Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G10340g2.285ON70870838260.0
Kwal_27.115372.285ON70870834320.0
SAKL0E07700g2.285ON71270730760.0
NCAS0G038002.285ON72667229010.0
Ecym_33242.285ON70667028990.0
NDAI0G006502.285ON68966928870.0
ZYRO0A01870g2.285ON70771528820.0
Skud_14.3082.285ON70670728790.0
TDEL0G021602.285ON71469828700.0
ADL216C2.285ON70570428640.0
Smik_14.3102.285ON70670628600.0
YNL021W (HDA1)2.285ON70670728580.0
CAGL0J03454g2.285ON69370528450.0
Suva_14.3262.285ON70670728410.0
KNAG0H020102.285ON69370928380.0
KLLA0E08383g2.285ON70470228040.0
KAFR0H033202.285ON70267627200.0
Kpol_1039.322.285ON65965626350.0
TPHA0C033902.285ON70170225580.0
TBLA0B069502.285ON79547119590.0
Kpol_1003.372.285ON57829813301e-176
TPHA0H003208.153ON4503823693e-37
NCAS0B054808.153ON4513673589e-36
SAKL0H25124g8.153ON4483663552e-35
Ecym_23468.153ON4853363563e-35
KLLA0F09119g8.153ON4523573544e-35
TDEL0B045808.153ON4463613501e-34
KAFR0C029208.153ON4533563501e-34
AFR172C8.153ON4493353492e-34
KLTH0E06446g8.153ON4493683463e-34
NDAI0B027108.153ON4533783455e-34
CAGL0A03322g8.153ON4503853447e-34
YGL194C (HOS2)8.153ON4523303439e-34
Kpol_246.58.153ON4533593421e-33
TBLA0D021408.153ON4563693412e-33
Smik_7.798.153ON4523303412e-33
Kwal_55.207908.153ON4493583402e-33
Kpol_1038.113.8ON4333253392e-33
Skud_7.798.153ON4523293393e-33
KAFR0A086303.8ON4333263375e-33
TBLA0I005603.8ON4333263357e-33
KLLA0E01981g3.8ON4323263349e-33
AGR395W3.8ON4333253341e-32
Ecym_20103.8ON4333253341e-32
Kwal_55.221423.8ON4323403331e-32
Suva_7.718.153ON4523293342e-32
Suva_14.113.8ON4333263332e-32
ZYRO0G19316g8.153ON4483353332e-32
KNAG0G013508.153ON4513353332e-32
Skud_14.113.8ON4333263322e-32
TPHA0A003003.8ON4333263322e-32
ZYRO0C03498g3.8ON4333253303e-32
KNAG0A011603.8ON4333263304e-32
CAGL0B01441g3.8ON4333263294e-32
NDAI0G037403.8ON4333253294e-32
KLTH0F19668g3.8ON4323413294e-32
SAKL0C13706g3.8ON4333253294e-32
Smik_14.23.8ON4333143278e-32
NCAS0C043203.8ON4343253278e-32
YNL330C (RPD3)3.8ON4333263261e-31
TDEL0A002703.8ON4333263199e-31
TDEL0A055208.607ON6743761932e-14
Skud_16.3533.362ON4711761912e-14
SAKL0B07854g3.362ON4892291903e-14
KLTH0F10582g3.362ON4741761893e-14
Suva_16.3963.362ON4771761876e-14
TDEL0C050403.362ON4541471859e-14
NDAI0A051203.362ON5082811851e-13
Ecym_82908.607ON7093351861e-13
ADL265W8.607ON6943801852e-13
YPL116W (HOS3)8.607ON6973721842e-13
CAGL0D01430g3.362ON4452981803e-13
TBLA0B023903.362ON5791791805e-13
KAFR0H027908.607ON7173461816e-13
Smik_16.3093.362ON4701761787e-13
NCAS0A111803.362ON4902561789e-13
YPR068C (HOS1)3.362ON4701761779e-13
Smik_6.3158.607ON6973721771e-12
Suva_16.1948.607ON6993731771e-12
Kpol_376.153.362ON5181761752e-12
KAFR0H008903.362ON4741851752e-12
Kwal_23.37243.362ON4732551742e-12
KNAG0H006303.362ON4561431742e-12
TBLA0E040808.607ON6943361753e-12
KLTH0D09592g8.607ON7053061743e-12
ZYRO0C16390g3.362ON4362311715e-12
ZYRO0F10780g8.607ON6683361719e-12
KLLA0B09394g3.362ON4411731681e-11
Kpol_479.68.607ON6883371663e-11
SAKL0H08338g8.607ON6903381636e-11
TPHA0A011208.607ON6982551637e-11
Kwal_26.85058.607ON7082981628e-11
NCAS0C017608.607ON7003731621e-10
ADL339W3.362ON4371751601e-10
KNAG0J013008.607ON6773481611e-10
TPHA0M015903.362ON4942681547e-10
Skud_16.1648.607ON6973711531e-09
Ecym_34653.362ON4451531465e-09
KLLA0F00858g8.607ON715651468e-09
NDAI0E024808.607ON684981451e-08
CAGL0J06974g8.607ON6782481432e-08
AFR659W1.92ON27371742.3
Smik_16.2238.78ON1226136733.7
KLTH0F02882g1.104ON81166725.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G10340g
         (708 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1478   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1326   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1189   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1122   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1121   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1116   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1114   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1113   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1110   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1107   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1106   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1105   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1100   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1098   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1097   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1084   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1052   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1019   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   989   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   759   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   516   e-176
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   146   3e-37
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   142   9e-36
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   141   2e-35
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   141   3e-35
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   140   4e-35
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   139   1e-34
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   139   1e-34
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   139   2e-34
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   137   3e-34
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    137   5e-34
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   137   7e-34
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   136   9e-34
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   136   1e-33
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   135   2e-33
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   135   2e-33
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   135   2e-33
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   135   2e-33
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   135   3e-33
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   134   5e-33
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   133   7e-33
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   133   9e-33
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   133   1e-32
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   133   1e-32
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   132   1e-32
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   133   2e-32
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   132   2e-32
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   132   2e-32
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   132   2e-32
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   132   2e-32
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   132   2e-32
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   131   3e-32
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   131   4e-32
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   131   4e-32
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   131   4e-32
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   131   4e-32
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   131   4e-32
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   130   8e-32
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      130   8e-32
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   130   1e-31
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   127   9e-31
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    79   2e-14
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    78   2e-14
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    78   3e-14
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    77   3e-14
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    77   6e-14
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    76   9e-14
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    76   1e-13
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    76   1e-13
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    76   2e-13
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    75   2e-13
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    74   3e-13
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    74   5e-13
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    74   6e-13
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    73   7e-13
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    73   9e-13
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    73   9e-13
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    73   1e-12
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    73   1e-12
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    72   2e-12
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    72   2e-12
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    72   2e-12
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    72   2e-12
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    72   3e-12
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    72   3e-12
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    70   5e-12
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    70   9e-12
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    69   1e-11
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    69   3e-11
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    67   6e-11
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    67   7e-11
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    67   8e-11
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    67   1e-10
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    66   1e-10
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    67   1e-10
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    64   7e-10
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    64   1e-09
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    61   5e-09
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    61   8e-09
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    60   1e-08
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    60   2e-08
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    33   2.3  
Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL01...    33   3.7  
KLTH0F02882g Chr6 (248890..251325) [2436 bp, 811 aa] {ON} simila...    32   5.8  

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1478 bits (3826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/708 (100%), Positives = 708/708 (100%)

Query: 1   MTESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTG 60
           MTESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTG
Sbjct: 1   MTESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTG 60

Query: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLML 120
           LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLML
Sbjct: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLML 120

Query: 121 KIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCG 180
           KIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCG
Sbjct: 121 KIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCG 180

Query: 181 GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240
           GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI
Sbjct: 181 GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240

Query: 241 MVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNI 300
           MVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNI
Sbjct: 241 MVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNI 300

Query: 301 PWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360
           PWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT
Sbjct: 301 PWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360

Query: 361 HMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSV 420
           HMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSV
Sbjct: 361 HMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSV 420

Query: 421 IKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPL 480
           IKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPL
Sbjct: 421 IKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPL 480

Query: 481 FKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKW 540
           FKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKW
Sbjct: 481 FKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKW 540

Query: 541 ASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHS 600
           ASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHS
Sbjct: 541 ASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHS 600

Query: 601 GVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGND 660
           GVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGND
Sbjct: 601 GVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGND 660

Query: 661 GNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           GNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE
Sbjct: 661 GNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1326 bits (3432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/708 (87%), Positives = 668/708 (94%)

Query: 1   MTESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTG 60
           MTE+  +KQE+  +Q NG KRD E+A L +  G   +  KRP IVPACR KLHYTPLKTG
Sbjct: 1   MTEAVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTG 60

Query: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLML 120
           LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD IGDLML
Sbjct: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLML 120

Query: 121 KIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCG 180
           KIP REATDEEILQVHT EHLEF+SKTTSMTR+QLLKETEKGDSVYFNNDSYLSAKLSCG
Sbjct: 121 KIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCG 180

Query: 181 GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240
           GAIEAC+AVVEGRVKNALAVVRPPGHHAEP++AGGFCLFSNVAVAAQNILKNYPESV+KI
Sbjct: 181 GAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240

Query: 241 MVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNI 300
           M+LDWDVHHGNGTQKAFY+DDRVLY+SLHRHELGKYYPGTIHGN+DRVGEGKGEGFNCNI
Sbjct: 241 MILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNI 300

Query: 301 PWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360
           PWPWKGVGD+EY+WAFEQV++PMGREF+PDLVIISSGFDAADGDTVGQCHVTPSCYGHMT
Sbjct: 301 PWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360

Query: 361 HMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSV 420
           HMLKSLARGN+CAVLEGGYSLDSIAKSAL VAKVLIGEPPDELPVVKQPK EAVEVID+V
Sbjct: 361 HMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAV 420

Query: 421 IKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPL 480
           IK QS+YW+CFKSTH NDGCSFKE  T+T +N+NFPLQ AIRQQQ+RLL  E+ FVTLPL
Sbjct: 421 IKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPL 480

Query: 481 FKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKW 540
            KKELPDDTA+CSPNIYD+ +IIVCVHDTP IWAQRSRATGTIDPSTSIIVDTTLDVIKW
Sbjct: 481 IKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKW 540

Query: 541 ASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHS 600
           AS RNYGVIDINIPQSLHEQDNYSAV+TAQEVLV+IWD+YLKYF SL++VAFV+IGDA+S
Sbjct: 541 ASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYS 600

Query: 601 GVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGND 660
           GVVHLLGHRDTR+VVK+A+SF+DQRPLRPL+PLVDE+LADWYFKNSLVFASA HTCWGND
Sbjct: 601 GVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGND 660

Query: 661 GNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           G ENKKPRKKFGRVLKC+SDG+NNILEERFEEATDFILDTFEEWSDSE
Sbjct: 661 GAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1189 bits (3076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/707 (77%), Positives = 627/707 (88%), Gaps = 10/707 (1%)

Query: 4   SAEVKQEEP-SEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLC 62
           + EVK E+    +++ ++ + ES   + GT         P IVP   P++HYT LKTGLC
Sbjct: 14  AVEVKMEDSLKRKVDTMEDEVESRKRSTGT--------LPVIVPEVPPRIHYTQLKTGLC 65

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKI 122
           YDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD IG+LMLKI
Sbjct: 66  YDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKI 125

Query: 123 PVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGA 182
           PVREAT EEILQVHTKEHL F+ KT  MTR+QLLKETE GDSVYFNNDS LSAKLSCGGA
Sbjct: 126 PVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGA 185

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           IEACKAVVEGRVKNALAV+RPPGHHAEPE+AGGFCLFSNVAVAAQNILKNYPESVR+IM+
Sbjct: 186 IEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMI 245

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           LDWD+HHGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT+HGN ++ GEGKGEGFNCNIPW
Sbjct: 246 LDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPW 305

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
           P+ G+GD+EY+WAF+QV+MPMGREF+PDLVIISSGFDAADGDT+GQCHV+PSCYGHMTHM
Sbjct: 306 PYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHM 365

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEAVEVIDSVI 421
           LKSLARGNLC VLEGGY+LDSIAKSAL VAK+LIGEPPDELP   +QPK EA+E I++VI
Sbjct: 366 LKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVI 425

Query: 422 KTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLF 481
           +TQSKYW CFKSTH NDGC+FKE+ T++ I+KNFPLQ AIRQ+Q++ L+ +F FVTLPL 
Sbjct: 426 RTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLSEKFGFVTLPLL 485

Query: 482 KKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWA 541
             E+P DT ICSPNIYDA  ++VCVHDTP IWAQR+  TGTIDPSTSIIVDTTLD+IKW+
Sbjct: 486 NMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWS 545

Query: 542 SSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSG 601
             R Y VID+NIPQSL EQDNYSA+IT+QEVLV+IWDNYLKYFPSL +VAF+ +GDA+SG
Sbjct: 546 LQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSG 605

Query: 602 VVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDG 661
           +VHLLGHRDTRSVVK+AVSFVD +PL+ L+PLVDE+L +WYFKNSLVF S  H+CWG DG
Sbjct: 606 IVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDG 665

Query: 662 NENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           NENKKPRK+FGRVLKCD+ G+NNI+EERF+EATDFILD+FEEWSDSE
Sbjct: 666 NENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1122 bits (2901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/672 (75%), Positives = 599/672 (89%), Gaps = 3/672 (0%)

