTDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTRV 226
           L+SELVRLKIKLKVTDL QLLKDDRNDMTPVRWFR+NP+RC  K E+++ EL+KKFPTRV
Sbjct: 121 LNSELVRLKIKLKVTDLHQLLKDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTRV 180

Query: 227 NSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSED 286
           +SW ++ PG IYHDEYIP LFGVHP DKITSHELYKTGK+IIQDRASCFPAHILN S  D
Sbjct: 181 DSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPSD 240

Query: 287 LIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEVH 346
           +IIDACAAPGNKTTHVAAH+F +   +   IHAFEKDPERAKTLRTM+ TAGC+KGI +H
Sbjct: 241 VIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGINIH 300

Query: 347 VGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXXXXXXX 406
           VGDFT+LAKP  FP+V+GFI+DPSCSGSGIFGR++IDD NKS+ +GA P           
Sbjct: 301 VGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPT----QEEERQ 356

Query: 407 DISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLLDSKVK 466
           +I  KD+KNRL KLASFQFEIVK+A+SFPSAKKLVYSTCS+HAEENERIV+DLLLDSKVK
Sbjct: 357 EIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKVK 416

Query: 467 EWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGFFAVCF 526
           EWGWRVRKRAG IPTW RRGFY EFE+VFR+ DTAKELAEACIRVAPKEDGGIGFFAVCF
Sbjct: 417 EWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDGGIGFFAVCF 476

Query: 527 ERD 529
           ERD
Sbjct: 477 ERD 479

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/484 (71%), Positives = 405/484 (83%), Gaps = 8/484 (1%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           MN YRDATWV EYVE  E  G++AGSLQTLVLNSCK+Y+LKTNPKH+YA V+SCW+Y  F
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K+LK+SGILKDIPKKKG+  F+ TTI LLVHDLL SKNKRIQMGKHP+KEFVLK+K R
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 167 LSSELVRLKIKLKVTDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTRV 226
           L +EL +LK+KL+VT+L QL+KDD NDMTPVRW R+NP+RC  K +D+  EL KKFPT+V
Sbjct: 121 LQAELAKLKVKLRVTNLSQLVKDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTKV 180

Query: 227 NSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSED 286
           ++W+ I PG IYHDE+IP LFGVHPADKITSHELYK GK+IIQDRASCFPAHILN + ED
Sbjct: 181 SNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPED 240

Query: 287 LIIDACAAPGNKTTHVAAHIFQDQAV-ESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           +IID+C+APGNKTTHVAAH+F  + V +  +IHAFEKDPERAKTL+ MI  AGC K IEV
Sbjct: 241 VIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIEV 300

Query: 346 HVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXXXXXX 405
           HVGDFT+LAKP KF  VTGFI+DPSCSGSGIFGRK+IDD N                   
Sbjct: 301 HVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNE-------VLPEEEQE 353

Query: 406 XDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLLDSKV 465
            +  D+DLK RL KL+SFQF+I+KHAMSFP+AKKLVYSTCS+HAEENER+V+DLLLD KV
Sbjct: 354 KEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDKV 413

Query: 466 KEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGFFAVC 525
           ++WGWRVRKRAGVIPTWSRRGF +EF++V++D+  A+ELA+ CIR  PKEDGGIGFFAVC
Sbjct: 414 QQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVC 473

Query: 526 FERD 529
           FERD
Sbjct: 474 FERD 477

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/493 (69%), Positives = 400/493 (81%), Gaps = 12/493 (2%)

Query: 47  MNFYRDATWVLEYVESA-EKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNE 105
           M FYRDATWVLE+VE    K  RVAGSLQTLVL SCK+Y+LKTNP+HIYA V S W+Y E
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 106 FLDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKA 165
           +LDK++K+SGIL+D+PKKKGK +FN  TI+LLVHDLL SK+KRIQMGKHP+K F+LK++ 
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 166 RLSSELVRLKIKLKVTDLQQLLK-DDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPT 224
           RL +EL +LK+KLKVT L QL+K DD  D+TPVRW R+NPI    + +D+L EL+KKFP 
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180

Query: 225 RVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASS 284
           RVNSW  I PG IY+DEYIP LFG+HP DKITSHE YK GK+IIQDRASCFPAHILN +S
Sbjct: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240

Query: 285 EDLIIDACAAPGNKTTHVAAHIFQ--DQAVESVRIHAFEKDPERAKTLRTMINTAGCTKG 342
            D++IDACAAPGNKTTHVAAHIF   D  V+SV+IHAFEKDPERAKTL+ M+ TAGC KG
Sbjct: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300

Query: 343 IEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXXX 402
           +++HVGDFT+L KP  F +VTGFI+DPSCSGSGIFGRK ID  N SK  G+S        
Sbjct: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKT-GSSNTDEDQTS 359

Query: 403 XXXXDIS------DKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIV 456
               +        ++DLKNRL KL+SFQ++IVKHAMSFPSAKK+ YSTCS+HAEENER+V
Sbjct: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419

Query: 457 VDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKED 516
           +DLLLDSKVKEWGW+VRKR GVIPTW RRG+  EFEEVF  E+ AKELAE CIR  PKED
Sbjct: 420 IDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEE-AKELAEGCIRALPKED 478

Query: 517 GGIGFFAVCFERD 529
           GGIGFFAVCFERD
Sbjct: 479 GGIGFFAVCFERD 491

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/492 (64%), Positives = 387/492 (78%), Gaps = 14/492 (2%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           M FYRDATWVLEY+E  +  GR++GSLQ+LVL SC+KY+LKTNPKHIYA + SCW+Y  F
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K++ +SGILKDIPKKKGK V+   T+ LL+HDLL SK KRIQMGKHP+K FVL+YK+R
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 167 LSSELVRLKIKLKVTDLQQLLK--DDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPT 224
           L SELV+LK+K KV DL +L+   D  ND+TPVRWFR+NP+RC   S  +++EL KKFP 
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDASA-VMKELEKKFPQ 179

Query: 225 RVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASS 284
           RV SW  I PG IYHDE+IP LFG+HP DKITSHELYK G++IIQDRASCFPAHILN + 
Sbjct: 180 RVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTL 239

Query: 285 EDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIE 344
           ED IIDAC+APGNKTTHVA+++F +  V+ VRI AFEKDPERAK L+ MI  AGC+K I 
Sbjct: 240 EDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQIS 299

Query: 345 VHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSK-----ADGASPVXXX 399
           V+VGDFT+LA P KFPDVTGFI+DPSCSGSGIFGRK ID  N+ K      D   P    
Sbjct: 300 VNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVP---- 355

Query: 400 XXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDL 459
                  +  + +L+ RL KL+SFQF++VKHAMSFP AK++VYSTCS+HAEENER+ +DL
Sbjct: 356 DEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDL 415

Query: 460 LLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTA--KELAEACIRVAPKEDG 517
           LLD KVK+WGW++ KR  VIP W RRGF  EF+E+FRD+  +  +E+A+ CIR  P+EDG
Sbjct: 416 LLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDG 475

Query: 518 GIGFFAVCFERD 529
           GIGFFA+CFERD
Sbjct: 476 GIGFFAICFERD 487

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/488 (63%), Positives = 376/488 (77%), Gaps = 2/488 (0%)

Query: 43  DVPIMNFYRDATWVLEYVESA-EKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCW 101
           D+  M FYRD++WVLEY+E    K  R++GSLQTLVL SCK+Y+LKTNPKHIYA V SCW
Sbjct: 10  DILKMEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCW 69

Query: 102 RYNEFLDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVL 161
           +Y  +L+K++K SG+L D+P KKG+ VF+ TTI LLVHDLL SKNKRI MGKHP+K FVL
Sbjct: 70  KYKMYLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVL 129

Query: 162 KYKARLSSELVRLKIKLKVTDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKK 221
           K + RLS E  ++ +KLKV  L +L++D+  DM+PVRW R+NP RC  K +D+L+EL KK
Sbjct: 130 KRQVRLSGEFKKMLVKLKVKSLSELVEDNDADMSPVRWIRINPFRCQGKVDDVLKELRKK 189

Query: 222 FPTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILN 281
           FP +V+ WT I PG IY DEYIP L+GVHP+DKITSHELYK GK+IIQDRASCFPA+ILN
Sbjct: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249

Query: 282 ASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTK 341
            +  D++IDAC+APGNKTTH+AAHIF D     V+I+AFE+D +RA+ L  M+ +AGC  
Sbjct: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCES 309

Query: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
            I++ VGDFTQLAKP  F DVTGFILDPSCSGSGIFGR+ +D  NKSK     P      
Sbjct: 310 CIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEE 369

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461
                   ++  K RL KL+SFQF+IVKHAMSFP+AKKLVYSTCS+HAEENER+V+DLLL
Sbjct: 370 QDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 429

Query: 462 DSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGF 521
           D  +K++GW+V KR  VIP W RRG   EFEEVF  E  A+ELA+ CIR  PKEDGGIGF
Sbjct: 430 DQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQ-AQELADGCIRALPKEDGGIGF 488

Query: 522 FAVCFERD 529
           FAVCFER+
Sbjct: 489 FAVCFERE 496

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/496 (64%), Positives = 388/496 (78%), Gaps = 14/496 (2%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           MNFYRDATWVLEYVE  E  GR++GSLQTLVL SC KY+LK NPKH+YA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K++K+SGIL DIPKKKGK +++  T+ LL HDLLFSK+KRIQMGKHP+KE+VLK+K+R
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222
           L SELVRLK+KLKV +L +++   D   D+TPVRW R+NP+RC  G     +L+EL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282
           P RV +W +I PG IY+DEYIP L+G+HP DKITSHELYK GK+IIQDRASCFPAHILN 
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVES--VRIHAFEKDPERAKTLRTMINTAGCT 340
           S +D+IIDACAAPGNKTTHVA+++F D   E   V+I+AFEKDPERAK L  MI  AGC+
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 341 KGIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSK------ADGAS 394
           K I+V VGDFT+ A P KF DVTGFI+DPSCSGSGIFGRK +D  N+ +       D  S
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 395 PVXXXXXXXXXXDISDK-DLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENE 453
                       D + K DLK RL KL+SFQF+++KHAMSFP+AKK+VYSTCS+HAEENE
Sbjct: 361 TEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420