Query: 38  VAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 97
           V++RP IVP    +L YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI
Sbjct: 57  VSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 116

Query: 98  LAENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLK 157
           LAENGLI DPTLSG++ IGDLMLKIPVR+AT+EEIL+VH+KEH +FI KT++M R++LLK
Sbjct: 117 LAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLK 176

Query: 158 ETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFC 217
            TEKGDSVYFNNDS+ SAKL  GG+IEACKAVVEGRVKN+LAVVRPPGHHAEP+ AGGFC
Sbjct: 177 ATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFC 236

Query: 218 LFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYY 277
           LFSNVA+AA+NILKNYPESVR+IM+LDWD+HHGNGTQKAFYDDDRVLYISLHR ELGKYY
Sbjct: 237 LFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYY 296

Query: 278 PGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSG 337
           PGTI+G  D+ GEGKGEGFNCNI WP  GVGD+EY+WAFEQV+MPM REF+PDLVIISSG
Sbjct: 297 PGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSG 356

Query: 338 FDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIG 397
           FDAADGD++GQCHVTPSCYGHMTHMLKSLA+GNLC VLEGGY+LD+IA+SAL+VAK+LIG
Sbjct: 357 FDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIG 416

Query: 398 EPPDELP-VVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFP 456
           EPPDELP  ++ PK EA+E+ID VI+ QSKYWKCFK  +GN GC+FK++  ++ I+KNFP
Sbjct: 417 EPPDELPDPLRDPKPEAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFP 476

Query: 457 LQNAIRQQQMRLLANEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQR 516
           LQ AIR+QQ+  L+ +F+F TLPL K ELP DT +CSPN+Y +  +I+C HDTP IWA+R
Sbjct: 477 LQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKR 536

Query: 517 SRATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHI 576
               GTIDPS+SIIVD+TLD IKWA+ + YGVIDINIPQ+L EQ+NYSA++T+QEVL +I
Sbjct: 537 DVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYI 596

Query: 577 WDNYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDE 636
           WDNYLKYFP++ +VAF+ IGDA+SG+VHLLGHRDTRSVVKS ++F+ Q+ LR L+PLVDE
Sbjct: 597 WDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDE 656

Query: 637 TLADWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDF 696
           +L+DWYFKNSLVF+   HT WG+   ENKKPRKK+GR+L+C++DGINNI+EERFEEATDF
Sbjct: 657 SLSDWYFKNSLVFSDKSHTYWGD--KENKKPRKKYGRLLRCETDGINNIVEERFEEATDF 714

Query: 697 ILDTFEEWSDSE 708
           ILD+FEEWSDSE
Sbjct: 715 ILDSFEEWSDSE 726

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1121 bits (2899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/670 (75%), Positives = 597/670 (89%), Gaps = 1/670 (0%)

Query: 40  KRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99
           KRP IVP  +PK+HY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 37  KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 96

Query: 100 ENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKET 159
           ENGLI+DPTLSGVD IG+LMLKIP+REAT++EIL VH+KEH+EF+  T +M+R+QLLKET
Sbjct: 97  ENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET 156

Query: 160 EKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 219
           E GDSVY+NNDS +SAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF
Sbjct: 157 EAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 216

Query: 220 SNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPG 279
           SNVAVAA+NILKNYPESVRK+M+LDWD+HHGNGTQ+AFY+D+RVLY+SLHR+ELG+YYPG
Sbjct: 217 SNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPG 276

Query: 280 TIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFD 339
           T +GN ++ GEGKGEGFNCNIPW   GVGD+EY+WAFEQ+++PMGREF+PDLVIISSGFD
Sbjct: 277 TEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFD 336

Query: 340 AADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEP 399
           AADGDT+GQCHV+P+CYGHMTHMLKSLA+GN+C VLEGGY+LDSIAKSAL V KVLIGEP
Sbjct: 337 AADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEP 396

Query: 400 PDELP-VVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQ 458
           PDELP   KQPK EA+  I++VI+ Q+KYW CFKS HGN G ++KE   ++   KNFPLQ
Sbjct: 397 PDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQ 456

Query: 459 NAIRQQQMRLLANEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSR 518
           +A+RQ+Q R L+ E++FVTLPL   EL  DT ICSPNI++   +I+CVHDTP +WA+R+ 
Sbjct: 457 SAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNP 516

Query: 519 ATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWD 578
            TG IDPSTSIIVDTTL +  WA  R+YG+IDINIPQSL E DNYSAV+T+QEVL ++WD
Sbjct: 517 LTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWD 576

Query: 579 NYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETL 638
           +YLK+F  L RVAFV IGDA+SG VHLLGHRDTRS+VK A+SF D++ LRPL+PLVDE++
Sbjct: 577 HYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESI 636

Query: 639 ADWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFIL 698
           +DWYFKNSL+F S  H+CWG +GN++KKPRKKFGRVLKC+SDG+NNILEERFEEATDFIL
Sbjct: 637 SDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFIL 696

Query: 699 DTFEEWSDSE 708
           D+FEEWSDSE
Sbjct: 697 DSFEEWSDSE 706

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/669 (76%), Positives = 593/669 (88%), Gaps = 3/669 (0%)

Query: 41  RPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 100
           R  IVP    ++HYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82

Query: 101 NGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETE 160
           NGLI DPTLSG+D IGDLMLKIPVREAT EEIL+VH+KEHL+FI  T+ M R+QLLK TE
Sbjct: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142

Query: 161 KGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFS 220
            GDSVYFN+DSY SAKL  GGAIEACKAVVEGRVKNALAVVRPPGHHAEPE AGGFCLFS
Sbjct: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202

Query: 221 NVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGT 280
           NVA+AA+NILKNYPESVRKI++LDWD+HHGNGTQKAFYDDDR+LY+SLHR ++GKYYPGT
Sbjct: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262

Query: 281 IHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDA 340
           IHG  D+ GEGKGEGFNCNI WP  GVGD+EY+WAFEQ++MPMGREF+PDLVIIS+GFDA
Sbjct: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322

Query: 341 ADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPP 400
           ADGDT+GQCHVTPSCYGHMTHMLKSLARGN+  VLEGGY+LDSIA SAL+VAK+LIGEPP
Sbjct: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382

Query: 401 DELP-VVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQN 459
           DELP V + PK E +E+ID V++ QSKYWKCFKS  GN GC F+EQ  ++   KNFPLQ+
Sbjct: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442

Query: 460 AIRQQQMRLLANEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRA 519
           AIRQQQ+R L+ EF F  LP++K ELP+DT +CS NIY+++ II+CVHDTP IWA+R   
Sbjct: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502

Query: 520 TGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDN 579
            GTIDPS+SIIVD++LD+IKWA  R YGVIDINIPQ+L EQ+NY ++ITAQEVL+++WDN
Sbjct: 503 QGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562

Query: 580 YLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLA 639
           YLKYFP++N++AFV IGDA+SG+VHLLGHRDTRSVVK+ ++FV Q+ L+PL+PLVDE+L 
Sbjct: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622

Query: 640 DWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILD 699
           +WYFKNSLVF++  H  WG+   ENKKPRKK+GRVL+CD+DGI+NI+EERFEEATDFILD
Sbjct: 623 EWYFKNSLVFSNKNHIYWGD--KENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILD 680

Query: 700 TFEEWSDSE 708
           +FEEWSDSE
Sbjct: 681 SFEEWSDSE 689

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1114 bits (2882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/715 (73%), Positives = 610/715 (85%), Gaps = 15/715 (2%)

Query: 1   MTESAEVKQEEPSEQINGLKRDHESATLN--DGTGNQASVA----KRPTIVPACRPKLHY 54
           M     VKQE+      G KR  E +     +   N ASV+    KR  IVPAC PK+HY
Sbjct: 1   MNTDNPVKQED-----EGSKRKLEESPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHY 55

Query: 55  TPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDS 114
           TPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSG D 
Sbjct: 56  TPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDD 115

Query: 115 IGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLS 174
           IG+LMLKIPVREAT EE+LQVHTKEHLEFI KT+ M R++LLKETE GDSVYFN+DSY +
Sbjct: 116 IGELMLKIPVREATVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSA 175

Query: 175 AKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYP 234
           AKL CGGAIEACKAVVEGRVKNALAV+RPPGHHAEPE+AGGFCLFSNVAVAAQNILKNYP
Sbjct: 176 AKLPCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYP 235

Query: 235 ESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGE 294
           ESVR+I++LDWD+HHGNGTQKAFY+DDRVLYISLHR ELGKYYPGTIHG  D+ GEGKGE
Sbjct: 236 ESVRRILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGE 295

Query: 295 GFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPS 354
           GFNCNI WP  GVGD+EY+ AFEQ++MPM RE+RPDLVIISSGFDAADGDT+GQCHV+PS
Sbjct: 296 GFNCNITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPS 355

Query: 355 CYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEA 413
           CYGHMTHMLKSLARGNLC  LEGGY+LD+IA SAL+VAK+LIGEPP+ELP   K PKLEA
Sbjct: 356 CYGHMTHMLKSLARGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEA 415

Query: 414 VEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEF 473
           +E+ID VI  QSKYWKCF+   GN GC+FKE  T++ I KNFPLQ AIRQ+Q   L  E+
Sbjct: 416 IEMIDKVIHVQSKYWKCFRRL-GNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEY 474

Query: 474 RFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDT 533
            FVTLP+ K ELP+DT +CSP+++  S +I+ VHDTP IWA+R   TG IDPSTSI VD+
Sbjct: 475 GFVTLPVPKLELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDS 534

Query: 534 TLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFV 593
            LD IKW+ +R YGVID+NIPQSL EQDNYSA+IT+QEVL+++WDN++KYFPSL++VAFV
Sbjct: 535 PLDFIKWSLARKYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFV 594

Query: 594 AIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAE 653
            +GDA+SG+VHLLGHRDTRSVVK+ ++FV ++ L+PL+PLVDE+L DWYFKNSLVF+   
Sbjct: 595 GVGDAYSGIVHLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRN 654

Query: 654 HTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           + CW +  NENKKPR+KFGRVL+C+SDGINN +EERF+EATDFILD+FEEWSDSE
Sbjct: 655 NPCWVD--NENKKPRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1113 bits (2879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/707 (71%), Positives = 605/707 (85%), Gaps = 3/707 (0%)

Query: 3   ESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLC 62
           +SA VK E      + LKR  E+   +  + +  S  KR  IVPAC PK+HY+PLKTGLC
Sbjct: 2   DSARVKNEVLENPDHDLKRTLENTKEDQNSLSTTSRNKRQVIVPACTPKIHYSPLKTGLC 61

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKI 122
           YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGVD IGDLMLKI
Sbjct: 62  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLKI 121

Query: 123 PVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGA 182
           PVR AT EEIL+VHTKEHLEFI  T  M+R+QLLKETEKGDSVYFNNDSY SA+L CGGA
Sbjct: 122 PVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGA 181

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           IEACKAVVEGRVKN+LAVVRPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR+IM+
Sbjct: 182 IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMI 241

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           LDWD+HHGNGTQK+FY DD+VLY+SLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI W
Sbjct: 242 LDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITW 301

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
           P  GVGD+EY+WAFEQV+MPMGREF+PDLVIISSGFDAADGDT+GQCHV+PSCYGHMTHM
Sbjct: 302 PVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHM 361

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEAVEVIDSVI 421
           LKSLARGNLC VLEGGY+LD+IA+SAL+VAKVLIGEPPDELP  +  PK E +E+ID VI
Sbjct: 362 LKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKVI 421

Query: 422 KTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLF 481
           + QSKYW CF+  H N GC+F E   D+ I+KNFPLQ AIRQQQ++ L+NEF FVTLPL 
Sbjct: 422 RLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPLI 481

Query: 482 KKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWA 541
              LPD+TA+C+PN+++++A++V VHDT  +WA+R+  +GTID S+S+I+D  +D IKW 
Sbjct: 482 NMGLPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWG 541

Query: 542 SSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSG 601
             R YG+ID+NIP +L E DNYS +IT+QEVL+++WDNY+KYFP++ ++AF+ IGD+HSG
Sbjct: 542 LDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSG 601

Query: 602 VVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDG 661
           +VHLLGHRDTR+V K+ ++F+  + L+PL+PLVDETL++WYFKNSL+F++  H CW    
Sbjct: 602 IVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKE-- 659

Query: 662 NENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           NE++KPRKKFGRVL+CD+DG++N +EERFEEATDFILD+FEEWSD E
Sbjct: 660 NESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/698 (73%), Positives = 598/698 (85%), Gaps = 12/698 (1%)

Query: 14  EQINGL--KRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYHA 71
           EQ +GL  K+   + T N   G +        IVPAC P LHYTPLKT LCYDVRMRYHA
Sbjct: 26  EQNDGLDPKKSQLARTQNGAAGKR-------VIVPACAPNLHYTPLKTALCYDVRMRYHA 78

Query: 72  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREATDEE 131
           KIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI+DPTLSG+D IGDLMLKIPVREATDEE
Sbjct: 79  KIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEE 138

Query: 132 ILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVE 191
           IL+VH+KE+LEF+ +++ M R++LLKETEKGDSVYFNNDSY+SAKLSCGG I+ACKAVVE
Sbjct: 139 ILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVE 198

Query: 192 GRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGN 251
           GRVKNALAVVRPPGHHAEPE  GGFCLFSNVAVAAQNILK YPESVR+I++LDWD+HHGN
Sbjct: 199 GRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGN 258

Query: 252 GTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSE 311
           GTQKAFY+D RVLYISLHR E+GKYYPGTI+G  D+ GEGKGEGFNCNI WP  GVGD+E
Sbjct: 259 GTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAE 318

Query: 312 YLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNL 371
           Y+ AFEQ++MPM REF+PDLVIISSGFDAADGDT+GQCHVTPSCYG MTHMLKSLARGNL
Sbjct: 319 YMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNL 378

Query: 372 CAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEAVEVIDSVIKTQSKYWKC 430
           C  LEGGY+LD+IA SAL+VAKVLIGEPPDELP   K PKLEA+E+ID+VI TQSKYWKC
Sbjct: 379 CVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKC 438

Query: 431 FKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFKKELPDDTA 490
           F+   GN GC+F E  T+T I+K+FPLQ AIRQ+Q R L+ E+ FVTLP+ K E+PDD+ 
Sbjct: 439 FQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSV 498

Query: 491 ICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSRNYGVID 550
           +CSP ++  S I++ VHDTP IWA+R   TG IDPSTSIIVD+ LD  KW  +R YGVID
Sbjct: 499 LCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVID 558

Query: 551 INIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRD 610
           +NIPQSL EQDNYSA+IT+QEVL++IWDNY+KYFPSL +VAFV  GDA++G+VHLLGHRD
Sbjct: 559 VNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRD 618

Query: 611 TRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNENKKPRKK 670
           TR+ VK+ VSF+ ++ L+PL+PLVDE+L+DWYFKNSL+F    H CW +  NE+KKPRKK
Sbjct: 619 TRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWAD--NESKKPRKK 676

Query: 671 FGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           FGRVL+CD+DG+N+ +EERFEEATDFILD FEEWSDSE
Sbjct: 677 FGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1107 bits (2864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/704 (74%), Positives = 598/704 (84%), Gaps = 5/704 (0%)

Query: 10  EEPSEQINGLKRDHESATLNDGTGN-QASVAKRPTIVPACRPKLHYTPLKTGLCYDVRMR 68
           EE ++Q   L+        N G  + +A V KRP IVP  RPK+ Y PLKTGLCYDVRMR
Sbjct: 2   EERTQQKRKLEEGSPDGEANGGQASRKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMR 61

Query: 69  YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREAT 128
           YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSG+D IG+LM KIPVREAT
Sbjct: 62  YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREAT 121

Query: 129 DEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACKA 188
           +EEIL VH+KEH+EF+  T +M R+QLLKETE GDSVY+NNDS +SA+LSCGGAIEACKA
Sbjct: 122 EEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACKA 181

Query: 189 VVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVH 248
           VVEGRVKNA+AVVRPPGHHAEP VAGGFCLFSNVAVAAQNILKNYPESVR++M+LDWD+H
Sbjct: 182 VVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIH 241

Query: 249 HGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVG 308
           HGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT +GN D+ G+GKGEGFNCNIPW   GVG
Sbjct: 242 HGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVG 301

Query: 309 DSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLAR 368
           D+EY+WAFEQV++PMGREF+PDLVIISSGFDAADGDT+GQCHV+P+CYGH+THMLKSLAR
Sbjct: 302 DAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLAR 361

Query: 369 GNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPV-VKQPKLEAVEVID-SVIKTQSK 426
           GN+C VLEGGY+LDSIAKSAL VAKVLIGEPPDELP  +KQPK EA+  ID  ++K QSK
Sbjct: 362 GNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSK 421

Query: 427 YWKCFKSTHGNDGCSFKEQAT-DTAINKNFPLQNAIR-QQQMRLLANEFRFVTLPLFKKE 484
           YW CFK  HGNDG +++E A  D+  +KNFPLQ       Q R LA E++FVTLPL   E
Sbjct: 422 YWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNME 481

Query: 485 LPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSR 544
           LP DT ICSPNI+   AII+CVHDTP IWAQR   TG IDPSTSIIVDTT+ VI WA  R
Sbjct: 482 LPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGR 541

Query: 545 NYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVH 604
           NYGVIDINIPQSL EQDNYSAV+++QEV+ ++WD+YLK FP L RVAFV IGDA+SG VH
Sbjct: 542 NYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVH 601

Query: 605 LLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNEN 664
           LLGHRDTRSVVK A++F D++ LRPL+PLVDE+L DWYFKNSLVF S  H CWG DGN++
Sbjct: 602 LLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDS 661

Query: 665 KKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           KKPRKKFGRVL+   DG+NNI+EER EEATDFILD+FEEWS+SE
Sbjct: 662 KKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1106 bits (2860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/706 (71%), Positives = 601/706 (85%), Gaps = 4/706 (0%)

Query: 5   AEVKQEEPSEQING-LKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLCY 63
           +E+ ++E  E  +G LKR  E    +  + +  S  KR  IVPAC PK+HY+PLKTGLCY
Sbjct: 3   SEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCY 62

Query: 64  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIP 123
           DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGVD +GDLMLKIP
Sbjct: 63  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIP 122

Query: 124 VREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAI 183
           VR AT EEIL+VHTKEHLEFI  T  M+R+QLLKETEKGDSVYFNNDSY SA+L CGGAI
Sbjct: 123 VRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAI 182

Query: 184 EACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVL 243
           EACKAVVEGRVKN+LAVVRPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR+IM+L
Sbjct: 183 EACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMIL 242

Query: 244 DWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWP 303
           DWD+HHGNGTQK+FY DD+VLY+SLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI WP
Sbjct: 243 DWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWP 302

Query: 304 WKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHML 363
             GVGD+EY+WAFEQV+MPMGREF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHML
Sbjct: 303 VGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHML 362

Query: 364 KSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEAVEVIDSVIK 422
           KSLARGNLC VLEGGY+LD+IA+SAL+VAKVLIGEPPDELP     PK E +E+ID VI+
Sbjct: 363 KSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKVIR 422

Query: 423 TQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFK 482
            QSKYW CF+  H N GC+F E   D+ ++KNFPLQ AIRQQQ   L++EF  VTLPL  
Sbjct: 423 LQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLIN 482

Query: 483 KELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWAS 542
            +LPD+T +C+PN+Y+++ ++V VHDT  IWA+R+  +GTID S+S+I+D  LD IKW  
Sbjct: 483 MDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGL 542

Query: 543 SRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGV 602
            R YG+ID+NIP SL E DNYS +IT+QEVL+++WDNY+KYFP++ ++AFV IGD++SG+
Sbjct: 543 DRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGI 602

Query: 603 VHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGN 662
           VHLLGHRDTR+V K+ ++F+  + L+PL+PLVDETL++WYFKNSL+F++  H CW    N
Sbjct: 603 VHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKE--N 660

Query: 663 ENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           E++KPRKKFGRVL+CD+DG+NN +EERFEEATDFILD+FEEWSD E
Sbjct: 661 ESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/707 (71%), Positives = 602/707 (85%), Gaps = 3/707 (0%)

Query: 3   ESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLC 62
           +S  VK+E      + LKR  E     + + +  S +KR  IVP C PK+HY+PLKTGLC
Sbjct: 2   DSVMVKKEVLENPDHDLKRKLEENKEEENSLSTTSKSKRQVIVPVCMPKIHYSPLKTGLC 61

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKI 122
           YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGVD +GDLMLKI
Sbjct: 62  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKI 121

Query: 123 PVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGA 182
           PVR AT EEIL+VHTKEHLEFI  T  M+R++LLKETEKGDSVYFNNDSY SA+L CGGA
Sbjct: 122 PVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETEKGDSVYFNNDSYASARLPCGGA 181

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           IEACKAVVEGRVKN+LAVVRPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR+IM+
Sbjct: 182 IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMI 241

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           LDWD+HHGNGTQK+FY DD+VLY+SLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI W
Sbjct: 242 LDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITW 301

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
           P  GVGD+EY+WAFEQV+MPMGREF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHM
Sbjct: 302 PVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHM 361

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEAVEVIDSVI 421
           LKSLARGNLC VLEGGY+LD+IA+SAL+VAKVLIGEPPDELP  +  PK E +E+ID VI
Sbjct: 362 LKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVI 421

Query: 422 KTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLF 481
           + QSKYW CF+  H N GC+F E   D+ I+KNFPLQ AIRQQQ   L++EF FVTLPL 
Sbjct: 422 RLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQQHYLSDEFNFVTLPLV 481

Query: 482 KKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWA 541
             +LPD+T +C+PNI +++ II+ VHDT  IWA+R+  +GTID S+S+I+D +LD IKW 
Sbjct: 482 SMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKWG 541

Query: 542 SSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSG 601
             R YG+ID+NIP +L E DNYS +IT+QEVL+++WDNY+KYFPS+ ++AF+ IGD++SG
Sbjct: 542 LDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYSG 601

Query: 602 VVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDG 661
           +VHLLGHRDTR+V K+ ++F+  + L+PL+PLVDETL++WYFKNSL+F++  H CW    
Sbjct: 602 IVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKE-- 659

Query: 662 NENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           NE++KPRKKFGRVL+CD+DG+NNI+EERFEEATDFILD+FEEWSD E
Sbjct: 660 NESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE 706

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/705 (72%), Positives = 600/705 (85%), Gaps = 15/705 (2%)

Query: 5   AEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLCYD 64
            E+KQE P E    L+ D  S  +           KRP IVP  + ++HYTPLKTG+CYD
Sbjct: 3   VELKQE-PGESKRKLEDDVASQDV-----------KRPVIVPTRKAQIHYTPLKTGICYD 50

Query: 65  VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPV 124
           VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGV+ IGDLMLKIP+
Sbjct: 51  VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPI 110

Query: 125 REATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIE 184
           R AT EEIL+VH+KEHLEFI KT  M R++LLKETEKGDSVYFNNDSY +++L CGGAIE
Sbjct: 111 RAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIE 170

Query: 185 ACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLD 244
           ACKAVVEGRVKN+LAVVRPPGHHAEPE AGGFCLFSNVAVAA+NILKNYPESVR+I++LD
Sbjct: 171 ACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILD 230

Query: 245 WDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPW 304
           WDVHHGNGTQKAFYDDDRVLYISLHR ELGKYYPGTI G  D++GEGKG+GFNCNI WP 
Sbjct: 231 WDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPV 290

Query: 305 KGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLK 364
            GVGD+EY+WAFEQV+MPMGREF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHMLK
Sbjct: 291 GGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLK 350

Query: 365 SLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEAVEVIDSVIKT 423
           SLARGNLC VLEGGY+LD+IA SAL+VAK+LIGEPPDELP  +++PK EA+E+ID VI  
Sbjct: 351 SLARGNLCVVLEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISL 410

Query: 424 QSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFKK 483
           QSKYWKCF   +GN G   +       ++K+FPLQ AIRQ+Q   L+ +F FVTLPL   
Sbjct: 411 QSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNM 470

Query: 484 ELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASS 543
           E+P D+ ICSPN+++ + I+V VHDTP IWA+R+  TGTIDPSTS++VD+  + IKW   
Sbjct: 471 EVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLE 530

Query: 544 RNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVV 603
           R YG++DINIPQSL EQ+NY+AV+T+QE+L++IWDNYLK+FPSL +VAF+ IGDA +G+V
Sbjct: 531 RKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIV 590

Query: 604 HLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNE 663
           HLLGHRDTRSVVKS VSF+ ++ L+PL+PLV+E+L DWYFKNSLVF    H+CWG+  NE
Sbjct: 591 HLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGD--NE 648

Query: 664 NKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           N+KPRKKFGRVL+CD++G+NNI+EER EE+TDFILD+FEEWSDSE
Sbjct: 649 NRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1098 bits (2841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/707 (71%), Positives = 594/707 (84%), Gaps = 3/707 (0%)

Query: 3   ESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLC 62
           +SA VK E        LK   E       + +  S  KR  IVPAC PKLHYTPL+TGLC
Sbjct: 2   DSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLC 61

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKI 122
           YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGVD +GDLMLKI
Sbjct: 62  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKI 121

Query: 123 PVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGA 182
           PVR AT EEIL+VHTKEHLEFI  T  M+R+QLLKETEKGDSVYFNNDSY SA+L CGGA
Sbjct: 122 PVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGA 181

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           IEACKAVVEGRVKN+LAVVRPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR+IM+
Sbjct: 182 IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMI 241

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           LDWD+HHGNGTQK+FY DD+VLYISLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI W
Sbjct: 242 LDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITW 301

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
           P  GVGD+EY+WAFEQV+MPMGREF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHM
Sbjct: 302 PVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHM 361

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEAVEVIDSVI 421
           LKSLARGNLC VLEGGY+LD+IA SAL+VAKVLIGEPPDELP  +  PK E +E+ID V+
Sbjct: 362 LKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVV 421

Query: 422 KTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLF 481
           + QSKYW CF+  H N GC+F E   D+ I+KNFPLQ AIRQQQ+  L++EF FVTLPL 
Sbjct: 422 RLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLI 481

Query: 482 KKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWA 541
             ELPD+  +C+PN+ ++S ++V VHDT  +WA+R+  +GTID S+S+++D  LD IKW 
Sbjct: 482 NMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWG 541

Query: 542 SSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSG 601
             R YG+ID+NIP +L E DNYS +IT+QEVL+++WDNY+KYFP++ ++A++ IGD++SG
Sbjct: 542 LDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSG 601

Query: 602 VVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDG 661
           +VHLLGHRDTR+V K+ ++F+  + L+PL+PLVDETL +WYFKNSLVF +  H CW    
Sbjct: 602 IVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKE-- 659