Query: 454 RIVVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT-AKELAEACIRVA 512
           R+V+DLLLDSKVK+WGW+V  +  VIPTW RRG  +EFEEVFRD+    + LA+ CIR  
Sbjct: 421 RVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRAL 480

Query: 513 PKEDGGIGFFAVCFER 528
           P++DGGIGFFAVCFER
Sbjct: 481 PRDDGGIGFFAVCFER 496

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/493 (62%), Positives = 378/493 (76%), Gaps = 10/493 (2%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           MNFYRDATWVLE++E  +  G+++GS+Q++VL SCK Y++++NPKHIYA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+ ++K+SGIL +IPKK GK  F   TI LL HDLLFSK+KRIQMGKHPLKE+VLKYK  
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222
           L SE+V+L++K+K+     L+  +DD ND+TPVRWFR+NPIR       E IL+EL KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282
           PTRV+ W+ I  G IYHDE+IP LFGVH  DKITSHELYK GK+IIQDRASCFPAH+LN 
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAV-ESVRIHAFEKDPERAKTLRTMINTAGCTK 341
             +D++ID+CAAPGNKTTH AA+I    +  + ++IHAFEKDPERAK L+ M+ TAGC +
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
            IEV+VGDFT++A P KF +VTGFI+DPSCSGSGIFGRK ID  NK K            
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360

Query: 402 ---XXXXXDISDK-DLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVV 457
                   + S K DLK RL KLASFQF++VKHAM+FP A+KLVYSTCS+HAEENER+V+
Sbjct: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420

Query: 458 DLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFR-DEDTAKELAEACIRVAPKED 516
           DLLLD  +K+ GWRV  R  VIPTW RRG+  EF+EVFR DE+  KE+A  CIR  PKED
Sbjct: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKED 480

Query: 517 GGIGFFAVCFERD 529
           GGIGFFAVCFERD
Sbjct: 481 GGIGFFAVCFERD 493

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/492 (64%), Positives = 383/492 (77%), Gaps = 9/492 (1%)

Query: 47  MNFYRDATWVLEYVESA-EKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNE 105
           M FYRD+TWVLEY+E   EK GRV+GSLQT+VL  CK+Y++KTNPKHIYA V SCW+Y  
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 106 FLDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKA 165
           +LDK++K+SG+L  IP+KKGK  F+  T+ LL HDLL SK KRIQMGKHP+K +VLKYK 
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 166 RLSSELVRLKIKLKVTDLQQLLKDDRND--MTPVRWFRLNPIRCGAKSED-ILQELSKKF 222
            L++E V+LKIKLK+TDL Q++  D     MTPVRW R+NP+R      D +L EL KKF
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180

Query: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282
           PTRVN+W +I PG IY+DE+IP L+G+H +DKITSHELYK GK+IIQDRASCFPAHILN 
Sbjct: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAV---ESVRIHAFEKDPERAKTLRTMINTAGC 339
           S++D++IDAC+APGNKTTHVAAHIF D      ++V+I+AFEKDPERA+ L+ MI TAGC
Sbjct: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300

Query: 340 TKGIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXX 399
            K I+V+VGDFTQ+A P K+ DVTGFILDPSCSGSGIFGRK +D  N         V   
Sbjct: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE 360

Query: 400 XXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDL 459
                  D  ++ LK RL KLASFQF+IV+HAMSFP+AKK+VYSTCS+HAEENER+V+DL
Sbjct: 361 NDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVIDL 420

Query: 460 LLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRD--EDTAKELAEACIRVAPKEDG 517
           LLD KV+ WGWRV K+  V+PTW RRGF +EF+EVF D  E   +ELA+ C+R  PKEDG
Sbjct: 421 LLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDG 480

Query: 518 GIGFFAVCFERD 529
           GIGFFAVCF RD
Sbjct: 481 GIGFFAVCFVRD 492

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/488 (62%), Positives = 372/488 (76%), Gaps = 9/488 (1%)

Query: 47  MNFYRDATWVLEYVESA-EKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNE 105
           M FYRDA+WVLEY+E    +  +VAGSL +LVL S KKY+LK++ +H+YA V S W+Y  
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 106 FLDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKA 165
           +LD+++++SG+LKD+P+KKG+  F  +T+ L+VHDLL SK KRI MGKHPLK FVLK++ 
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 166 RLSSELVRLKIKLKVTDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTR 225
           RL  E  +  +KL V DL  L++D+R D TPVRW RLNP R   + E++LQEL KKFP R
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQDEREDATPVRWIRLNPFRIRGQREEVLQELQKKFPRR 180

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           V  W  + PG IY DEY+ GL+GVHPADKITSHELYK GK+IIQDRASCFPA IL     
Sbjct: 181 VADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAPGRS 240

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           D+IIDACAAPGNKTTHVAAHIF +   +  +IHAFE+DP+RAKTLR MI TAGC   IEV
Sbjct: 241 DVIIDACAAPGNKTTHVAAHIFPEGGADHAQIHAFERDPQRAKTLRKMIATAGCDNAIEV 300

Query: 346 HVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSK----ADGASPVXXXXX 401
           HVGDFT+ A+P  F +VTGFI+DPSCSGSGIFGR+++D   +++     D ++ V     
Sbjct: 301 HVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADVPEEET 360

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461
                  S  +LKNRL KL+SFQF+IVKHAMSFPSAKKL+YSTCSVHAEENER+V+DLLL
Sbjct: 361 FEATK--SAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVIDLLL 418

Query: 462 DSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGF 521
           DSKV++ GW+V  R+ VIP W RRG   EFEEVF D+  A+ELA  CIRV PKEDGGIGF
Sbjct: 419 DSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPDQ--AEELAGGCIRVLPKEDGGIGF 476

Query: 522 FAVCFERD 529
           FAVCFER+
Sbjct: 477 FAVCFERE 484

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/496 (62%), Positives = 381/496 (76%), Gaps = 14/496 (2%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           M+FYRDATWVLE +E+ +  G+++GSLQTLVLNSCK++++KTNPKHIYA V SCWRY  F
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K++K+S IL ++P+KKG  VF   T+ LL HDLL SK+KRIQMGKHP+K FVLKYK R
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 167 LSSELVRLKIKLKVTDLQQLLKDD--RNDMTPVRWFRLNPIRCGAKS--EDILQELSKKF 222
           L++EL ++K+KLKV DL QL   D   ND+TPVRWFR+NP+RC A+   + ++ EL KKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282
             +V+SW ++ PG IY+DEYIP LF VHP DKITSHELYK GK+IIQDRASCFPAHILN 
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVES---VRIHAFEKDPERAKTLRTMINTAGC 339
            S+D++IDACAAPGNKTTH+AAH+FQD+  +    V+I+AFEKDPERA+ L  MI  AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 340 TKGIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXX 399
           +K IEV VGDFT+LA P   P+V G I+DPSCSGSGIFGRK ID  N  K D        
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 400 XXXXXXXDIS----DKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERI 455
                  +      D +LK RL KL+SFQF+IVK+A+SFP A K+VYSTCS+HAEENER+
Sbjct: 361 ELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420

Query: 456 VVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTA---KELAEACIRVA 512
           V+DLLLD KVKE GWRV  R+ VIPTW RRG   EF++VFR++  +   +E+A+ CIR  
Sbjct: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480

Query: 513 PKEDGGIGFFAVCFER 528
           P+EDGGIGFFAVCFER
Sbjct: 481 PREDGGIGFFAVCFER 496

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/496 (63%), Positives = 383/496 (77%), Gaps = 13/496 (2%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           M+FYRD+TWVLEY+E      +++GSLQ LVL SCKKY++K+NP+H+YAAV SCW+   +
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K++KRSGIL DIP KKGK  F   T+ LL HDLL SK+KRIQMGKHP+K ++LKYK R
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 167 LSSELVRLKIKLKVTDLQQLLKDD--RNDMTPVRWFRLNPIRCGAKS--EDILQELSKKF 222
           L SELV+LK+KLKV DL +L++D+   +D+TPVRW R+NPIR       E I+ EL+KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282
           PTRVN W++I PG IYHD+YIP LFGVH  DKITSHELYKTGKVIIQDRASCFPAHILN 
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 283 SSEDLIIDACAAPGNKTTHVAAHIFQD-QAVESVRIHAFEKDPERAKTLRTMINTAGCTK 341
              D++IDACAAPGNKTTH A++I    +  ++ +I+AFEKDPERAK L+ MI  AGC+ 
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXX-- 399
            I+V+VGDFT++A P KF +VTGFI+DPSCSGSGIFGRK +D  NK K + +        
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360

Query: 400 -----XXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENER 454
                       D+   DLK RL KLASFQF++VKHAMSFP AKK+VYSTCS+HAEENE 
Sbjct: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420

Query: 455 IVVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT-AKELAEACIRVAP 513
           +V+DLLLD KV+EWGW+V  R+ VIPTW RRGF  EF +VFRDED   +ELA+ CIRV P
Sbjct: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP 480

Query: 514 KEDGGIGFFAVCFERD 529
           KEDGGIGFFAVCFER+
Sbjct: 481 KEDGGIGFFAVCFERN 496

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/489 (61%), Positives = 375/489 (76%), Gaps = 12/489 (2%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           MNFYRDATWVLEYVE  ++ GR++GS+QTLVL SC++Y+LK++PKH+YA V SCWRY   
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K++KRS I  DIPKKKGK +++  T+ L+ HDLL SK KRIQMGK P+KE+VLK+K R
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRCGAKS-EDILQELSKKFP 223
           L+SELV+LK+KLKV  L +++  +D  ND+TPVRW R+NP+RC     E +L+EL KKFP
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKNDVEPVLKELIKKFP 180

Query: 224 TRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNAS 283
            RV+ W++I  G +Y+DE++P LFGVHP DKITSHELY+ GK+IIQDR+SCFPAHILN  
Sbjct: 181 QRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNPG 240