Query: 662 NENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           NE++KPRKKFGRVL+CD+DG++N +EERFEEATDFILD+FEEWSD E
Sbjct: 660 NESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/709 (72%), Positives = 591/709 (83%), Gaps = 17/709 (2%)

Query: 1   MTESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTG 60
           MTE + VK+E P  Q     +  ES+T           +KR  IV  C PKL YTPLKTG
Sbjct: 1   MTEPS-VKRENPDSQ-----KPAESSTH----------SKRQMIVAPCAPKLRYTPLKTG 44

Query: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLML 120
           LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP LSG+D IGDLML
Sbjct: 45  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLML 104

Query: 121 KIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCG 180
           KIPVREAT +E+L+VH+KEHLEFI   T M+ D+LLK TE GDSVYFNNDS  SAKLSCG
Sbjct: 105 KIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCG 164

Query: 181 GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240
           GAIEACKAVVEGRVKNA AVVRPPGHH+EPE AGGFCLFSNVAVA++NIL+NYPESVR+I
Sbjct: 165 GAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRI 224

Query: 241 MVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNI 300
           M+LDWD+HHGNGTQKAFYDDDRVLYISLHR ELGKYYPGT  G+ D+ GEGKGEGFNCNI
Sbjct: 225 MILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNI 284

Query: 301 PWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360
            WP  GVGD+EY+WAFEQV+MPM REFRPDLVIIS+GFDAADGDT+GQCHV+PSCYGHMT
Sbjct: 285 TWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMT 344

Query: 361 HMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDE-LPVVKQPKLEAVEVIDS 419
           HMLKSLA GNLC VLEGGY+LD+IA+SAL+VAKVLIGEPP+E L  VK PK EA+E+I+ 
Sbjct: 345 HMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINK 404

Query: 420 VIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLP 479
           VI+ QSKYWKCF+  HGN GC+F++  T++    NFPLQ+AIRQQQ   L+ EF FV  P
Sbjct: 405 VIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFP 464

Query: 480 LFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIK 539
           LF+ +L DDT ICSP +Y+   II+ V DTP IWA+R    GTIDPS SII D  L  IK
Sbjct: 465 LFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIK 524

Query: 540 WASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAH 599
           WA  RNYGVID+NIPQSL EQDNYSA+ITAQEV+  +WDNY+++F S +++AFV +GDA 
Sbjct: 525 WAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDAC 584

Query: 600 SGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGN 659
           SG+VHLLGHRDTRS VKS ++F+ Q+ L+PLIPLVDETL DWYFKNSLVF+   H CWG+
Sbjct: 585 SGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGD 644

Query: 660 DGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           + NENKKPRKKFGRVL+C+SDG+ NI+EERFEEATDF+LD+FEEWS+S+
Sbjct: 645 NENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1084 bits (2804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/702 (70%), Positives = 593/702 (84%), Gaps = 8/702 (1%)

Query: 10  EEPSEQ--INGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLCYDVRM 67
           EEP E+  I  +K +  + TL     +Q     RP IVP  +PK+ Y+ LKTG+CYDVRM
Sbjct: 8   EEPLERPSIKEIKNEGTAYTLPSKDESQ-----RPVIVPPTKPKIRYSLLKTGICYDVRM 62

Query: 68  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREA 127
           RYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG DSIGDLM+K+PVREA
Sbjct: 63  RYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREA 122

Query: 128 TDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACK 187
            +EEILQVH+++HL+FIS+T  + R+ LLKETE GDSVYFNNDSYLSAKLSCGGAIEACK
Sbjct: 123 EEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACK 182

Query: 188 AVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDV 247
           AVVEGRVKN++AVVRPPGHHAEPE+AGGFCLFSNVAVAA N+LK+YPESVRKIM++DWD+
Sbjct: 183 AVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDI 242

Query: 248 HHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGV 307
           HHGNGTQKAFYDDDRVLY+SLHR++LGKYYPGTIHGN D+ GEGKGEGFNCNI WP  GV
Sbjct: 243 HHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGV 302

Query: 308 GDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLA 367
           GD+EY+WAFEQVIMPMGREF PDLV+ISSGFDAADGDT+GQCHVTP+CYGHMTHML SLA
Sbjct: 303 GDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLA 362

Query: 368 RGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPV-VKQPKLEAVEVIDSVIKTQSK 426
           +GNLC VLEGGY+LDSIAKSAL V KVL+GEPPDELP   KQP  EA ++I++VI+TQSK
Sbjct: 363 KGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSK 422

Query: 427 YWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFKKELP 486
           YW CFK+ HGNDG +FK+  T T   +NFPLQNAIR+ Q+  L+++F FV LP+    LP
Sbjct: 423 YWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLNLP 482

Query: 487 DDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSRNY 546
            +T +C+  I D+  ++V VHDTP IW++R   TG IDPS+SIIVD  L +I WA  R Y
Sbjct: 483 ANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRRY 542

Query: 547 GVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVHLL 606
           G+IDINIPQ+L E  NY  V ++QE+L+++WDNYLK+F +L +VAF+ IGDA+ G+VHLL
Sbjct: 543 GIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLL 602

Query: 607 GHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNENKK 666
           GHRDTRSVVK A+SF+D++PL+ ++PL+DETL DWYFKNSLVF S+ H+CWG+  NENKK
Sbjct: 603 GHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKK 662

Query: 667 PRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
            RKK+GRVLK D DG+ NI +ERFEEATDFILD+FEEWS+SE
Sbjct: 663 LRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1052 bits (2720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/676 (71%), Positives = 572/676 (84%), Gaps = 7/676 (1%)

Query: 38  VAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 97
           V KR  IVP  +P++HY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI
Sbjct: 29  VPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 88

Query: 98  LAENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLK 157
           LAENGLI+D  LSGVD IGD+MLKIPVREAT +EIL+VH++EHLEF+  TT+M R+ LLK
Sbjct: 89  LAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLK 148

Query: 158 ETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFC 217
           ETEKGDSVYFNNDSY+SAKLSCGGAIEACKAVVEG+VKNALAVVRPPGHH+EPE +GGFC
Sbjct: 149 ETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFC 208

Query: 218 LFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYY 277
           LFSNVAVAA+NILKNYPESVRKIM+LDWD+HHGNGTQKAFY D+RVLY+SLHR E GKYY
Sbjct: 209 LFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYY 268

Query: 278 PGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSG 337
           PGT+ G  D+ GEGKGEGFNCNI WP  GVGD+EY+WAFEQ++MPMGREF+PDLVIISSG
Sbjct: 269 PGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSG 328

Query: 338 FDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIG 397
           FDAADGD +GQCHVTPSCYGHMTHMLKSLARGNL  VLEGGY+LDSIA SAL+VAK LIG
Sbjct: 329 FDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIG 388

Query: 398 EPPDELP-VVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFP 456
           EPPDELP  +K PK EA+E+I  VIK QSKYWKCFK  HGN   +F E A+DT   K FP
Sbjct: 389 EPPDELPDPLKDPKPEALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFP 448

Query: 457 LQNAIRQQQMRLLANEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQR 516
           LQ AIRQQQ   L  E+ FV  P    +LPDD  +CSPNI+ A  +I+ VHDTP IW ++
Sbjct: 449 LQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEK 508

Query: 517 SRATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSL----HEQDNYSAVITAQEV 572
              + T+DP +SII+D+TLD +KWA +R YG+ID+NIPQSL       DNYS++I AQE+
Sbjct: 509 DIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEI 568

Query: 573 LVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIP 632
           L+ +WDN++K+   +N++AF+ +GD+ SGVVHLLGHRDT+  VK+ ++F+  + L+PL+P
Sbjct: 569 LLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVP 628

Query: 633 LVDETLADWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEE 692
           LVDE+L+DWYFKNSLVF++  H CWG+   ENKKPRKK+GRVL+CD+DG+N+ +EERF+E
Sbjct: 629 LVDESLSDWYFKNSLVFSNRTHPCWGD--KENKKPRKKYGRVLRCDTDGLNSTIEERFDE 686

Query: 693 ATDFILDTFEEWSDSE 708
           ATDFILD+FEEWSDSE
Sbjct: 687 ATDFILDSFEEWSDSE 702

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/656 (69%), Positives = 557/656 (84%), Gaps = 3/656 (0%)

Query: 52  LHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSG 111
           L YTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64

Query: 112 VDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDS 171
           +D IGDLM KIPVREAT EEIL+VH KE LE++ KT  + RD+LL +TE GDSVYFNNDS
Sbjct: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124

Query: 172 YLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILK 231
           Y SAKLSCGGAIEACKA+V+G+VKN+LA+VRPPGHH+EPEVAGGFCLFSNVAVA +NILK
Sbjct: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184

Query: 232 NYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEG 291
           NYP+ V+K+M++DWD+HHGNGTQKAFY+DDRVLY+SLHR ELGKYYPGTIHG  D+VGEG
Sbjct: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244

Query: 292 KGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHV 351
           KGEGFNCNIPW   G+GD+EY+WAFEQ++MPMGREFRPDLVI+SSGFDAADGDT+G+CHV
Sbjct: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304

Query: 352 TPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVV-KQPK 410
           TPSCYGHMTHMLKSLA G LC VLEGGY+LD+IA+SALAVAKVLIGEPPDELP   K PK
Sbjct: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364

Query: 411 LEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLA 470
            EA+E+ID VI  +SKYWKCFK    N  C +K   +++   K FP+Q+AIR QQ++ L 
Sbjct: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424

Query: 471 NEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSII 530
           N++  V LPL    LP+DT +CS +I  ++  I+ VHDTP IW++R    G ID S S+ 
Sbjct: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484

Query: 531 VDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRV 590
           +D +L    WA  R YG+ID+NIPQ+L+EQDNYSA +TAQEVL+ +WDN LKYFP++N++
Sbjct: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544

Query: 591 AFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFA 650
           A++ +G+A+SG+VHLLGHRDTRSVVKS + FV ++PL+ L+PLV+E+LADWYFK SL+FA
Sbjct: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604

Query: 651 SAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSD 706
              H+CWG   N++KKPRK++GRVL+CDSDGI +++EERFEEATDFI+D+ +EW++
Sbjct: 605 DKNHSCWGE--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/702 (66%), Positives = 564/702 (80%), Gaps = 10/702 (1%)

Query: 13  SEQING---LKRDHE--SATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLCYDVRM 67
           SEQI     LK + E  S ++ D       + KRP IVP  +P LHYTPLKTG+CYDVRM
Sbjct: 2   SEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRM 61

Query: 68  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREA 127
           RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DP+L+GV  IGDLMLKIPVREA
Sbjct: 62  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREA 121

Query: 128 TDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACK 187
           T EEIL VHT+EH++F+  T  MTR++LL +TEKGDSVY NNDSY+SA+LSCGGAIEACK
Sbjct: 122 TKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACK 181

Query: 188 AVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDV 247
           AVVEGRVKNALA+VRPPGHHAEP+ AGGFCLFSNV+VAA++ILK YPESVRKI+++DWD+
Sbjct: 182 AVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDI 241

Query: 248 HHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGV 307
           HHGNGTQKAFY+DD VLYISLHR ELGK+YPG   GN D+VG+GKG+GFNCNI WP KGV
Sbjct: 242 HHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGV 301

Query: 308 GDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLA 367
           GD EY+WAFEQ+++PM REFRPDLVI+SSGFDAA GDT+GQCHVTP+CYG+MTHMLKSLA
Sbjct: 302 GDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLA 361

Query: 368 RGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVV-KQPKLEAVEVIDSVIKTQSK 426
           RGNLC VLEGGY+LDSI+ SALAVAK+LIGEPPDE+P   + PK   +E+I+ VI+ QSK
Sbjct: 362 RGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSK 421

Query: 427 YWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFKKELP 486
           YWKCF+   GN G  + E A ++ I K FPLQ+AIR  Q+    ++F  ++L L    LP
Sbjct: 422 YWKCFRRKFGNFGGEY-ENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMISLSLPNLNLP 480

Query: 487 DDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSRNY 546
            ++ ICS N + A ++ V +HDTP +W  R   TG IDPSTSII D++L  I WA  R  
Sbjct: 481 KNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET 540

Query: 547 GVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVHLL 606
            VIDINIP+S  E DNYS+ + +Q+V++ +WDN+ KY  SL ++ F+ IG+A SG+VHLL
Sbjct: 541 AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL 600

Query: 607 GHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNENKK 666
           G RDTR+V K+A++FV    L+P++P +DE+L DWYFKNSLVF    H CW  +   +KK
Sbjct: 601 GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEN---DKK 657

Query: 667 PRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           PRKK+GRVL+CD+DGI+NI+EERFEEATDFILD F+EWSD+E
Sbjct: 658 PRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/471 (74%), Positives = 403/471 (85%), Gaps = 8/471 (1%)

Query: 18  GLKRDHE---SATLNDGTGN----QASVAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYH 70
           GLKR+HE   + T N  T N         K+  IVP   PK+HY PLKTGLCYDVRMRYH
Sbjct: 11  GLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVRMRYH 70

Query: 71  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREATDE 130
           AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGVD+IGDLMLK+P+REAT  
Sbjct: 71  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMN 130

Query: 131 EILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVV 190
           EIL+VH+ EH +++ KT++  R+QLLKETE GDSVYFNNDS+ SAKLSCGGAIEACKAVV
Sbjct: 131 EILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVV 190