Query: 284 SEDLIIDACAAPGNKTTHVAAHIFQDQAVESV-RIHAFEKDPERAKTLRTMINTAGCTKG 342
             D++IDACAAPGNKTTHVAAHI  +   E   +I+AFEKDP RA  L+ M + AGC + 
Sbjct: 241 KNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQT 300

Query: 343 IEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRN--KSKADGASPVXXXX 400
           +E+HVGDFT+LA P  F DVTG I+DPSCSGSGIFGRK +D  N  K K +  S +    
Sbjct: 301 VEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSEIPDEE 360

Query: 401 XXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLL 460
                 D++     NRL KLASFQF++VKHAMS P+AKK+VYSTCS+HAEENER+V+DLL
Sbjct: 361 EKMVGDDVA-----NRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVIDLL 415

Query: 461 LDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT-AKELAEACIRVAPKEDGGI 519
           LD  +KEWGW+V  R  VIP W RRG  KEFE+VFRD+     ELA+ CIR  P+EDGGI
Sbjct: 416 LDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPVKCNELADGCIRALPQEDGGI 475

Query: 520 GFFAVCFER 528
           GFFAVCF+R
Sbjct: 476 GFFAVCFKR 484

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/508 (59%), Positives = 386/508 (75%), Gaps = 26/508 (5%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           MNFYRDATWVLE++E+ +K GRV+GSL +LV+ SCK++++++NPKH+YA V S W++  F
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           +++++ +SGIL DIPKKKGK ++   T+ LL+HDL+FSK++RIQMGKHP+K FVL YK R
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 167 LSSELVRLKIKLKVTDLQQLL------KDDRNDMTPVRWFRLNPIRCGAK--SEDILQEL 218
           L SELV+LK+KLKVT+L  ++       D  +D+TPVRW R+NPIR   +  S+DI+ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 219 SKKFPTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAH 278
            KKF T+V+ W+ I PGCIY+DEYIP LFG+ P DKITSHELYK GK+IIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 279 ILNASSEDLIIDACAAPGNKTTHVAAHIF---QDQAV--ESVRIHAFEKDPERAKTLRTM 333
           ILNA+ +D IIDACAAPGNKTTHVA++I     D  +  +  R+ AFEKDPER+K L  M
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300

Query: 334 INTAGCTKGIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSK---- 389
           +  AGC K +E++ GDFT++A P K+P+VTGFI+DPSCSGSGIFGRK ID+ N +K    
Sbjct: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360

Query: 390 ------ADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYS 443
                  D    +             D DL+ RL KL+SFQF++VKHAMSFPSAKK+VYS
Sbjct: 361 KVKDEGEDDEQDIPLEQETLAEAKAKD-DLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419

Query: 444 TCSVHAEENERIVVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT--A 501
           TCS+HAEENER+V+DLLLD KVKEWGW+V  R+  IPTW RRG   EFE+VF+++     
Sbjct: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479

Query: 502 KELAEACIRVAPKEDGGIGFFAVCFERD 529
           K+LAE CIR  PKEDGGIGFFAVCFER+
Sbjct: 480 KQLAEGCIRTLPKEDGGIGFFAVCFERN 507

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/487 (59%), Positives = 378/487 (77%), Gaps = 27/487 (5%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           M+FYRD+TW+LEY+E+ EK G+++GSLQ+ VL +C KY++K NPKHIYA V SCW+Y  +
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L++++ +SGILK IP+KKGK  F+  TI LL HDLL SK KRIQMGKHP+K++VLKYK R
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 167 LSSELVRLKIKLKVTDLQQLL-KDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTR 225
           L +ELV+LK+KLKV +L +L+ +DD +D TPVRW R+NP++C      ++++L+KKFP R
Sbjct: 121 LHAELVKLKVKLKVKELSELVDQDDGDDATPVRWIRINPLKCDIPV--VVEQLNKKFPHR 178

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           V+ W  ++PG IY+DEY+P LFG+HP++KITSH+LYK GKVIIQDRASC PAHILN   E
Sbjct: 179 VDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKE 238

Query: 286 DLIIDACAAPGNKTTHVAAHIFQ---DQAVESVRIHAFEKDPERAKTLRTMINTAGCTKG 342
           D+++DACAAPGNKTTH+AAHI     D      +IHAFEK+P RAK L+ M + AGC   
Sbjct: 239 DVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSL 298

Query: 343 IEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXXX 402
           +++HVGDFT+LA P +F DVT  ++DPSCSGSGIFGRK ++  N S+             
Sbjct: 299 VKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQ------------- 345

Query: 403 XXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLLD 462
                  D+ L++RL KL+SFQF++VKHAMS P+A+K+VYSTCSVHAEENER+V+DLLLD
Sbjct: 346 -------DQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLD 398

Query: 463 SKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT-AKELAEACIRVAPKEDGGIGF 521
           SKVKEWGW++  R+ V+PTW RRG  +EFEEVFRD+    + LAE+CIR  P+EDGGIGF
Sbjct: 399 SKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGF 458

Query: 522 FAVCFER 528
           FAVCF+R
Sbjct: 459 FAVCFQR 465

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/489 (60%), Positives = 376/489 (76%), Gaps = 7/489 (1%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           MNFYRDATWVLE +E      R++GS+QTLVL SCK+Y+LK+NPKHIYA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K++K++ IL++IPKKKGK +F   T+ LL HDLL SK KRIQMGKHP+KE+VLK+K+ 
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222
           L SE+V+LK+KLKV DL +L+  +D  ND+ PVRW R+NP++C     +E +L EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282
             +V++W+ + PG IYHDEYIP LFG+HP DKIT+HELYK GK+IIQDRASCFPAHIL+ 
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVE-SVRIHAFEKDPERAKTLRTMINTAGCTK 341
            S D++IDAC+APGNKTTH A++IF +   +  ++I+AFEKDPERAK L+ MI  AGC+ 
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300

Query: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
            I+V+VGDFT+LA P K   VTGFI+DPSCSGSGIFGRK  D  N+ K D          
Sbjct: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDDAVP 360

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461
                 ++ ++L+ RL KL+SFQF++VKHAMSFP AKK+VYSTCS+HAEENER+V+DLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 462 DSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT--AKELAEACIRVAPKEDGGI 519
           D  V+EWGW+V  R  V+P+W RRG  +EFEEVFRD      ++LAE CIR  PKEDGGI
Sbjct: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480

Query: 520 GFFAVCFER 528
           GFFAVCF R
Sbjct: 481 GFFAVCFVR 489

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/490 (60%), Positives = 380/490 (77%), Gaps = 7/490 (1%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           MNFYRDATWVLE +E      R++GS+QTLVL SCK+Y+LK+NPKHIYA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K++K++ IL+DIPKKKGK +F+  T+ LL HDLL SK KRIQMGKHP+K++VLK+K+ 
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222
           L SE+V+LK+KLKV +L +L+  +D  ND+ PVRW R+NP++C    ++E +L EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282
             +V+ W+ + PG IY+DE+IP LFG+HP+DKIT+HELYK GK+IIQDRASCFPAHILN 
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVE-SVRIHAFEKDPERAKTLRTMINTAGCTK 341
              D++ID+C+APGNKTTH A++I+ +   + + RI+AFEKDPERAK L+ MI  AGC+ 
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300

Query: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
            I V+VGDFT+LA P K+ DVT FI+DPSCSGSGIFGRK  D  N+ K D          
Sbjct: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIVP 360

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461
                 I+ ++L+ RL KL+SFQF++VKHAMSFP+AKK+VYSTCS+HAEENER+V+DLLL
Sbjct: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 462 DSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT--AKELAEACIRVAPKEDGGI 519
           D  V+EWGW+V  +  VIP+W RRG  +EFEEVFRD  T   ++LAE CIR  PK DGGI
Sbjct: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480

Query: 520 GFFAVCFERD 529
           GFFAVCFERD
Sbjct: 481 GFFAVCFERD 490

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/489 (60%), Positives = 376/489 (76%), Gaps = 7/489 (1%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           MNFYRDATWVLE +E      R++GS+QTLVL SCKKY+LK+NPKHIYA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K++K++ IL+DIPKKKGK +F+  T+ LL HDLL SK KRIQMGKHP+K++VLK+K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222
           L SE+V+LK+KLKV DL +++  +D  ND+ PVRW R+NP++C     +E +L EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282
             +VN W+++ PG IY+DEYIP LFG+HP DKIT+HELYK GK+IIQDRASCFPAHIL+ 
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVES-VRIHAFEKDPERAKTLRTMINTAGCTK 341
            ++D++IDAC+APGNKTTH A++I      ++ +RI+AFEKDPERAK L+ M+  AGC+ 
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300

Query: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
            I+V VGDFT+LA P K    TGFI+DPSCSGSGIFGRK  D  NK K D          
Sbjct: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461
                 ++ ++L+ RL KL+SFQF++VKHAMSFP+AKK+VYSTCS+HAEENER+V+DLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 462 DSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRD--EDTAKELAEACIRVAPKEDGGI 519
           D  V+EWGW+V  R  VIP+W RRG  +EF EVFRD      ++LAE CIR  PKEDGGI
Sbjct: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480

Query: 520 GFFAVCFER 528
           GFFAVCFER
Sbjct: 481 GFFAVCFER 489

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/494 (59%), Positives = 377/494 (76%), Gaps = 14/494 (2%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           M FYRDATWVLE+VE  +  GR++GSLQTLV  SCK+Y+LK NPKH+YA + SCW+Y  +
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K++K+SGIL +IPK+KGK +++  T+ L+ HDLLFSK KRIQMGK P+K +VLK+K+R
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 167 LSSELVRLKIKLKVTDLQQLLK--DDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPT 224
           L SELV+LK+KLKV +L +L+   D  NDMTPVRW R+NP+RC  ++  +  E+ KKFPT
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRCDVEATKL--EIQKKFPT 178

Query: 225 RVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASS 284
           RV +W++I PG IY+DEYIP LFG+HP DKITSH LYK GK+IIQDRASCFPAHIL+   
Sbjct: 179 RVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDE 238