Query: 191 EGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHG 250
           EGRVKNA+AVVRPPGHH+EPE AGGFCLFSNVAVA +NILKNYPESVRK+++LDWD+HHG
Sbjct: 191 EGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHG 250

Query: 251 NGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDS 310
           NGTQKAFY+DD VLYISLHR ELGKYYPGTI G  D+ GEGKGEGFNCNI WP   VGD+
Sbjct: 251 NGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDA 310

Query: 311 EYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGN 370
           EY+WAFEQV+MPM REF+PDLVIISSGFDAADGDT+GQCHV+PSCYGHMTHMLKSLARGN
Sbjct: 311 EYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGN 370

Query: 371 LCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEAVEVIDSVIKTQSKYWK 429
           LC VLEGGY+LD+IA+SAL+V+K+LIGEPPDELP  +K PK E +E+ID +I+ QSKYWK
Sbjct: 371 LCVVLEGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPKPEVIEMIDKIIRLQSKYWK 430

Query: 430 CFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPL 480
           CF+  HGN GC+FKE   D+ I+KNFPLQ AIR  Q + L +E  F+TLP+
Sbjct: 431 CFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPI 481

 Score =  317 bits (813), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 180/224 (80%), Gaps = 2/224 (0%)

Query: 485 LPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSR 544
           L ++T +CSP I  +  ++V VHD+P +W +R  +TG +D S++II+D+TLD IKW+  R
Sbjct: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633

Query: 545 NYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVH 604
           NYGVIDINIPQ+L EQDNYS+++ AQE L+  WDNYLKYFP + ++ F+  GDAH+G+VH
Sbjct: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693

Query: 605 LLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNEN 664
           LLGHRDTRSVVKS ++F+ ++PL+ L+PLVDETL+DWYFKNSLVF    H  W +  NEN
Sbjct: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWAD--NEN 751

Query: 665 KKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708
           KKPRKKFGRVL+   DGI N++EERF+EATDFILD+FEEWSD E
Sbjct: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  516 bits (1330), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 233/298 (78%), Positives = 266/298 (89%)

Query: 40  KRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99
           KR  IVP  +PKLHYTPLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111

Query: 100 ENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKET 159
           ENGLI D  LSG+D IGD+MLKIPVR AT+EEIL VHT+EHL+FI    S +R++L+K T
Sbjct: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171

Query: 160 EKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 219
           EK DSVY+NNDSY SAKLSCGG IEAC+AVVEGRVKN+LA+VRPPGHHAEP+ AGGFCLF
Sbjct: 172 EKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231

Query: 220 SNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPG 279
           SNV+VAA++IL+ YPESVRKI++LDWD+HHGNGTQKAFY+D+ VLYISLHR+E   +YPG
Sbjct: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291

Query: 280 TIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSG 337
           TIHG  D+VGEGKGEGFNCNI WP  GVGD+EY+WAFE V+MP+GREFRPDLVI+SSG
Sbjct: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  257 bits (657), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 117/251 (46%), Positives = 167/251 (66%), Gaps = 17/251 (6%)

Query: 473 FRFVTLPLFKKELPD---------------DTAICSPNIYDASAIIVCVHDTPSIWAQRS 517
           F  V +PL ++  PD                  + S  I+ A  +++ VHDTP +W  R 
Sbjct: 328 FEHVVMPLGREFRPDLVIVSSGXXXMKPHEKLVLASQKIFKAETLVILVHDTPELWGDRD 387

Query: 518 RATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIW 577
             TG +DPSTS+++DT++  IKWA+ RNY ++DINIP+S  E++ +S+   A E+++ +W
Sbjct: 388 IITGVLDPSTSVLIDTSMKFIKWAADRNYSILDINIPKSNLEKETFSSSKAANEIMLSLW 447

Query: 578 DNYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDET 637
           DN+L+Y  +L ++ F+ IG+++ G+VHL+G RD R + K+ ++FV   PL+ L    DET
Sbjct: 448 DNHLQYISTLTKICFIGIGESYQGIVHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDET 507

Query: 638 LADWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFI 697
           + DWYFKNSLVF +  H CW    +E K+PRKKFGRVLK DSDGI +I+ ERF+EATDFI
Sbjct: 508 MVDWYFKNSLVFTNDSHNCWKE--SEEKRPRKKFGRVLKSDSDGIISIINERFDEATDFI 565

Query: 698 LDTFEEWSDSE 708
           LD FEEWSD E
Sbjct: 566 LDAFEEWSDEE 576

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 104/382 (27%), Positives = 185/382 (48%), Gaps = 37/382 (9%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIG 116
            + G  Y  R+ YH     S + Y   HP  P R      +++  GL             
Sbjct: 19  FEFGSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGL------------H 66

Query: 117 DLMLKIPVREATDEEILQVHTKEHLEFISKTT-----SMTRDQLLKETEKGDSVYFNNDS 171
           ++M     REAT EE+LQ H+++++EF+SK +      M R    K     D   F N  
Sbjct: 67  NIMDLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQN-I 125

Query: 172 YLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNIL 230
           Y   KL  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L
Sbjct: 126 YEYCKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLL 183

Query: 231 KNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGE 290
           + +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  GN D +G 
Sbjct: 184 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGC 236

Query: 291 GKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCH 350
            +G+ F  N+P    G+ D  Y+  F+ V+ P+   F+P  +I   G D+   D +G  +
Sbjct: 237 AEGKHFAMNVPLN-DGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFN 295

Query: 351 VTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLIGEPPDELPV 405
           +    +G     ++S     +  V  GGY+  ++++     + +    +L  E P+++P 
Sbjct: 296 LNIKAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSRLYAYETGILNNVLLQSELPEDMPF 354

Query: 406 VKQ--PKLEAVEVIDSVIKTQS 425
             Q  P      V+D + +  +
Sbjct: 355 RNQFGPDYSLYPVLDDLYENMN 376

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  142 bits (358), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 105/367 (28%), Positives = 182/367 (49%), Gaps = 38/367 (10%)

Query: 49  RPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPT 108
           +P+  Y   + G  Y  R+ YH     S + Y   HP  P R+     +++  GL     
Sbjct: 15  QPQFEY---EFGSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGL----- 66

Query: 109 LSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTT-----SMTRDQLLKETEKGD 163
                 I DL      REAT EE+ Q H+++++EF+SK T      M R  L K     D
Sbjct: 67  ----HKIMDLY---ETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDD 119

Query: 164 SVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNV 222
              F N  Y  + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++
Sbjct: 120 CPIFQN-IYDYSTLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDI 176

Query: 223 AVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIH 282
            ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  IS H+   G+++PGT  
Sbjct: 177 VLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT-- 229

Query: 283 GNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAAD 342
           G+ D +G  KG+ F  N+P    G+ D  Y+  F+ +I P+   ++P ++I   G D+  
Sbjct: 230 GDFDEIGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLG 288

Query: 343 GDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLIG 397
            D +G  ++    +G     +KS     +  V  GGY+  ++++     + +    +L  
Sbjct: 289 HDRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPS 347

Query: 398 EPPDELP 404
           E P+E+P
Sbjct: 348 EIPEEIP 354

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  141 bits (355), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/366 (27%), Positives = 183/366 (50%), Gaps = 33/366 (9%)

Query: 49  RPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPT 108
           + K  Y P + G  Y   + YH     S + Y   HP  P R+     +++  GL     
Sbjct: 9   KTKETYLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGL----- 63

Query: 109 LSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDS 164
                 I DL      REAT +E+L+ H+ +++EF+SK +  T  ++    L++   GD 
Sbjct: 64  ----HKIMDLY---ETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDD 116

Query: 165 VYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVA 223
                  +  + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ 
Sbjct: 117 CPIFQGIFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIV 174

Query: 224 VAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHG 283
           +A  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G
Sbjct: 175 LAILNLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--G 227

Query: 284 NSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADG 343
           + D +G  +G+ F  N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   
Sbjct: 228 DFDEIGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGH 286

Query: 344 DTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLIGE 398
           D +G  ++    +G     +KS     L  V  GGY+  ++++     + L    +L  E
Sbjct: 287 DRLGCFNLNIRAHGECVKFVKSFGIPML-VVGGGGYTPRNVSRLWTYETGLLNDVLLPQE 345

Query: 399 PPDELP 404
            P+ +P
Sbjct: 346 IPENIP 351

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  141 bits (356), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 174/336 (51%), Gaps = 28/336 (8%)

Query: 56  PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSI 115
           P + G  Y  ++ YH     S + Y   HP  P      ++++  + L+   +  G+  I
Sbjct: 53  PFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKP------FRLMLTDHLV---SCYGLHKI 103

Query: 116 GDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFNNDS 171
            DL      REAT EE+L+ H  +++EF+S  T    ++L    L++   GD        
Sbjct: 104 MDLY---ETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQGM 160

Query: 172 YLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNIL 230
           +  + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  ++L
Sbjct: 161 FDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISLL 218

Query: 231 KNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGE 290
           + +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+ D +G 
Sbjct: 219 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGC 271

Query: 291 GKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCH 350
            KG+ F+ N+P    G+ D  Y+  F+ +I P+   ++P ++I   G D+   D +G  +
Sbjct: 272 SKGKKFSLNVPL-QDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFN 330

Query: 351 VTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK 386
           +    +G     +KS     LC V  GGY+  ++++
Sbjct: 331 LNIKAHGECVKFVKSFGIPILC-VGGGGYTPRNVSR 365

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  140 bits (354), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 100/357 (28%), Positives = 178/357 (49%), Gaps = 35/357 (9%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLM 119
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL           + DL 
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGL---------HKVMDLY 74

Query: 120 LKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFNNDSYLSA 175
                R AT +E+ + H+++++ F++K T  T ++L    L++   GD        +  A
Sbjct: 75  ---ETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 176 KLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYP 234
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 132 ALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 235 ESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGE 294
               +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+ D +G  +G+
Sbjct: 190 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 242

Query: 295 GFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPS 354
            F  N+P    G+ D  Y+  F+ +I P+   FRP ++I   G D+   D +G  ++   
Sbjct: 243 HFALNVPL-QDGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNIK 301

Query: 355 CYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKL 411
            +G     +KS     L  V  GGY+  ++++       +L G       V+ QPKL
Sbjct: 302 AHGECVRFVKSFGVPML-VVGGGGYTPRNVSRLWTYETGLLNG-------VLLQPKL 350

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  139 bits (350), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 104/361 (28%), Positives = 179/361 (49%), Gaps = 39/361 (10%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLS--GVDS 114
            + G  Y  R+ YH     S + Y   HP  P R+           L+ D  +S  G+  
Sbjct: 18  FEFGSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRL-----------LLTDHLVSSYGLHK 66

Query: 115 IGDLMLKIPVREATDEEILQVHTKEHLEFISKTT-----SMTRDQLLKETEKGDSVYFNN 169
           I DL      R AT EEI + HT+++++F+ K T      M R  L K     D   F N
Sbjct: 67  IMDLY---ETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQN 123

Query: 170 DSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQN 228
             +   KL  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N
Sbjct: 124 -LFNYCKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILN 180

Query: 229 ILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRV 288
           +L+ +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  GN D V
Sbjct: 181 LLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEV 233

Query: 289 GEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQ 348
           G   G+ F  N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G 
Sbjct: 234 GCANGKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGC 292

Query: 349 CHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLIGEPPDEL 403
            ++T   +G     ++S     L  V  GGY+  ++++     + +    +L  E P+E+
Sbjct: 293 FNLTIKGHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWAYETGVLNNVLLSKELPEEI 351

Query: 404 P 404
           P
Sbjct: 352 P 352

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  139 bits (350), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 102/356 (28%), Positives = 179/356 (50%), Gaps = 35/356 (9%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLM 119
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL           I DL 
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGL---------HKIMDLY 73

Query: 120 LKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKET-EK----GDSVYFNNDSYLS 174
                REAT EE+ Q H+ ++L+F+ K +  T +++ + T EK     D   F N  Y  
Sbjct: 74  ---ETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFEN-IYDY 129

Query: 175 AKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNY 233
           + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 234 PESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKG 293
           P    +++ +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  GN D +G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 294 EGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTP 353
           + F  N+P    G+ D  Y+  F+ +I P+   ++P ++I   G D+   D +G  ++  
Sbjct: 241 KHFAMNVPLN-DGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 354 SCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLIGEPPDELP 404
             +G     + S     +  V  GGY+  ++++     + +    +L  E P+ELP
Sbjct: 300 KAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELP 354

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/335 (27%), Positives = 169/335 (50%), Gaps = 28/335 (8%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIG 116
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL           + 
Sbjct: 18  FEFGASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGL---------HKVM 68

Query: 117 DLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFNNDSY 172
           DL      R AT EE+L  H +++++F+S       ++L    L++   GD        +
Sbjct: 69  DLY---ETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLF 125

Query: 173 LSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILK 231
             + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+
Sbjct: 126 EYSMLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLR 183

Query: 232 NYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEG 291
            +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+ D +G  
Sbjct: 184 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCS 236

Query: 292 KGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHV 351
           +G+ F+ N+P    G+ D  Y+  F+ +I P+   ++P ++I   G D+   D +G  ++
Sbjct: 237 RGKHFSLNVPLN-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNL 295

Query: 352 TPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK 386
               +G     +KS     LC V  GGY+  ++++
Sbjct: 296 NIRAHGECVKFVKSFGIPMLC-VGGGGYTPRNVSR 329

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  137 bits (346), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/368 (26%), Positives = 180/368 (48%), Gaps = 38/368 (10%)