Query: 285 EDLIIDACAAPGNKTTHVAAHIFQDQAVE-SVRIHAFEKDPERAKTLRTMINTAGCTKGI 343
            D++ID CAAPGNKTTH A+++ ++ + +  ++I+AFEK+PERAK L  MI  AGC+K I
Sbjct: 239 NDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNI 298

Query: 344 EVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXXXX 403
           +++VGDFT++A P K+ DVTGFI+DPSCSGSGIFGRK ID  N+ K +            
Sbjct: 299 KINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGDEE 358

Query: 404 XXXDISD------KDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVV 457
                        +DLK RL KL+SFQF++VKHAMSFP+AKK+VYSTCS+HAEENER+V+
Sbjct: 359 EEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVVI 418

Query: 458 DLLLDSKVKEWGWRVRKRAGVIPTWSRRG-FYKEFEEVFRDEDTAK--ELAEACIRVAPK 514
           DL+LDSKVK+WGW+V  R+ VIPTW RRG   +  E    D +++K  ELA  CIR  P+
Sbjct: 419 DLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALPR 478

Query: 515 EDGGIGFFAVCFER 528
            DGGIGFFAVCFER
Sbjct: 479 SDGGIGFFAVCFER 492

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/489 (59%), Positives = 367/489 (75%), Gaps = 7/489 (1%)

Query: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106
           MNFYRDATWVLE +E      R++GS+QTLVL SCK+Y+LK+NPKH+YA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166
           L+K++K++ IL+DIPKKKGK +F+  T+ LL HDLL SK KRIQMGKHP+K++VLK+K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222
           L SE+V+LK+KLKV +L +L+  +D  ND+ PVRW R+NP++C    K+E +L EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282
             +V  W+ + P  IY+DEYIP LFG+HP+DKIT+HELYK GK+IIQDRASCFPAHILN 
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVES-VRIHAFEKDPERAKTLRTMINTAGCTK 341
              D++IDAC+APGNKTTH A++I  +   +S  RI+AFEKDPERAK L+ MI  AGC+ 
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300

Query: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
            I+V VGDFT+LA P KF D TGFI+DPSCSGSGIFGRK  D  N+ K D          
Sbjct: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDIVP 360

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461
                 ++ ++L+ RL KL+SFQF++VKHAMSFP AKK+VYSTCS+HAEENER+V+DLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 462 DSKVKEWGWRVRKRAGVIPTWSRRG--FYKEFEEVFRDEDTAKELAEACIRVAPKEDGGI 519
           D  V+EWGWRV  R+ VIP W RRG     E           +ELAE CIR  PK+DGGI
Sbjct: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480

Query: 520 GFFAVCFER 528
           GFFAVCFER
Sbjct: 481 GFFAVCFER 489

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 98/240 (40%), Gaps = 58/240 (24%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 286 IGSWTKV--GLQIFDSQVP--VGATPE--------YLAGHYILQAASSFLPVIALDPHEN 333

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 334 ERILDMAAAPGGKTTYISAMMKNTGCV-----FANDANKARTKSLIANIHRLGCTNTIVC 388

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
           +           +FP V G     +LD  CSG+G+ G+      N+++ D          
Sbjct: 389 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVNRTEKD---------- 431

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAM-SFPSAKK----LVYSTCSVHAEENERIV 456
                            ++   Q +++  A+ S  S  K    +VYSTCSV  EENE +V
Sbjct: 432 ---------------FMQIPHLQKQLILSAIDSVDSNSKHGGVIVYSTCSVAVEENEAVV 476

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 115/298 (38%), Gaps = 65/298 (21%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L+      ++D CAAPG+KT  +  ++ +D    S  + A + D
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSGFVVANDAD 201

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAKPGKFPDVTG---------FILDPSCSG 373
            +R+  L   +        I V H   F    K    PD T           + D  CSG
Sbjct: 202 AKRSHMLVHQLKRLNSANLIVVNHDAQFFPRVK--AHPDHTNKKDILRFDRVLCDVPCSG 259

Query: 374 SGIFGRKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMS 433
            G   + +   R+ +  +G +                         L + Q  I+   + 
Sbjct: 260 DGTMRKNVNVWRDWTTQNGLA-------------------------LHNVQLNILNRGLH 294

Query: 434 -FPSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR------KRAGVI------- 479
              S  +LVYSTCS++  ENE +V + L     ++WG +VR      K  G++       
Sbjct: 295 LLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGGKVRLVDCSDKLPGLVRSNGINQ 349

Query: 480 -PTWSRRGFYKEFEE--------VFRDEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
            P  +R    KE  E           DE+ A+   + C+RV P +    GFF    E+
Sbjct: 350 WPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVLEK 407

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 99/240 (41%), Gaps = 58/240 (24%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 300 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPQEN 347

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 348 ERILDMAAAPGGKTTYISALMKNTGCV-----FANDANKSRTKSLVANIHRLGCTNTIVC 402

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
           +           +FP V G     +LD  CSG+G+ G+      ++++ D          
Sbjct: 403 NY-------DAREFPRVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD---------- 445

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAM-SFPSAKK----LVYSTCSVHAEENERIV 456
                            ++   Q +++  A+ S  S  K    +VYSTCSV  EE+E++V
Sbjct: 446 ---------------FMQIPHLQKQLLLSAIDSVDSHSKTGGIIVYSTCSVAVEEDEQVV 490

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 93/236 (39%), Gaps = 50/236 (21%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 296 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 343

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 344 ERILDMAAAPGGKTTYISAMMKNTGCV-----FANDANKARTKSLIANIHRLGCTNTIVC 398

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGAS-PVXXXX 400
           +           +FP V G     +LD  CSG+G+ G+      ++++ D    P     
Sbjct: 399 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFMQIPHLQKQ 451

Query: 401 XXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIV 456
                 D  D + K                     +   +VYSTCSV  +ENE +V
Sbjct: 452 LLLSAIDSVDSNSK---------------------TGGVIVYSTCSVAVDENEAVV 486

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 95/236 (40%), Gaps = 50/236 (21%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + +WT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 313 IGAWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPQEN 360

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + ++D  +APG KTT+++A + ++       I A + +  R K+L   I+  GCT  I  
Sbjct: 361 ERVLDMASAPGGKTTYISA-LMKNTGC----IFANDANKARTKSLIANIHRLGCTNTIVC 415

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGAS-PVXXXX 400
           +           +FP V G     +LD  CSG+G+ G+      ++++ D    P     
Sbjct: 416 NYD-------AREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQ 468

Query: 401 XXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIV 456
                 D  D + KN                        LVYSTCSV  EE+E +V
Sbjct: 469 LILSAIDSLDSNSKN---------------------GGVLVYSTCSVAVEEDEAVV 503

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 118/294 (40%), Gaps = 55/294 (18%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L+      ++D CAAPG+KT  +   +  D    S  + A + D
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSGFVIANDAD 199

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMI 382
            +R+  L   +     +  + V H   F        FP++     D S      F R + 
Sbjct: 200 NKRSHLLVHQLKRLSTSNVLIVNHDAQF--------FPNLKINTKDASSQEDLKFDRILC 251

Query: 383 DDRNKSKADGASPVXXXXXXXXXXDI-SDKDLKNRLEKLASFQFEIVKHAMSF-PSAKKL 440
           D           P           ++  + + +N L  L + QF I+   ++      KL
Sbjct: 252 D----------VPCSGDGTMRKNVNVWKNWNTQNAL-GLHNVQFNILDRGLTLLKETGKL 300

Query: 441 VYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR------KRAGVI-----PTWSRRGFYK 489
           VYSTCS++  ENE +V  +L     ++WG +VR      K  G+I      TW      +
Sbjct: 301 VYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLIRSKGLTTWPV--INR 353

Query: 490 EFEEVFRD---------------EDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
           + EEV R+               E+ +K   + C+RV P +    GFF   FE+
Sbjct: 354 DMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFITMFEK 407

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 95/240 (39%), Gaps = 58/240 (24%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 293 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 340

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GC   I  
Sbjct: 341 ERILDMAAAPGGKTTYISALMKNTGCV-----FANDANKARTKSLIANIHRLGCHNTIVC 395

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
           +           +FP V G     +LD  CSG+G+ G+      ++++ D          
Sbjct: 396 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD---------- 438

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKK-----LVYSTCSVHAEENERIV 456
                            ++   Q +++  A+    A       +VYSTCSV  EENE +V
Sbjct: 439 ---------------FMQIPHLQKQLILSAIDSVDAHSKTGGVIVYSTCSVAVEENEAVV 483

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 94/236 (39%), Gaps = 50/236 (21%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + +WT +  G    D  +P   G  P         Y  G+ I+Q  +S  P   L+    
Sbjct: 294 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGQYILQAASSFLPVIALDPQEN 341

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  +APG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 342 ERILDMASAPGGKTTYISALMKNTGCV-----FANDANKNRTKSLIANIHRLGCTNTIVC 396

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGAS-PVXXXX 400
           +           +FP V G     +LD  CSG+G+ G+      ++++ D    P     
Sbjct: 397 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQ 449

Query: 401 XXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIV 456
                 D  D + K                     S   +VYSTCSV  EE+E +V
Sbjct: 450 LLLSAIDSVDANSK---------------------SGGVIVYSTCSVAVEEDEAVV 484

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 97/240 (40%), Gaps = 58/240 (24%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + +WT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 288 IGTWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 335

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 336 ERILDMAAAPGGKTTYISALMKNTGCV-----FANDANKARTKSLIANIHRLGCTNTIVC 390

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
           +           +FP V G     +LD  CSG+G+  +      ++++ D          
Sbjct: 391 NYD-------AREFPKVIGGFDRILLDAPCSGTGVIAKDQSVKVSRTEKD---------- 433

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAM-SFPSAKK----LVYSTCSVHAEENERIV 456
                            ++   Q +++  A+ S  S  K    +VYSTCSV  EENE +V
Sbjct: 434 ---------------FMQIPHLQKQLILSAIDSVDSNSKTGGIIVYSTCSVAVEENEAVV 478

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 96/240 (40%), Gaps = 58/240 (24%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           +  WT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 310 IGPWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVVALDPHEN 357