Query: 47  ACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDD 106
           + +P+  +     G  Y+  + YH     S F Y   HP  P R+     +++  GL   
Sbjct: 13  SLKPRFEF-----GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGL--- 64

Query: 107 PTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKG 162
                   I DL      R AT EE+ + H  +++EF++K +     +L    L++   G
Sbjct: 65  ------HKIMDLY---ETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIG 115

Query: 163 DSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSN 221
           D        Y  + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  ++
Sbjct: 116 DDCPIFQGLYQYSTLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVND 173

Query: 222 VAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTI 281
           + ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT 
Sbjct: 174 IVLSVLNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT- 227

Query: 282 HGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAA 341
            GN D  G  +G+ F  N+P    G+ D  Y+  F+ +I P+   F+P ++I   G D+ 
Sbjct: 228 -GNLDETGCSRGKHFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSL 285

Query: 342 DGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLI 396
             D +G  ++    +G     +KS     L  +  GGY+  ++++     +AL     + 
Sbjct: 286 GHDRLGCFNLNVKAHGECVRFVKSFGIPML-VLGGGGYTPRNVSRLWTYETALLNGVSVP 344

Query: 397 GEPPDELP 404
            E P+++P
Sbjct: 345 QEIPEDIP 352

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  137 bits (345), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 105/378 (27%), Positives = 183/378 (48%), Gaps = 46/378 (12%)

Query: 37  SVAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYK 96
           + AK+P    +      YTP         R+ YH     S + Y   HP  P R+     
Sbjct: 11  TAAKQPLFEESFDNSSSYTP---------RVSYHFNPKVSNYHYGVKHPMKPFRLMLTDH 61

Query: 97  ILAENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTT-----SMT 151
           +++  GL           I DL      R AT+EE++Q H++++L+F+SK T      M 
Sbjct: 62  LVSSYGL---------HKIMDLY---ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMP 109

Query: 152 RDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEP 210
           R  L K     D   F N  Y  + L  G +++A + ++    ++ +A+    G HHA+ 
Sbjct: 110 RGTLEKFNIGDDCPIFQN-LYDYSTLYTGASLDATRKLIND--QSDIAINWSGGLHHAKK 166

Query: 211 EVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHR 270
               GFC  +++ ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  IS H+
Sbjct: 167 NNPSGFCYINDIVLSIVNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHK 222

Query: 271 HELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPD 330
              G+++PGT  G+ D  G  KG+ F  N+P    G+ D  Y+  F+ ++ P+   ++P 
Sbjct: 223 FN-GEFFPGT--GDYDETGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPT 278

Query: 331 LVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK---- 386
           +++   G D+   D +G  ++    +G     +KS     +  V  GGY+  ++++    
Sbjct: 279 VIVQQCGADSLGHDRLGCFNLNIKGHGECVKFIKSFGIP-MLVVGGGGYTPRNVSRLWTY 337

Query: 387 SALAVAKVLIGEPPDELP 404
               +  VL+   P+ELP
Sbjct: 338 ETGILNNVLL---PNELP 352

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  137 bits (344), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 100/385 (25%), Positives = 191/385 (49%), Gaps = 36/385 (9%)

Query: 54  YTPL-KTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGV 112
           + PL + G  Y  R+ YH     S++ Y   HP  P R+           ++ D  +SG 
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGY 62

Query: 113 DSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFN 168
             +  +M     R+AT EE+ + H+++++ F+SK T     +L    L++   GD     
Sbjct: 63  -GLHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIF 121

Query: 169 NDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQ 227
            + +  + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  
Sbjct: 122 PNIFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAIL 179

Query: 228 NILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDR 287
           N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  G +D 
Sbjct: 180 NLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDE 232

Query: 288 VGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVG 347
            G   G+ F  N+P    G+ D  Y+  F+ +I P+   F+P +++   G D+   D +G
Sbjct: 233 TGCADGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLG 291

Query: 348 QCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLIGEPPDE 402
             ++    +G     ++S     +  V  GGY+  ++++     + +    +L  E PD 
Sbjct: 292 CFNLNIKAHGECVKFVRSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLLPEELPDN 350

Query: 403 LPVVKQ--PKLEAVEVIDSVIKTQS 425
           LP  +   P      V+D++ + ++
Sbjct: 351 LPFKESFGPDYSLYPVLDNLYENRN 375

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  136 bits (343), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 91/330 (27%), Positives = 166/330 (50%), Gaps = 28/330 (8%)

Query: 62  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLK 121
            Y  R+ YH     S++ Y   HP  P R+     +++  GL           I DL   
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY-- 71

Query: 122 IPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFNNDSYLSAKL 177
              R AT +E+LQ H+++++ F+SK +    ++L    L+    GD      + Y    L
Sbjct: 72  -ETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 178 SCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPES 236
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 237 VRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGF 296
             +I+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+   +G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 297 NCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCY 356
             N+P    G+ D  Y+  F+ ++ P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 357 GHMTHMLKSLARGNLCAVLEGGYSLDSIAK 386
           G     +KS     L  V  GGY+  ++++
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 99/359 (27%), Positives = 175/359 (48%), Gaps = 35/359 (9%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIG 116
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL           I 
Sbjct: 22  FEFGSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIM 72

Query: 117 DLMLKIPVREATDEEILQVHTKEHLEFISKTT-----SMTRDQLLKETEKGDSVYFNNDS 171
           DL      R AT +E+L  H+ +++ F+ K T      M R  L K     D   F N  
Sbjct: 73  DLY---ETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQN-L 128

Query: 172 YLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNIL 230
           Y  + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L
Sbjct: 129 YDYSALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLL 186

Query: 231 KNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGE 290
           + +P    +++ +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  GN D +G 
Sbjct: 187 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGC 239

Query: 291 GKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCH 350
            +G+ F  N+P    G+ D  Y+  F+ +I P+   ++P ++I   G D+   D +G  +
Sbjct: 240 AQGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFN 298

Query: 351 VTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLIGEPPDELP 404
           +    +G     ++S     L  V  GGY+  ++++     + +    +L  E P+++P
Sbjct: 299 LNIKAHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDIP 356

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/369 (26%), Positives = 182/369 (49%), Gaps = 38/369 (10%)

Query: 49  RPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPT 108
           +P+ +Y   + G  Y  R+ YH     S + +   HP  P R+           ++ D  
Sbjct: 15  QPQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHL 60

Query: 109 LSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTT-----SMTRDQLLKETEKGD 163
           +SG   +  +M     R+A+D+E+L+ HT +++ F+ K        M R  L K     D
Sbjct: 61  VSGY-GLHKIMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDD 119

Query: 164 SVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNV 222
              F+N  Y  + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++
Sbjct: 120 CPIFHN-LYEYSSLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDI 176

Query: 223 AVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIH 282
            ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  
Sbjct: 177 VLSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT-- 229

Query: 283 GNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAAD 342
           GN D  G   G+ F  N+P    G+ D  Y+  F+ +I P+   + P ++I   G D+  
Sbjct: 230 GNYDETGCSNGKHFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLG 288

Query: 343 GDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLIG 397
            D +G  ++    +G     +KS     L  V  GGY+  ++++     + +    +L  
Sbjct: 289 HDRLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGYTPKNVSRLWTYETGILNNVLLSP 347

Query: 398 EPPDELPVV 406
           E P ++P +
Sbjct: 348 ELPSDIPFL 356

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/330 (27%), Positives = 166/330 (50%), Gaps = 28/330 (8%)

Query: 62  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLK 121
            Y  R+ YH     S++ Y   HP  P R+     +++  GL           I DL   
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY-- 71

Query: 122 IPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFNNDSYLSAKL 177
              R AT +E+LQ H+++++ F+SK +    ++L    L+    GD      + Y    L
Sbjct: 72  -ETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 178 SCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPES 236
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 237 VRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGF 296
             +I+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+   +G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 297 NCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCY 356
             N+P    G+ D  Y+  F+ ++ P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 357 GHMTHMLKSLARGNLCAVLEGGYSLDSIAK 386
           G     +KS     L  V  GGY+  ++++
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/358 (26%), Positives = 177/358 (49%), Gaps = 33/358 (9%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIG 116
            + G  +   + YH     S F Y   HP  P R+     +++  GL           I 
Sbjct: 18  FEFGASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIM 68

Query: 117 DLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFNNDSY 172
           DL      R AT EE+ + H+++++EF+++ +     +L    L++   GD        Y
Sbjct: 69  DLY---ETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLY 125

Query: 173 LSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILK 231
             + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+
Sbjct: 126 QYSTLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLR 183

Query: 232 NYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEG 291
            +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  GN D +G  
Sbjct: 184 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCS 236

Query: 292 KGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHV 351
           +G+ F  N+P    G+ D  Y+  F+ +I P+   F+P ++I   G D+   D +G  ++
Sbjct: 237 RGKHFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNL 295

Query: 352 TPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLIGEPPDELP 404
               +G     +KS     L  V  GGY+  ++++     + L    +L  E P+ +P
Sbjct: 296 NVKAHGECVKYVKSFGLPML-VVGGGGYTPRNVSRLWAYETGLLNGVLLPEEIPEGIP 352

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 158/325 (48%), Gaps = 26/325 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    D   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    +++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+P 
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVPL 238

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
              G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 -RDGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNF 297

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKS 387
           +KS     L  V  GGY++ ++A++
Sbjct: 298 VKSFGI-PLMVVGGGGYTMRNVART 321

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  135 bits (339), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 90/329 (27%), Positives = 166/329 (50%), Gaps = 28/329 (8%)

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKI 122
           Y  R+ YH     S++ Y   HP  P R+     +++  GL           I DL    
Sbjct: 24  YSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY--- 71

Query: 123 PVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFNNDSYLSAKLS 178
             R AT +E+L+ H+++++ F+SK +    ++L    L+    GD      + Y    L 
Sbjct: 72  ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 179 CGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESV 237
            G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 238 RKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFN 297
            +I+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+   +G  KG+ F 
Sbjct: 187 -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 298 CNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYG 357
            N+P    G+ D  Y+  F+ ++ P+   F+P L++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 358 HMTHMLKSLARGNLCAVLEGGYSLDSIAK 386
                +KS     L  V  GGY+  ++++
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  134 bits (337), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    D   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 VLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 302 WPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 362 MLKSLARGNLCAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  133 bits (335), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 160/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL  +            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    D   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 242 VLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 302 WPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 362 MLKSLARGNLCAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  133 bits (334), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 160/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    D   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 VLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 302 WPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 362 MLKSLARGNLCAVLEGGYSLDSIAKS 387
            +KS     L  V  GGY++ ++A++
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/325 (27%), Positives = 159/325 (48%), Gaps = 26/325 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    D   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    +++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ ++ N+P 
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
              G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 -RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKS 387
           +KS     +  V  GGY++ ++A++
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/325 (27%), Positives = 159/325 (48%), Gaps = 26/325 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    D   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    +++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ ++ N+P 
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
              G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 -RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKS 387
           +KS     +  V  GGY++ ++A++
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  132 bits (333), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 95/340 (27%), Positives = 164/340 (48%), Gaps = 26/340 (7%)

Query: 51  KLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLS 110
           +L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL       
Sbjct: 5   QLPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 111 GVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYF 167
                   M     + AT +E+ Q HT E+++F+S+ T    +   KE+ K   GD    
Sbjct: 61  --------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 168 NNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQ 227
            +  Y    +S GG++E    +  G+   A+       HHA+   A GFC  +++ +   
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGII 171

Query: 228 NILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDR 287
            +L+ +P    +++ +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    
Sbjct: 172 ELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRD 223

Query: 288 VGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVG 347
            G GKG+ +  N+P    G+ DS Y   FE VI  +   ++P  V++  G D+  GD +G
Sbjct: 224 TGVGKGKYYAVNVPL-RDGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLG 282

Query: 348 QCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKS 387
             +++   + +  + +KS     L  V  GGY++ ++A++
Sbjct: 283 CFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVART 321

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  133 bits (334), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 88/329 (26%), Positives = 164/329 (49%), Gaps = 28/329 (8%)

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKI 122
           Y  R+ YH     S++ Y   HP  P R+     +++  GL           I DL    
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGL---------HKIMDLY--- 71

Query: 123 PVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFNNDSYLSAKLS 178
             R AT +E+ + HT++++ F+SK +    ++L    L+    GD      + Y    L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 179 CGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESV 237
            G  ++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 238 RKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFN 297
            +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+   +G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 298 CNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYG 357
            N+P    G+ D  Y+  F+ ++ P+   F+P +++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 358 HMTHMLKSLARGNLCAVLEGGYSLDSIAK 386
                +KS     L  V  GGY+  ++++
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGYTPKNVSR 329

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 163/326 (50%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    +   +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIM 241
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 VLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    VG GKG+ ++ N+P
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 302 WPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ D+ Y   FE V+  +   ++P  V++ +G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNLCAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/335 (27%), Positives = 169/335 (50%), Gaps = 28/335 (8%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIG 116
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL           I 
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGL---------HKIM 67

Query: 117 DLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFNNDSY 172
           DL      R AT EE+   H++E+++F+ + T    ++L    L++   GD      + Y
Sbjct: 68  DLY---ETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 173 LSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILK 231
             + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+
Sbjct: 125 DYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLR 182

Query: 232 NYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEG 291
            +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  GN D VG  
Sbjct: 183 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCA 235