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 358 ERILDMAAAPGGKTTYISAMMKNTGCV-----FANDANKARTKSLIANIHRLGCTNTIVC 412

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
           +           +FP V G     +LD  CSG+G+  +           D +  V     
Sbjct: 413 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIAK-----------DQSVKVSR--- 451

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKK-----LVYSTCSVHAEENERIV 456
                  +DKD      ++   Q +++  A+    A       +VYSTCSV  EENE +V
Sbjct: 452 -------TDKDFM----QIPHLQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEENEAVV 500

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 103/260 (39%), Gaps = 55/260 (21%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 299 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHEN 346

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 347 ERILDMAAAPGGKTTYISAMMKNTGCV-----FANDANKSRTKSLIANIHRLGCTNTIVC 401

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGAS-PVXXXX 400
           +           +FP V G     +LD  CSG+G+ G+      ++++ D    P     
Sbjct: 402 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQ 454

Query: 401 XXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLL 460
                 D  D + K+                        +VYSTCSV  EE+E  V+D  
Sbjct: 455 LLLSAIDSVDCNSKH---------------------GGVIVYSTCSVAVEEDE-AVIDYA 492

Query: 461 L----DSKVKEWGWRVRKRA 476
           L    + K+ E G  + K A
Sbjct: 493 LRKRPNVKLVETGLAIGKEA 512

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 103/260 (39%), Gaps = 55/260 (21%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 296 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHEN 343

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 344 ERILDMAAAPGGKTTYISALMKNTGCV-----FANDANKARTKSLIANIHRLGCTNTIVC 398

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGAS-PVXXXX 400
           +           +FP V G     +LD  C+G+G+ G+      ++++ D    P     
Sbjct: 399 NY-------DAREFPKVIGGFDRILLDAPCTGTGVIGKDQSVKVSRTEKDFIQVPHLQKQ 451

Query: 401 XXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLL 460
                 D  D + K                     +   +VYSTCSV  EE+E +VVD  
Sbjct: 452 LLLSAIDSVDSNSK---------------------TGGIIVYSTCSVAVEEDE-MVVDYA 489

Query: 461 L----DSKVKEWGWRVRKRA 476
           L    + K+ E G  + K  
Sbjct: 490 LRKRPNVKLVEAGLAIGKEG 509

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 93/236 (39%), Gaps = 50/236 (21%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 171 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHEN 218

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 219 ERILDMAAAPGGKTTYISAMMKNTGCV-----FANDANKNRTKSLIANIHRLGCTNTIVC 273

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGAS-PVXXXX 400
           +           +FP V G     +LD  CSG+G+ G+      ++++ D    P     
Sbjct: 274 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQ 326

Query: 401 XXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIV 456
                 D  D + K+                        +VYSTCSV  EE+E +V
Sbjct: 327 LLLSAIDSVDCNSKH---------------------GGVIVYSTCSVAVEEDEAVV 361

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 97/240 (40%), Gaps = 58/240 (24%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 302 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVVALDPQEN 349

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + ++D  +APG KTT+++A +     V      A + + +R K+L   I+  GCT  I  
Sbjct: 350 ERVLDMASAPGGKTTYISALMKNTGCV-----FANDANKKRTKSLIANIHRLGCTNTIVC 404

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
           +           +FP V G     +LD  CSG+G+ G+      ++++ D          
Sbjct: 405 NY-------DAREFPKVIGGFDRVLLDAPCSGTGVIGKDQSVKVSRTEKD---------- 447

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKK-----LVYSTCSVHAEENERIV 456
                            ++   Q +++  A+    A       +VYSTCSV  EE+E +V
Sbjct: 448 ---------------FIQIPHLQKQLLLSAIDSVDANSKKGGVIVYSTCSVAVEEDEAVV 492

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 112/300 (37%), Gaps = 68/300 (22%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQD----------QAVE 313
           G +  Q+  S  P  +L       ++D CAAPG+KT  +   + +D             +
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGFVVANDAD 202

Query: 314 SVRIHAFEKDPERAKTLRTMI--NTAGCTKGIEVHVGDFTQLAKPGKFPDVTGFILDPSC 371
           S R H      +R  +   M+  + A     I+    D +  A   KF  V   + D  C
Sbjct: 203 SKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRV---LCDVPC 259

Query: 372 SGSGIFGRKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHA 431
           SG G   + +   R+ +   G                           L + QF I+   
Sbjct: 260 SGDGTMRKNVNVWRDWTPQGGLG-------------------------LHTVQFNILNRG 294

Query: 432 MSFPSAK-KLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR-----------KRAGVI 479
           +     K +LVYSTCS++  ENE +V + L     ++WG ++R            R+  +
Sbjct: 295 LHLLKNKGRLVYSTCSMNPIENEAVVAEAL-----RKWGDKIRLVSCEDKLPGLVRSKGV 349

Query: 480 PTWS---------RRGFYKEFEEVF--RDEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
             W           +G     +  F   +E+ AK   E CIRV P +    GFF   FE+
Sbjct: 350 SQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVFEK 409

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 97/240 (40%), Gaps = 58/240 (24%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + +WT +  G    D  +P          I +   Y  G+ I+Q  +S  P   L+    
Sbjct: 314 IGAWTKV--GLQIFDSQVP----------IGATSEYLAGQYILQAASSFLPVVALDPQEN 361

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + ++D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 362 ERVLDMAAAPGGKTTYISALMKNTGCV-----FANDANKARTKSLIANIHRLGCTNTIVC 416

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
           +           +FP V G     +LD  CSG+G+ G+      ++++ D          
Sbjct: 417 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKSSRTEKD---------- 459

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKK-----LVYSTCSVHAEENERIV 456
                            ++   Q +++  A+    A       +VYSTCSV  EE+E +V
Sbjct: 460 ---------------FIQIPHLQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEEDEAVV 504

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 98/240 (40%), Gaps = 58/240 (24%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + +WT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 311 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 358

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 359 ERILDMAAAPGGKTTYISAMMKNTGCV-----FANDANKNRTKSLIANIHRLGCTNTI-- 411

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
            V ++       +FP V G     +LD  CSG+G+ G+      ++++ D          
Sbjct: 412 -VCNYDAR----EFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD---------- 456

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKK-----LVYSTCSVHAEENERIV 456
                            ++   Q +++  A+    A       +VYSTCSV  EE+E +V
Sbjct: 457 ---------------FIQIPHLQKQLLLSAIDSVDANSKKGGIIVYSTCSVAVEEDEAVV 501

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 96/240 (40%), Gaps = 58/240 (24%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 306 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHEN 353

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +       +  + A + +  R K+L   I+  GCT  I  
Sbjct: 354 ERILDMAAAPGGKTTYISALM-----KNTGTVFANDANKNRTKSLIANIHRLGCTNTIVC 408

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
           +           +FP V G     +LD  CSG+G+ G+      ++++ D          
Sbjct: 409 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD---------- 451

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKK-----LVYSTCSVHAEENERIV 456
                            ++   Q +++  A+            +VYSTCSV  EE+E +V
Sbjct: 452 ---------------FIQIPHLQKQLLLSAIDSVDCNSKHGGIIVYSTCSVAVEEDEAVV 496

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 93/236 (39%), Gaps = 50/236 (21%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 299 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHEN 346

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 347 ERILDMAAAPGGKTTYISAMMKNTGCV-----FANDANKSRTKSLIANIHRLGCTNTIVC 401

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGAS-PVXXXX 400
           +           +FP V G     +LD  CSG+G+ G+      ++++ D    P     
Sbjct: 402 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQ 454

Query: 401 XXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIV 456
                 D  D + K+                        +VYSTCSV  EE+E ++
Sbjct: 455 LLLSAIDSVDCNSKH---------------------GGVIVYSTCSVAVEEDEAVI 489

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 113/299 (37%), Gaps = 67/299 (22%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L    +  ++D CAAPG+KT  +   + +D    +  + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPTGFVVANDAD 204

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAKPGKFPDVTGFIL-------DPSCSGSG 375
             R+  L   +        I V H   F    K  K  +    +L       D  CSG G
Sbjct: 205 NRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCSGDG 264

Query: 376 IFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAM 432
              RK ++   D N   A G                           L   Q  I+   +
Sbjct: 265 TM-RKNVNVWRDWNTQNALG---------------------------LHQVQANILNRGL 296

Query: 433 SF-PSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR------KRAGVI------ 479
                  +LVYSTCS++  ENE +V   L     ++WG +VR      K  G++      
Sbjct: 297 HLLKKGGRLVYSTCSMNPIENEAVVAQAL-----RKWGDKVRLVNCDDKLPGLVRNKGIS 351

Query: 480 --PTWSR------RGFYKEFEEVFR--DEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
             PT +R      +G     +  F+  +E+  K   E CIRV P +    GFF   FE+
Sbjct: 352 KWPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITVFEK 410

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 114/300 (38%), Gaps = 67/300 (22%)

Query: 263 TGKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEK 322
            G +  Q+  S  P  +L       ++D CAAPG+KT  +   + +D    S  + A + 
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDA 203

Query: 323 DPERAKTLRTMINTAGCTKGIEV-HVGDFTQLAK----PGKFPDVTGF---ILDPSCSGS 374
           D  R+  L   +        + V H   F    +      K  DV  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSGD 263

Query: 375 GIFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHA 431
           G   RK ++   D N     G                           L + Q  I+   
Sbjct: 264 GTM-RKNVNVWKDWNTQAGLG---------------------------LHTVQLNILNRG 295

Query: 432 MSF-PSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR------KRAGVI----- 479
           +       +LVYSTCS++  ENE ++ + L     ++WG ++R      K +G++     
Sbjct: 296 LHLLKDGGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLSGLVRSKGV 350

Query: 480 ---PTWSR------RGFYKEFEEVF--RDEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
              P + R      +G     E  F   +E+ +K   + C+RV P +    GFF   FE+
Sbjct: 351 SKWPVYDRNLTEKTKGDEGTLESFFAPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 97/240 (40%), Gaps = 58/240 (24%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + +WT +  G    D  +P          I +   Y  G+ I+Q  +S  P   L+    
Sbjct: 294 IGTWTKV--GLQIFDSQVP----------IGATSEYLAGQYILQAASSFLPVVALDPQLN 341

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + ++D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 342 ERVLDMAAAPGGKTTYISALMKNTGCV-----FANDANKARTKSLIANIHRLGCTNTIVC 396

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
           +           +FP V G     +LD  CSG+G+ G+      ++++ D          
Sbjct: 397 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD---------- 439

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKK-----LVYSTCSVHAEENERIV 456
                            ++   Q +++  A+    A       +VYSTCSV  EE+E +V
Sbjct: 440 ---------------FIQIPHLQKQLLLSAIDSVDANSKTGGFIVYSTCSVAVEEDEAVV 484

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 93/236 (39%), Gaps = 50/236 (21%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           + SWT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 301 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHEN 348

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 349 ERILDMAAAPGGKTTYISAMMKNTGCV-----FANDANKSRTKSLIANIHRLGCTNTIVC 403

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGAS-PVXXXX 400
           +           +FP V G     +LD  CSG+G+ G+      ++++ D    P     
Sbjct: 404 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQ 456

Query: 401 XXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIV 456
                 D  D + K+                        +VYSTCSV  EE+E +V
Sbjct: 457 LLLSAIDSVDCNSKH---------------------GGVIVYSTCSVAVEEDEAVV 491

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 111/299 (37%), Gaps = 67/299 (22%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L       ++D CAAPG+KT  +   + +D    +  + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDAD 204

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDF-------TQLAKPGKFPDVTGFILDPSCSGSG 375
            +R+  L   +        + V H   F       T   K  +       + D  CSG G
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSGDG 264

Query: 376 IFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAM 432
              RK ++   D N     G                           L + Q  I+   +
Sbjct: 265 TM-RKNVNVWKDWNTQGGLG---------------------------LHTVQLNILNRGL 296

Query: 433 SF-PSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR-----------KRAGVIP 480
           +   S  +LVYSTCS++  ENE +V + L     ++WG +++            R+  I 
Sbjct: 297 NLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGSKIKLVNCDDKLVGLVRSKGIS 351

Query: 481 TW---------SRRGFYKEFEEVFRDEDTAKEL--AEACIRVAPKEDGGIGFFAVCFER 528
            W           +G     E  F   +  +E+   ++CIRV P +    GFF   FE+
Sbjct: 352 NWPVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFITVFEK 410

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 115/300 (38%), Gaps = 69/300 (23%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHV--AAHIFQDQA--------VE 313
           G +  Q+  S  P  +L       ++D CAAPG+KT  +  A H+  D+          +
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGFVVANDAD 204

Query: 314 SVRIHAFEKDPERAKTLRTMI--NTAGCTKGIEVHVGDFTQLAKPGKFPDVTGFILDPSC 371
           + R H      +R  +   M+  + A     I++H  D TQ     +F  V   + D  C
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLH-EDATQKKDVLRFDRV---LCDVPC 260

Query: 372 SGSGIFGRKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHA 431
           SG G   + +   R+ +   G                           L + Q  I+   
Sbjct: 261 SGDGTMRKNVNVWRDWNTQSGLG-------------------------LHTVQLNILNRG 295

Query: 432 MSFPSAK-KLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR-----------KRAGVI 479
           +     K +LVYSTCS++  ENE +V      + +++WG ++R            R+  I
Sbjct: 296 LHLLKPKGRLVYSTCSMNPIENEAVVA-----AALRKWGDKIRLVNCDDKLPGLVRSKGI 350

Query: 480 PTW---------SRRGFYKEFEEVF--RDEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
            TW          ++G     E  F    E+  K    +CIRV P +    GFF   FE+
Sbjct: 351 STWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFITVFEK 410

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 105/266 (39%), Gaps = 63/266 (23%)

Query: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285
           +  WT +  G    D  +P   G  P         Y  G  I+Q  +S  P   L+    
Sbjct: 308 IGPWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHEN 355

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+  GCT  I  
Sbjct: 356 ERILDMAAAPGGKTTYISAMMKNTGCV-----FANDANKARTKSLIANIHRLGCTNTIVC 410

Query: 346 HVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADGASPVXXXXX 401
           +           +FP V G     +LD  CSG+G+  +      ++++ D          
Sbjct: 411 NY-------DAREFPKVIGGFDRILLDAPCSGTGVIAKDQSVKVSRTEKD---------- 453

Query: 402 XXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKK-----LVYSTCSVHAEENERIV 456
                            ++   Q +++  A+    A       +VYSTCSV  EENE  V
Sbjct: 454 ---------------FIQIPHLQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEENE-AV 497

Query: 457 VDLLL----DSKVKEWGWRVRKRAGV 478
           +D  L    + K+ + G  + K A V
Sbjct: 498 IDYALRKRPNVKLVDAGLSIGKEAFV 523

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 114/299 (38%), Gaps = 67/299 (22%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L       ++D CAAPG+KT  +   + +D    S  + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAK----PGKFPDVTGF---ILDPSCSGSG 375
             R+  L   +        + V H   F    +      K  D+  F   + D  CSG G
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSGDG 264

Query: 376 IFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAM 432
              RK ++   D N     G                           L + Q  I+   +
Sbjct: 265 TM-RKNVNVWKDWNTQAGLG---------------------------LHTVQLNILNRGL 296

Query: 433 SF-PSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR------KRAGVI------ 479
               S  +LVYSTCS++  ENE ++ + L     ++WG ++R      K  G+I      
Sbjct: 297 HLLKSNGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLTGLIRSKGVS 351

Query: 480 --PTWSR------RGFYKEFEEVF--RDEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
             P + R      +G     E  F   +E+ +K   + C+RV P +    GFF   FE+
Sbjct: 352 KWPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFISVFEK 410

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 94/245 (38%), Gaps = 55/245 (22%)

Query: 224 TRVNSWTNIAP-------GCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFP 276
           T VN   N+ P       G    D  +P   G  P         Y  G  I+Q  +S  P
Sbjct: 289 TLVNRGVNLQPIGPWTKVGLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLP 338

Query: 277 AHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINT 336
              L+    + I+D  AAPG KTT+++A +     V      A + +  R K+L   I+ 
Sbjct: 339 VIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV-----FANDANKSRTKSLIANIHR 393

Query: 337 AGCTKGIEVHVGDFTQLAKPGKFPDVTG----FILDPSCSGSGIFGRKMIDDRNKSKADG 392
            GCT  I  +           +FP V G     +LD  CSG+G+ G+      ++++ D 
Sbjct: 394 LGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDF 446

Query: 393 AS-PVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEE 451
              P           D  D + K+                        +VYSTCSV  EE
Sbjct: 447 IQIPHLQKQLLLSAIDSVDCNSKH---------------------GGVIVYSTCSVAVEE 485

Query: 452 NERIV 456
           +E +V
Sbjct: 486 DEAVV 490

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 110/295 (37%), Gaps = 62/295 (21%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L       ++D CAAPG+KT  +   +   +   +  + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGFVVANDAD 204

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAKPGKFPDVTGF------ILDPSCSGSGI 376
            +R+  L   +        + V H   F    K    PD   F      + D  CSG G 
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQ--PDSKEFLKFDRVLCDVPCSGDGT 262

Query: 377 FGRKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMS-FP 435
             + +   R+   A G                           L + Q  I+   ++   
Sbjct: 263 MRKNVNVWRDWGTASGLG-------------------------LHTVQLNILNRGLNLLK 297

Query: 436 SAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR------KRAGVI--------PT 481
              +LVYSTCS++  ENE ++   L     ++WG ++R      K  G++        P 
Sbjct: 298 DGGRLVYSTCSLNPIENESVIAAAL-----RKWGDKIRLVNCDEKLPGLVRSKGITQWPV 352

Query: 482 WSRRGFYKE------FEEVF--RDEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
           + +    KE       E  F   +E+  +   E CIRV P +    GFF   FE+
Sbjct: 353 YDKNFALKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVFEK 407

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 112/301 (37%), Gaps = 71/301 (23%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L       ++D CAAPG+KT  +   + +D    +  + A + D
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSNEPTGFVVANDSD 198

Query: 324 PERAKTLRTMINTAGCTKGIEVH--VGDFTQLAKPGKFPDVTGFI------LDPSCSGSG 375
             RA  L   +        + V+     F ++       + +G +       D  CSG G
Sbjct: 199 SRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCSGDG 258

Query: 376 IFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAM 432
              RK ++   D N   A G                           L + Q  I+   +
Sbjct: 259 TM-RKNVNVWKDWNTQNALG---------------------------LHNVQLNILNRGL 290

Query: 433 SF-PSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR-----------KRAGVIP 480
                  +LVYSTCS++  ENE +V      + +++WG +++            R+  I 
Sbjct: 291 QLLKDNGRLVYSTCSLNPIENEAVVA-----AALRKWGNKIKLVDCQNKLQGLVRSNGIS 345

Query: 481 TWSRRGFYKEFEEVFRDEDTAKEL-------------AEACIRVAPKEDGGIGFFAVCFE 527
            WS   + +E   + +D ++ K                E C+RV P +    GFF   FE
Sbjct: 346 HWSV--YDREMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAVFE 403

Query: 528 R 528
           +
Sbjct: 404 K 404

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 109/295 (36%), Gaps = 62/295 (21%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P ++L       ++D CAAPG+KT  +   +  +    S  + A + D
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGFVVANDAD 205

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAKPGK----FPDVTGFILDPSCSGSGIFG 378
             R+  L   +        I V H   F    K  +    F      + D  CSG G   
Sbjct: 206 YRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGTMR 265

Query: 379 RKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSF-PSA 437
           + +   ++     G                           L + Q  I+   ++   + 
Sbjct: 266 KNINVWKDWGTGSGLG-------------------------LHTVQLNILNRGLTLLKNG 300

Query: 438 KKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR-----------KRAGVIPTWSRRG 486
            +LVYSTCS++  ENE +V   L     ++WG +++            R+  I +W    
Sbjct: 301 GRLVYSTCSLNPIENEAVVAAAL-----RKWGAKIKLVNCDDQLLGLVRSTGISSWPV-- 353