Query: 292 KGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHV 351
           +G+ F  N+P    G+ D  Y+  F+ +I P+   ++P +++   G D+   D +G  ++
Sbjct: 236 RGKHFALNVPL-QDGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFNL 294

Query: 352 TPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK 386
               +G   + ++S     L  V  GGY+  ++++
Sbjct: 295 NVKAHGECVNFVRSFGLPML-VVGGGGYTPRNVSR 328

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 167/335 (49%), Gaps = 28/335 (8%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIG 116
            + G    +R+ YH     S++ Y   HP  P R+           ++ D  +SG   + 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGY-GMH 66

Query: 117 DLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQL----LKETEKGDSVYFNNDSY 172
            +M     R AT++E+ + HT++++ F+ K +     +L    L++   GD      + Y
Sbjct: 67  KVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 173 LSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILK 231
             A L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+
Sbjct: 127 DYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 232 NYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEG 291
            +P    +++ +D D+HHG+G Q+AFY  DRV  IS H++  G ++PGT  G+ D  G  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCD 237

Query: 292 KGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHV 351
            GE F  N+P    G+ D  Y+  F+ VI P+   + P ++I   G D+   D +G  ++
Sbjct: 238 AGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNL 296

Query: 352 TPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAK 386
               +G     +KS     L  V  GGY+  ++++
Sbjct: 297 NIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 330

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    +   +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIM 241
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 VLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 302 WPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   +G+  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 362 MLKSLARGNLCAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    D   KE+ K   GD     +  +    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 VLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    VG GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 302 WPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNLCAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  131 bits (330), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 89/325 (27%), Positives = 158/325 (48%), Gaps = 26/325 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    D   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    +++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKTEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+P 
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVPL 238

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
              G+ D+ Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 -RDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVNF 297

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKS 387
           +KS     +  V  GGY++ ++A++
Sbjct: 298 VKSFGL-PMMIVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  131 bits (330), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIM 241
           +E+   +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 VLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 302 WPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ D+ Y   FE V+  +   ++P  V++  G D+  GD +G  +++   +    +
Sbjct: 238 L-RDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 362 MLKSLARGNLCAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  131 bits (329), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 VLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 302 WPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNLCAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  131 bits (329), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 89/325 (27%), Positives = 159/325 (48%), Gaps = 26/325 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    +++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    VG GKG+ +  N+P 
Sbjct: 183 IDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVPL 238

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
              G+ D+ Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 -RDGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVNY 297

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKS 387
           +KS     +  V  GGY++ ++A++
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  131 bits (329), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 94/341 (27%), Positives = 167/341 (48%), Gaps = 28/341 (8%)

Query: 51  KLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLS 110
           +L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL       
Sbjct: 5   QLPFDDLKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 111 GVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYF 167
                   M     + AT +E+ Q H+ E+++F+S+ T    +   KE+ K   GD    
Sbjct: 61  --------MEIYRAKPATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 168 NNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAA 226
            +  Y    +S GG++E    +  G+    +A+    G HHA+   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 227 QNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSD 286
             +L+ +P    +++ +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G   
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 287 RVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTV 346
             G GKG+ ++ N+P    G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +
Sbjct: 223 DTGVGKGKYYSVNVPL-RDGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL 281

Query: 347 GQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKS 387
           G  +++   + +  + +KS     L  V  GGY++ ++A++
Sbjct: 282 GCFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  131 bits (329), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 89/325 (27%), Positives = 159/325 (48%), Gaps = 26/325 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    +++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ ++ N+P 
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
              G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 -RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVNY 297

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKS 387
           +KS     +  V  GGY++ ++A++
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  130 bits (327), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 157/314 (50%), Gaps = 28/314 (8%)

Query: 78  FEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHT 137
           + Y   HP  P RI   + ++   GL               M     + AT +E+ Q HT
Sbjct: 32  YAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAKPATKQEMCQFHT 79

Query: 138 KEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRV 194
            E+++F+S+ T    +   +E+ K   GD     +  Y    +S GG++E    +  G+ 
Sbjct: 80  DEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKC 139

Query: 195 KNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGT 253
              +AV    G HHA+   A GFC  +++ +    +L+ +P    +++ +D DVHHG+G 
Sbjct: 140 D--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGV 193

Query: 254 QKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYL 313
           ++AFY  DRV+  S H++  G+++PGT  G    +G G G+ +  N+P    G+ D+ Y 
Sbjct: 194 EEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVPL-RDGIDDATYR 248

Query: 314 WAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCA 373
             FE VI  +   ++P  V++  G D+  GD +G  +++   + +  + +KS     +  
Sbjct: 249 SVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGI-PMMV 307

Query: 374 VLEGGYSLDSIAKS 387
           V  GGY++ ++A++
Sbjct: 308 VGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  130 bits (327), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 89/325 (27%), Positives = 158/325 (48%), Gaps = 26/325 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    +++ 
Sbjct: 129 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRFHP----RVLY 183

Query: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302
           +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+P 
Sbjct: 184 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVPL 239

Query: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
              G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  + 
Sbjct: 240 -RDGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVNY 298

Query: 363 LKSLARGNLCAVLEGGYSLDSIAKS 387
           +KS     +  V  GGY++ ++A++
Sbjct: 299 VKSFGI-PMMVVGGGGYTMRNVART 322

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 160/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    +   +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIM 241
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 VLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 302 WPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNLCAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  127 bits (319), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 160/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVR 125
           R+ Y        F Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++F+S+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 VLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 302 WPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ D+ +   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNLCAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 99/376 (26%), Positives = 156/376 (41%), Gaps = 83/376 (22%)

Query: 132 ILQVHTKEHLEFISKTTSMTRDQLLK-ETEKGDSVYFNNDSYLSAKL------SCGGAIE 184
           +L+VH ++    + +      ++L K E E  DS + + D YLS+K       S G    
Sbjct: 108 VLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDS-WNSGDIYLSSKTIEALQGSIGALET 166

Query: 185 ACKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRK 239
              ++ EG     V N A  V+RPPGHH       GFCL +N  V+ +     Y   +  
Sbjct: 167 GVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITH 224

Query: 240 IMVLDWDVHHGNGTQ-------------------------KAFYDDDRVLYISLHRHELG 274
            +VLD+D+HHG+GTQ                         K F +  RV Y S+  H++ 
Sbjct: 225 AVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSM--HDIN 282

Query: 275 KYYPGTIHGNSDRVGEGKG---EGFNCNIPW-----PWKGVGDSEYLWA----------- 315
            +   + +   D +         G + NI W      W+   D   L+            
Sbjct: 283 SFPTESGYATKDNIKSASTCIMNGHDLNI-WNVHLSAWETEEDFNKLYQSKYRTLFAKAD 341

Query: 316 --FEQVIMPM---GREFRPDLVIISSGFDAADGDTVGQ----CHVTPSCYGHMTHMLKSL 366
             F+   + M   G++F+  LV+IS+GFDA++ + V       +V  + Y   T     L
Sbjct: 342 EFFKNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKL 400

Query: 367 AR----GNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSVIK 422
           A+    G + +VLEGGYS  +I     A    LIG        +K+   E  +V+  +++
Sbjct: 401 AQMHSEGKVLSVLEGGYSDKAITSGVFA---HLIGLQNQNW--IKEWGSE--QVVKEIVR 453

Query: 423 TQSKYWKCFKSTHGND 438
                WK +KS    D
Sbjct: 454 GCKPNWKPYKSKKTRD 469

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 11/176 (6%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA  + A GFC  ++V +  Q + K     + KI  +D+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGR 325
           IS+H +E G ++PGT   N  R G+        NIP    G  DS       ++I P+ +
Sbjct: 269 ISIHLYEPG-FFPGTGSLNDARKGKSV-----VNIPLK-HGCDDSYLDLVASKIISPLIK 321

Query: 326 EFRPDLVIISSGFDAADGDTVGQCHVTPSCYGH-MTHMLKSLARGNLCAVLEGGYS 380
              PD++II  G D   GD   +  +T       + +++K   R ++  +  GGY+
Sbjct: 322 RHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 102/229 (44%), Gaps = 17/229 (7%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HH+    A GFC  +++ +A Q + +N+      I  +D+D+HHG+G ++AF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFS----NISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGR 325
           ISLH HE G ++PGT    S + G         NIP    G  D   +   E V++P  +
Sbjct: 298 ISLHNHEPG-FFPGTGSMESSQDGHSI-----INIPLR-HGADDDCLMKITESVVIPCIQ 350

Query: 326 EFRPDLVIISSGFDAADGDTVGQCHVT-PSCYGHMTHMLKSLARGNLCAVLEGGYSLDSI 384
           +  P +++I  G D   GD   +  +T       +  +L SL   ++  +  GGY+   +
Sbjct: 351 KHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRVM 410

Query: 385 AKS----ALAVAKVLIGEPPDELPVVKQPKL-EAVEVIDSVIKTQSKYW 428
           ++        V       PP++ P +    L    E +D       K+W
Sbjct: 411 SRFYTYLTWKVCDQFSKSPPEDPPFIDDEDLIPDHEFLDLYTDEHYKFW 459

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 88/176 (50%), Gaps = 11/176 (6%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA    A GFC  +++A+  Q + +     +R+I  +D+D+HH +G ++AF     V  
Sbjct: 221 HHASRSRASGFCYINDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQT 277

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGR 325
           IS+H HE G ++PGT       VG+        NIP    G+ D+      ++VIMP  R
Sbjct: 278 ISVHLHEPG-FFPGTGSLKEASVGKNV-----VNIPVQ-HGMDDTFLNQIVQRVIMPCIR 330

Query: 326 EFRPDLVIISSGFDAADGDTVGQCHVT-PSCYGHMTHMLKSLARGNLCAVLEGGYS 380
              P++++I  G D   GD   +  +T      ++ ++++     N+  +  GGY+
Sbjct: 331 SHNPEVLVIQCGGDGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 89/176 (50%), Gaps = 11/176 (6%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA  + A GFC  ++V +  Q + K     + K+  LD+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGR 325
           IS+H +E G ++PGT   N  + G+        NIP    G  D+       ++I P+ +
Sbjct: 269 ISVHLYEPG-FFPGTGSLNDSQNGKNI-----VNIPLK-HGCDDNYLNLVASKIIHPLIK 321

Query: 326 EFRPDLVIISSGFDAADGDTVGQCHVTPSCYGH-MTHMLKSLARGNLCAVLEGGYS 380
              P+++I+  G D   GD   +  +T       + +++KS  + ++  +  GGY+
Sbjct: 322 RHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 75.9 bits (185), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 76/147 (51%), Gaps = 10/147 (6%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA  + A GFC  +++ +  Q + +   +  +KI  +D+D+HHG+G +KAF     V  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGR 325
           ISLH  E+G ++PGT  GN   + E        NIP    G+ D+      EQ++ P+  
Sbjct: 263 ISLHLFEVG-FFPGT--GN---LSESDKRRNVVNIPL-LHGLDDTSLEQLIEQIVKPVIE 315

Query: 326 EFRPDLVIISSGFDAADGDTVGQCHVT 352
              PD+++I  G D   GD   +  ++
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLS 342

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 128/281 (45%), Gaps = 23/281 (8%)

Query: 150 MTRDQLLKETEKGDSVYFNNDSYLSA--KLSCGGAIEACKAVVEGRVKNALAVVRPPG-H 206
           M R++L     +GD   F   SYL    ++  G  +   K +     +  +AV    G H
Sbjct: 177 MIREKLKGYNLEGDCPIF---SYLPVYCQVIVGATLSLAKHITAVANERTIAVNWDGGRH 233

Query: 207 HAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYI 266
           HA    A GFC  +++ +  Q +  N     ++I  +D+D+HHG+G Q++F     V  I
Sbjct: 234 HALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDFDLHHGDGVQRSFQYSTSVQTI 290

Query: 267 SLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGRE 326
           S H  E G ++P T      ++G+        NIP    GV D       E+V++P  + 
Sbjct: 291 SAHMFEPG-FFPCTGSLKESKMGKNI-----VNIPL-LHGVDDMLMNEIVEKVMIPCVKR 343

Query: 327 FRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVL---EGGYSLDS 383
           + P++++I  G D   GD   +  +T   +G + ++LK L     C V+    GGY+   
Sbjct: 344 YDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNILKLLRIFPGCPVVLLGGGGYNETV 401

Query: 384 IAKSALAVAKVLIGEPPDELPVVK--QPKLEAVEVIDSVIK 422
           +++    +   ++ E  ++  + K  Q K E +   D  IK
Sbjct: 402 MSRFYTYLTWKIVDEYSNKKSLKKPFQAKEERIHDKDRSIK 442

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/335 (22%), Positives = 137/335 (40%), Gaps = 73/335 (21%)

Query: 165 VYFNNDSYLSAKLSCGGAIEACKAVVEGRVKN-----ALAVVRPPGHHAEPEVAGGFCLF 219
           +Y   ++  + + S G       ++ +G V       A   +RPPGHH+      GFCL 
Sbjct: 147 IYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLL 206

Query: 220 SNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ------------------------- 254
           +N  +A +     Y   V   ++LD+D+HHG+GTQ                         
Sbjct: 207 NNAHIAVEYAADTY--GVTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYNEFD 264

Query: 255 KAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKG---EGFNCNIPW-----PWKG 306
           K F +  +V Y S+  H++  +     + + D+V +      +  + NI W     P++ 
Sbjct: 265 KKFAEFPKVGYFSM--HDINSFPTELNYASKDKVKDASTCIMDAHDVNI-WNIHLLPYET 321