Query: 487 FYKEFEEVFR------------DEDTAKELA-EACIRVAPKEDGGIGFFAVCFER 528
             K +EE  +             E+ AKE   E CIRV P +    GFF   FE+
Sbjct: 354 LDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 115/300 (38%), Gaps = 67/300 (22%)

Query: 263 TGKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEK 322
            G +  Q+  S  P  +L       ++D CAAPG+KT  +   + +D    S  + A + 
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDA 203

Query: 323 DPERAKTLRTMINTAGCTKGIEVH--VGDFTQLAKPGKFP---DVTGF---ILDPSCSGS 374
           D  R+  L   +        + V+     F ++   G      DV  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCSGD 263

Query: 375 GIFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHA 431
           G   RK ++   D N     G                           L + Q  I+   
Sbjct: 264 GTM-RKNVNVWKDWNTQAGLG---------------------------LHTVQLNILNRG 295

Query: 432 MSF-PSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR------KRAGVI----- 479
           +    +  +LVYSTCS++  ENE +V + L     ++WG ++R      K  G+I     
Sbjct: 296 LHLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRSKGV 350

Query: 480 ---PTWSR------RGFYKEFEEVF--RDEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
              P + R      +G     E  F   +E+ ++   + C+RV P +    GFF   FE+
Sbjct: 351 SKWPVYDRNLTEKTKGDEGTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVFEK 410

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 112/297 (37%), Gaps = 63/297 (21%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L    +  ++D CAAPG+KT  +   + +D    +  + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDAD 204

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAK----PGKFPDVTGF---ILDPSCSGSG 375
             R+  L   +        + V H   F    K      K  D+  F   + D  CSG G
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCSGDG 264

Query: 376 IFGRKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSF- 434
              RK ++      A GA                          L + Q+ I+   +   
Sbjct: 265 TM-RKNVNVWKDWNAQGAL------------------------GLHTVQWNILNRGLHLL 299

Query: 435 -PSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR--KRAGVIPTWSRRGFYKEF 491
            P+  +LVYSTCS++  ENE +V   L     ++WG ++R       +P   R     ++
Sbjct: 300 KPNG-RLVYSTCSLNPIENEAVVAQAL-----RKWGNKIRLVNCDEKLPGLVRSKGISQW 353

Query: 492 EEVFRDEDTAKELAE--------------------ACIRVAPKEDGGIGFFAVCFER 528
             + RD +T  +  E                    ACIRV P +    GFF   FE+
Sbjct: 354 PVLNRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFITVFEK 410

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 113/299 (37%), Gaps = 67/299 (22%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L       ++D CAAPG+KT  +   + +D    S  + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAK----PGKFPDVTGF---ILDPSCSGSG 375
             R+  L   +        + V H   F    +         DV  F   + D  CSG G
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGDG 264

Query: 376 IFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAM 432
              RK ++   D N     G                           L + Q  I+   +
Sbjct: 265 TM-RKNVNVWKDWNTQAGLG---------------------------LHAVQLNILNRGL 296

Query: 433 SF-PSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR------KRAGVI------ 479
               +  +LVYSTCS++  ENE +V + L     ++WG ++R      K  G+I      
Sbjct: 297 HLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRSKGVS 351

Query: 480 --PTWSR------RGFYKEFEEVF--RDEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
             P + R      +G     +  F   +E+ +K   + C+RV P +    GFF   FE+
Sbjct: 352 KWPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 109/299 (36%), Gaps = 67/299 (22%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L    +  ++D CAAPG+KT  +   +  D    +  + A + D
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTGFVVANDAD 205

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAK----PGKFPDVTGF---ILDPSCSGSG 375
             R+  L   +        + V H   F    K      K  D+  F   + D  CSG G
Sbjct: 206 SRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCSGDG 265

Query: 376 IFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAM 432
              RK ++   D N     G                           L + Q+ I+   +
Sbjct: 266 TM-RKNVNVWKDWNTQSGLG---------------------------LHTVQYNILNRGL 297

Query: 433 SF-PSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR-----------KRAGVIP 480
           +   S  +LVYSTCS++  ENE +V   L     + WG +++            R+  I 
Sbjct: 298 NLLKSGGRLVYSTCSLNPIENEAVVAQAL-----RTWGDKIKLVNCGDKLPGLVRSQGIS 352

Query: 481 TW---------SRRGFYKEFEEVF-RDEDTAKEL-AEACIRVAPKEDGGIGFFAVCFER 528
            W           +G     E  F   E+ AK    E CIRV P +    GFF    E+
Sbjct: 353 QWPVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFITVIEK 411

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 111/293 (37%), Gaps = 58/293 (19%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L    +  ++D CAAPG+KT  +   +       S  + A + D
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSGFVVANDAD 204

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAKPGK----FPDVTGFILDPSCSGSGIFG 378
             R+  L   +        I V H   F    K  +    F      + D  CSG G   
Sbjct: 205 YRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGTMR 264

Query: 379 RKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMS-FPSA 437
           + +   ++ + A G                           L + Q  I+   ++     
Sbjct: 265 KNINVWKDWATASGLG-------------------------LHTVQVNILNRGLNLLKDG 299

Query: 438 KKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVRK-----------RAGVIPTWS--R 484
            +LVYSTCS++  ENE +V      + +++WG +++            R+  I  W    
Sbjct: 300 GRLVYSTCSLNPIENEAVVA-----AALRKWGDKIKLVECGDKLPGLIRSQGISQWPVYD 354

Query: 485 RGF---YKEFEEV------FRDEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
           +GF    +  E V        DE+ +K   E+C+RV P +    GFF   FE+
Sbjct: 355 KGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEK 407

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 113/306 (36%), Gaps = 81/306 (26%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L       ++D CAAPG+KT  +   +  + A  +  + A + D
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTGFVVANDSD 204

Query: 324 PERAKTLRTM---INTAGCT---------KGIEVHVGDFTQLAKPGKFPDVTGF---ILD 368
             R+  L      +N+A              I++ VGD        K  D   F   + D
Sbjct: 205 YRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-------NKAKDALKFDRILCD 257

Query: 369 PSCSGSGIFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQF 425
             CSG G   RK ++   D N     G                           L + Q+
Sbjct: 258 VPCSGDGTM-RKNVNVWKDWNTQAGLG---------------------------LHTIQY 289

Query: 426 EIVKHAMS-FPSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR------KRAGV 478
            I+   +    +  +LVYSTCS++  ENE +V   L     + WG +++      K  G+
Sbjct: 290 NILNRGLHLLKTGGRLVYSTCSLNPIENEAVVARAL-----RTWGSKIKIINCDDKLPGL 344

Query: 479 I--------PTWSR------RGFYKEFEEVF--RDEDTAKELAEACIRVAPKEDGGIGFF 522
           I        P + R      +G     E  F   DE+      + C+RV P +    GFF
Sbjct: 345 IRSNGVTQWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQNCMRVYPHQQNTGGFF 404

Query: 523 AVCFER 528
               E+
Sbjct: 405 ITVIEK 410

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 110/295 (37%), Gaps = 62/295 (21%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L   S   ++D CAAPG+KT  +   +   +   +  + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGFVVANDAD 204

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAKPGK----FPDVTGFILDPSCSGSGIFG 378
             R+  L   +        + V H   F    K  K    F      + D  CSG G   
Sbjct: 205 ARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGTMR 264

Query: 379 RKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMS-FPSA 437
           + +   ++   A G                           L + Q  I+K  ++     
Sbjct: 265 KNVNVWKDWGTASGLG-------------------------LHTVQLNILKRGLNLLKKG 299

Query: 438 KKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR-----------KRAGVIPTWSRRG 486
            +LVYSTCS++  ENE +V   L     ++WG +++            R+  I  W    
Sbjct: 300 GRLVYSTCSMNPIENEAVVAAAL-----RQWGDKIKLVDCSDKLPGLVRSKGISNWPV-- 352

Query: 487 FYKEFEEVFR-DEDT--------AKELA----EACIRVAPKEDGGIGFFAVCFER 528
             K FE+  + DE T        A+E A    + CIRV P +    GFF    E+
Sbjct: 353 IDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 110/302 (36%), Gaps = 73/302 (24%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L   S   ++D CAAPG+KT  +   + +D    +  I A + D
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTGIIVANDSD 218

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLAKPGKFPDVTG-------------FILDP 369
             R+  L   +     +  + V H   F        FP++                + D 
Sbjct: 219 MRRSYLLVHQLKRLNSSNILVVNHDAQF--------FPNIRTNSLNNNITMKFDRILCDV 270

Query: 370 SCSGSGIFGRKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVK 429
            CSG G   RK I+  N                       D   +N L  L   Q  I+ 
Sbjct: 271 PCSGDGTL-RKNINIWN-----------------------DWRFQNAL-GLHRLQNNILN 305

Query: 430 HAMS-FPSAKKLVYSTCSVHAEENERIVVDLL---------------LDSKVKEWG---W 470
             +    +  +LVYSTCS++  ENE ++ + L               L   ++  G   W
Sbjct: 306 RGLQLLRNGGRLVYSTCSMNPIENEAVIANALRNWAGEVSLVNFDDELPGLIRSRGISSW 365

Query: 471 RVRKRAGVIPTWSRRGFYKEFEEVF---RDEDTAKELAEACIRVAPKEDGGIGFFAVCFE 527
            V  R G +     RG  +  +  F    DE     L E CIRV P +     FF   FE
Sbjct: 366 PVIDRNGEM---RERGDPETLDSWFPPTADEQKTFNL-EKCIRVYPHQQDTGAFFIAVFE 421

Query: 528 RD 529
           ++
Sbjct: 422 KN 423

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 114/302 (37%), Gaps = 72/302 (23%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L+      ++D CAAPG+KT  +   +  +    S  + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSGFVIANDAD 204

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDF--------TQLAKPGKFPDVTGFILDPSCSGS 374
            +R+  L   +        + V H   F        T+ +K  +F      + D  CSG 
Sbjct: 205 YKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPCSGD 264

Query: 375 GIFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHA 431
           G   RK ++   D N     G                           L   Q  I++  
Sbjct: 265 GTM-RKNVNVWKDWNTGSGLG---------------------------LHIVQLNILERG 296

Query: 432 MS-FPSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR-----------KRAGVI 479
           ++      KLVYSTCS++  ENE ++   L     + WG +VR            R+  I
Sbjct: 297 LNLLKEGGKLVYSTCSLNPIENEAVIAAAL-----RRWGDKVRLVNCDDQLPGLVRSKGI 351

Query: 480 PTWSRRGFYKEFEEVFRDED---------TAKELA----EACIRVAPKEDGGIGFFAVCF 526
             W  + + K+F+   +  +         TA+E+     E C+RV   +    GFF   F
Sbjct: 352 TEW--KVYDKQFQVREKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGGFFITVF 409

Query: 527 ER 528
           E+
Sbjct: 410 EK 411

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 109/293 (37%), Gaps = 67/293 (22%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L       ++D CAAPG+KTT +   + +D    +  + A + D
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGFVVANDAD 202

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDFTQLA----KPGKFPDVTGF---ILDPSCSGSG 375
             R+  L   +        + V H   F        +P K      F   + D  CSG G
Sbjct: 203 SRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSGDG 262

Query: 376 IFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAM 432
              RK ++   D N   A G                           L + Q  I+   +
Sbjct: 263 TM-RKNVNVWKDWNTQGALG---------------------------LHTVQLNILDRGL 294

Query: 433 S-FPSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVRK-----------RAGVIP 480
               +  +LVYSTCS++  ENE +V + L     + WG +VR            R+  I 
Sbjct: 295 HLLQNNGRLVYSTCSMNPIENEAVVAEAL-----RRWGDKVRLVDCSEKLPGLIRSQGIT 349

Query: 481 TW-----SRRGFYKEFEEVFR------DEDTAKELAEACIRVAPKEDGGIGFF 522
            W     +     KE E +        +E+ +K   E C+RV P +    GFF
Sbjct: 350 QWPVIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 111/298 (37%), Gaps = 63/298 (21%)

Query: 263 TGKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEK 322
            G +  Q+  S  P  +L   S   ++D CAAPG+KT  +   +  ++   +  + A + 
Sbjct: 143 VGNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTGIVVANDA 202

Query: 323 DPERAKTLRTMINTAGCTKGIEVH--VGDFTQLAKPGKFPDVTGF------ILDPSCSGS 374
           D  R+  L   +        + V+     F ++A      D   F      + D  CSG 
Sbjct: 203 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSGD 262

Query: 375 GIFGRKMIDDRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHAMSF 434
           G   + +   R+ +   G                           L + Q  I+   +  
Sbjct: 263 GTMRKNVNVWRDWTSQGGLG-------------------------LHNIQLNILNRGLHL 297

Query: 435 PSAK-KLVYSTCSVHAEENERIVVDLLLDSKVKEWGWRVR------KRAGVI-------- 479
              K +LVYSTCS++  ENE ++      + +++WG ++R      K  G++        
Sbjct: 298 LKPKGRLVYSTCSMNPIENEAVIA-----AALRKWGSKIRVINCDEKLPGLVRSKGIDSW 352

Query: 480 PTWSR---------RGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGFFAVCFER 528
           P ++R         +G    +     +E +   L + CIRV P +     FF    E+
Sbjct: 353 PVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNL-QNCIRVYPHQQNTGAFFITVIEK 409

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 111/303 (36%), Gaps = 74/303 (24%)

Query: 264 GKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKD 323
           G +  Q+  S  P  +L+      ++D CAAPG+KT  +   +  D    S  + A + D
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSGFVVANDSD 198

Query: 324 PERAKTLRTMINTAGCTKGIEV-HVGDF---TQL-AKPGK----FPDVTGFILDPSCSGS 374
            +R+  L   +        + V H   F    QL +  G+    +      + D  CSG 
Sbjct: 199 SKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPCSGD 258

Query: 375 GIFGRKMID---DRNKSKADGASPVXXXXXXXXXXDISDKDLKNRLEKLASFQFEIVKHA 431
           G   RK ++   D N   + G                           L + Q  I+   
Sbjct: 259 GTI-RKNVNIWKDWNTQNSLG---------------------------LHNVQLNILNRG 290

Query: 432 MS-FPSAKKLVYSTCSVHAEENERIVVDLLLDSKVKEWG--------------------- 469
           +    S  +LVYSTCS+   ENE ++      + +++WG                     
Sbjct: 291 IQLLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPGLISSPGI 345

Query: 470 --WRVRKRAGVIPTWSRRGFYKEFEEVFR-DEDTAKELAEA-CIRVAPKEDGGIGFFAVC 525
             W V  R   I +   +G  K  +  F+  E+ A +   + CIRV P +    GFF   
Sbjct: 346 SKWEVYDRTMSIVS---KGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNTGGFFIAV 402

Query: 526 FER 528
            E+
Sbjct: 403 LEK 405

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 50/128 (39%), Gaps = 10/128 (7%)

Query: 263 TGKVIIQDRASCFPAHILNASSEDLIIDACAAPGNKTTHV--AAHIFQDQAVESVRIHAF 320
            G +  Q+  S  P  +L       ++D CAAPG+KT  +  A H  +D+    V   A 
Sbjct: 144 VGNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTGFVV--AN 201

Query: 321 EKDPERAKTLRTMINTAGCTKGIEV-HVGDFTQLAK----PGKFPDVTGFILDPSCSGSG 375
           + D  R+  L   +        + V H   F    K      +F      + D  CSG G
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDG 261

Query: 376 IFGRKMID 383
              RK ++
Sbjct: 262 TM-RKNVN 268

>AGR036W Chr7 (774273..775193) [921 bp, 306 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR061C (TRM7)
          Length = 306

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 288 IIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDP----ERAKTLRTMI-NTAGCTKG 342
           ++D CAAPG+ +  ++  +F D      RI A +  P    E   TL+  I +    TK 
Sbjct: 45  VVDLCAAPGSWSQVLSRELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKI 104

Query: 343 IEVHVGDFTQLAKPGKFPDVTGF 365
           IE+  G+          PDVTG 
Sbjct: 105 IELFKGEKADFVCSDGAPDVTGL 127

>SAKL0A05478g Chr1 (498526..500262) [1737 bp, 578 aa] {ON} similar
           to uniprot|P38932 Saccharomyces cerevisiae YGL095C VPS45
           Protein of the Sec1p family essential for vacuolar
           protein sorting required for the function of both Pep12p
           and the early endosome/late Golgi SNARE Tlg2p
          Length = 578

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 199 WF--RLNPIRCGAKSEDILQELSKKFPTRVNS 228
           WF  RLN    G   +D++ EL+KKF TR+ S
Sbjct: 438 WFGSRLNKTSTGKDKDDLISELTKKFNTRMGS 469

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 8/71 (11%)

Query: 286 DLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345
           D++++     GN TT +          ++ ++ A E DP  A  L   ++     K +E+
Sbjct: 58  DIVLEVGPGTGNLTTRILE--------KARKVVAVEFDPRMAAELTKRVHGTAAEKKLEI 109

Query: 346 HVGDFTQLAKP 356
            +GDFT+   P
Sbjct: 110 ILGDFTKTELP 120

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 69/169 (40%), Gaps = 31/169 (18%)

Query: 88   TNPKHIYAAVYSCWRYNEFLD---KLLKRSGILKDIPK-------KKGKEVFN------- 130
            ++PK+++ +V+S WR  E  D     + R   L DI K       K G E F        
Sbjct: 1511 SDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEKNLINNTTKIGMESFYFTIYSQR 1570

Query: 131  --------PTTIKLLVHDLLFSKNKRIQMGKHPLKEF-----VLKYKARLSSELVRLKIK 177
                     T I +++  +L  +  +        K +     V  +K  L  +L+RLK K
Sbjct: 1571 YAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDITGTVGTFKGELGDQLIRLK-K 1629

Query: 178  LKVTDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTRV 226
            L   D  ++  +   D +  ++F++N +    K E  L   + K  +R+
Sbjct: 1630 LYSEDKAKIRSEKSTDFSIPKFFKINIVLIVEKGELTLAAANTKLISRI 1678

>ZYRO0B13992g Chr2 complement(1137166..1140828) [3663 bp, 1220 aa]
           {ON} some similarities with uniprot|Q06673 Saccharomyces
           cerevisiae YLR436C ECM30 Non-essential protein of
           unknown function
          Length = 1220

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 79/191 (41%), Gaps = 40/191 (20%)

Query: 75  TLVLNSCKKYQL----KTNPKHIYAAVYSCWRYNEFLDKLLKRSGILKDIPKKKGKEVFN 130
           T+++ + K +Q     K  PK I  ++Y    Y +F D  + ++G         G E+  
Sbjct: 463 TILVQNNKNFQNYVADKFGPKLIIFSIY----YLQFYDNNVNQNG---------GWEL-G 508

Query: 131 PTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKARLSSELVRLKI---------KLKVT 181
            T I L  +  LF  +K++ + K  L+ F   Y         +L              + 
Sbjct: 509 STVIPLCYNLALFFSSKKLVLSKM-LETFSPNYYTNKLPNFFKLSSGNINHITYRDFAIV 567

Query: 182 DLQQL-LKDDRNDMTPVRW-----FRLNPIRCGAKSEDILQELSKKFPTRVNSWTNIAPG 235
            L  + + D R+++ P  W     + L PIR   + E+++Q  SKK P       NI  G
Sbjct: 568 HLCNMAISDVRDNLQPRPWIFELIYNLLPIRANLRDEELVQLSSKKRP------KNIGSG 621

Query: 236 CIYHDEYIPGL 246
            I ++  +P L
Sbjct: 622 GISYNAAMPLL 632

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,972,495
Number of extensions: 2321634
Number of successful extensions: 5888
Number of sequences better than 10.0: 74
Number of HSP's gapped: 5929
Number of HSP's successfully gapped: 93
Length of query: 529
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 415
Effective length of database: 40,409,475
Effective search space: 16769932125
Effective search space used: 16769932125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)