Query: 307 VGDSEYLWA-------------FEQVIMPMGREFRP--DLVIISSGFDAADGDTVGQ--- 348
             +   L+              F+   + M ++ +P   LV++S+GFDA++ + V     
Sbjct: 322 EEEFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVSMQRH 381

Query: 349 -CHVTPSCYGHMTHMLKSLAR----GNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDEL 403
             +V  S Y   T     LA+    G + ++LEGGYS  +IA     V   LIG      
Sbjct: 382 GVNVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDAAIAS---GVFSHLIGLQNQNW 438

Query: 404 PVVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGND 438
                 +  + +V+  +++     WK +K+    D
Sbjct: 439 IT----EWGSAQVVKEIVRGCKPRWKPYKTRKAGD 469

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 93/380 (24%), Positives = 146/380 (38%), Gaps = 91/380 (23%)

Query: 132 ILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVV- 190
           +L+VH  +  + I +    + D++ K   +    +   D YL     C G I+A +  + 
Sbjct: 108 VLRVHGNDWPKAILRLCKQSDDRIQKRQLEVPDEWNVGDIYL-----CRGTIDALQGSIG 162

Query: 191 --EGRVKN-------------ALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPE 235
             E  V +             A   +RPPGHH+      GFCL +N  +A +     Y  
Sbjct: 163 ALESGVDSIFDGPSAASTPNRAFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY-- 220

Query: 236 SVRKIMVLDWDVHHGNGTQ-----------------KAFYDD--------DRVLYISLHR 270
            V    +LD+D+HHG+GTQ                  A YDD         +V Y SLH 
Sbjct: 221 GVTHAAILDFDLHHGDGTQDICWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHD 280

Query: 271 HELGKYYPGTIHGNSDR-------------------VGEGKGEGFNCNIPWPWKGV--GD 309
                   G  H  S +                         E FN      ++ +    
Sbjct: 281 INSFPTEQGYAHKTSIKDASVCIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKA 340

Query: 310 SEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQ----CHVTPSCYGHMTHMLKS 365
            E+L   ++ +   G+ ++  L+IIS+GFDA++ + +       HV  S Y   T     
Sbjct: 341 DEFLRVSQKRMASEGKNYK-GLIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALK 399

Query: 366 LA----RGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQ---PKLEAVEVID 418
           LA    +G L ++LEGGYS  ++      V   LIG       +  Q   P+  + +VI 
Sbjct: 400 LAQMHTQGKLLSLLEGGYSDAALVS---GVFSHLIG-------MQNQNWIPEWGSAQVIK 449

Query: 419 SVIKTQSKYWKCFKSTHGND 438
            V +     WK +K+    D
Sbjct: 450 EVCRGCRPNWKAYKTKRSRD 469

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 95/372 (25%), Positives = 152/372 (40%), Gaps = 76/372 (20%)

Query: 132 ILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKL--SCGGAIEACKAV 189
           +L+VH       + +   M   +LLK   +    + + D YLS+K   +  G I A +  
Sbjct: 110 VLKVHGSSWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 190 VEGRVK---------NALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240
           V+   K          A   +RPPGHH       GFCL +N  VA +     Y  +V  +
Sbjct: 170 VDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 241 MVLDWDVHHGNGTQ------------------------KAFYDDDRVLYISLHRHELGKY 276
           +VLD+D+HHG+GTQ                        K F +  +V Y S+  H++  +
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSM--HDINSF 285

Query: 277 YPGTIHGNSDRVGEGKGEGFNCNIPWPW-----KGVGDSEY----------LWA-----F 316
              +     + +        N +    W     K   + E+          L+A     F
Sbjct: 286 PTESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFF 345

Query: 317 EQVIMPMGREFRP--DLVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLAR-- 368
               + M ++ RP   LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+  
Sbjct: 346 RSAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMH 405

Query: 369 --GNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSVIKTQSK 426
             G + +++EGGYS  +I     A    LIG    +   VK+   E  +V+  +++    
Sbjct: 406 CHGKVLSLMEGGYSDKAICSGVFA---HLIGLQNQDW--VKEWGSE--QVVKEIVRGCKP 458

Query: 427 YWKCFKSTHGND 438
            WK +K+    D
Sbjct: 459 AWKPYKTKRAKD 470

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 130/298 (43%), Gaps = 36/298 (12%)

Query: 173 LSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILK 231
           L   +S G  +   + ++EG  +  +A+    G HH+    A GFC  +++A+    + +
Sbjct: 170 LYCYVSTGATLSLAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRR 228

Query: 232 NYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYP--GTIHGNSDRVG 289
                V +I  +D+D+HHG+G +KAF    +V  ISLH +E G ++P  G++  NS    
Sbjct: 229 G---GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCSGSLEDNS---- 280

Query: 290 EGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQC 349
            GK      NIP    G+ DS      +++I+P   + +P++++I  G D   GD   + 
Sbjct: 281 SGKSI---VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEW 336

Query: 350 HVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQP 409
            +  S  G  + +   + + N   VL GG   +++  S                 +  Q 
Sbjct: 337 QL--SIKGLTSTITSLIEQFNCHIVLLGGGGYNNLLMSRFYTYLT--------WSICHQY 386

Query: 410 KLEAVEVIDSVIK----------TQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPL 457
             E    ID +I+           Q K+W   + T G    ++   A    + KN PL
Sbjct: 387 ASEYSTPIDDLIQDHCYSDLYSPEQFKFWYYDQETSGGSLKNYNTTAYIEDLIKNIPL 444

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 93/179 (51%), Gaps = 17/179 (9%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HH+  + A GFC  +++ +  Q + +   +  RKI  LD+D+HHG+G +K+F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLCIQKLGE---KGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFN-CNIPWPWKGVGDSEYLWAFEQVIMPMG 324
           IS+H  E G ++P T       + E K  GFN  NIP    G+ D+   +   +VI+P+ 
Sbjct: 356 ISVHLFEPG-FFPCT-----GSLEETK-HGFNIVNIP-TLHGLDDNYLTYLLNRVIIPLI 407

Query: 325 REFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVL---EGGYS 380
           ++ +P+ +++  G D   GD   +  +T S  G   +++  L     C+V+    GGY+
Sbjct: 408 KKHKPECLVVQCGGDGLIGDRYKEWQMTIS--GLTKNIMLVLQNFPECSVVLLGGGGYN 464

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 81/346 (23%), Positives = 138/346 (39%), Gaps = 78/346 (22%)

Query: 158 ETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGR-----VKNALAVVRPPGHHAEPEV 212
           E+     +Y N+D+ ++ K S G       ++  G         A   +RPPGHH    +
Sbjct: 141 ESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPPGHHCHVGM 200

Query: 213 AGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ------------------ 254
             GFCL +N  +  +     Y   V  ++VLD+D+HHG+GTQ                  
Sbjct: 201 PSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQDICWKRAGFKPDGNYIDE 258

Query: 255 ----------KAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKG---EGFNCNIP 301
                     K   D  +V Y S+  H++  +   + +   + +           + NI 
Sbjct: 259 ADSTGYDDFEKKMADFPKVGYFSM--HDINSFPTESGYATRENIKNASTCIMNSHDLNI- 315

Query: 302 W-----PWKGVGD------SEYLWAFEQV----------IMPMGREFRPDLVIISSGFDA 340
           W      W    D      S+Y   F +           +  MG+ ++  LV+ISSGFDA
Sbjct: 316 WNVHLSKWSTEEDFLKLYRSKYRTLFAKADEFFKAAKLEMASMGKPYK-GLVLISSGFDA 374

Query: 341 ADGDTVG----QCHVTPSCYGHMTHMLKSLAR----GNLCAVLEGGYSLDSIAKSALAVA 392
           ++ + V       +V  + Y   T     LA+    G + +++EGGYS  +I     A  
Sbjct: 375 SEFEQVSMQRHSVNVPTTFYTMFTKDALKLAQMHCHGKVISIMEGGYSDKAITSGVFA-- 432

Query: 393 KVLIGEPPDELPVVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGND 438
             LIG    +   +K+   E  +V+  +++     WK +K+   +D
Sbjct: 433 -HLIGLQNQDW--IKEWGSE--QVVKEIVRGCKPTWKPYKTKRNDD 473

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 89/176 (50%), Gaps = 11/176 (6%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA  + A GFC  ++V +  Q + K     + KI  LD+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGR 325
           IS+H +E G ++PGT  G+ D    GK      NIP    G  DS       ++I P+  
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV---VNIPLK-HGCDDSYLNLIASKIINPLID 319

Query: 326 EFRPDLVIISSGFDAADGDTVGQCHVTPSCYGH-MTHMLKSLARGNLCAVLEGGYS 380
           +  P+++II  G D   GD   +  +T       + + +K  ++ ++  +  GGY+
Sbjct: 320 KHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 112/256 (43%), Gaps = 18/256 (7%)

Query: 181 GAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRK 239
           GA  +    ++   + ++A+    G HHA    A GFC  +++ +  Q I KN     + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 240 IMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCN 299
           I  +D+D+HHG+G QKAF     V  +SLH  E G ++P T       + E K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCT-----GSLQEAKAGSSIVN 299

Query: 300 IPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVT-PSCYGH 358
           IP    G+  +      + +I+P+  +  P++++I  G D   GD   +  +T     G 
Sbjct: 300 IPL-LHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSGA 358

Query: 359 MTHMLKSLARGNLCAVLEGGYSLDSIAKS----ALAVAKVLIGEPPDELPVVKQPKLEAV 414
           +  ++ +    ++  +  GGY+   +++        +A      PP  L +  +  L   
Sbjct: 359 IMKLINTFPSCSVVLLGGGGYNEKVMSRFYNYLTWNIAFEYSKRPPSGLFLSSELNLLIP 418

Query: 415 --EVIDSVIKTQSKYW 428
             E ID     Q KYW
Sbjct: 419 DHEFIDVYQDEQYKYW 434

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 87/176 (49%), Gaps = 11/176 (6%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA  + A GFC  ++V +  Q + K     + KI  +D+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGR 325
           IS+H +E G ++PGT       + + + +    NIP    G  D+       +++ P+  
Sbjct: 267 ISVHLYEPG-FFPGT-----GSLSDSRKDKNVVNIPLK-HGCDDNYLELIASKIVNPLIE 319

Query: 326 EFRPDLVIISSGFDAADGDTVGQCHVTPSCYGH-MTHMLKSLARGNLCAVLEGGYS 380
              P+ +II  G D   GD   +  +T       + +++KS  R ++  +  GGY+
Sbjct: 320 RHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 96/372 (25%), Positives = 152/372 (40%), Gaps = 76/372 (20%)

Query: 132 ILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKL-----SCGGAIE-A 185
           +L+VH       + +   M   +LLK   +    + + D YLS+K         GAIE  
Sbjct: 110 VLKVHGSHWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 186 CKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240
             ++ EG     + N A   +RPPGHH       GFCL +N  VA +     Y  +V  +
Sbjct: 170 VDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 241 MVLDWDVHHGNGTQ------------------------KAFYDDDRVLYISLHRHELGKY 276
           +VLD+D+HHG+GTQ                        K F +  +V Y S+  H++  +
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYDEFDKKFAEFPKVGYFSM--HDINSF 285

Query: 277 YPGTIHGNSDRVGEGKGEGFNCNIPWPW-----KGVGDSEY----------LWA-----F 316
              +     + +        N +    W     K   + E+          L+A     F
Sbjct: 286 PTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFF 345

Query: 317 EQVIMPMGREFRP--DLVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLAR-- 368
                 M +  +P   LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+  
Sbjct: 346 RSAKQEMNQNEKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMH 405

Query: 369 --GNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSVIKTQSK 426
             G + +++EGGYS  +I     A    LIG    +   VK+   E  +V+  +++    
Sbjct: 406 CHGKVLSLMEGGYSDKAICSGVFA---HLIGLQNQDW--VKEWGSE--QVVKEIVRGCKP 458

Query: 427 YWKCFKSTHGND 438
            WK +K+    D
Sbjct: 459 AWKPYKTRRAKD 470

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 93/373 (24%), Positives = 149/373 (39%), Gaps = 78/373 (20%)

Query: 132 ILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKL--SCGGAIEACKAV 189
           +L+VH       + +   M   +LLK   +    + + D YLS+K   +  G I A +  
Sbjct: 110 VLKVHGSHWPTELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIQALQGTIGAIETG 169

Query: 190 VEGRVK---------NALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240
           V+   K          A   +RPPGHH       GFCL +N  VA +     Y   V  +
Sbjct: 170 VDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTHV 227

Query: 241 MVLDWDVHHGNGTQ------------------------KAFYDDDRVLYISLHRHELGKY 276
           +VLD+D+HHG+GTQ                        K F +  +V Y S+  H++  +
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYDNFGKKFAEFPKVGYFSM--HDINSF 285

Query: 277 YPGTIHGNSDRVGEGKG---EGFNCNIPW-----PWKGVGDSEYLWA------------- 315
              +     + +           + NI W      W    D   L+              
Sbjct: 286 PTESGFATKENIKNASTCIMNSHDLNI-WNVHLSKWTTEEDFNILYRTKYRTLFAKADEF 344

Query: 316 FEQVIMPMGREFR--PDLVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLAR- 368
           F+   + M ++ +    LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+ 
Sbjct: 345 FKTAKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQM 404

Query: 369 ---GNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSVIKTQS 425
              G + +++EGGYS  +I     A    LIG    +   VK+   E  +V+  +++   
Sbjct: 405 HCHGKVLSLMEGGYSDKAICSGVFA---HLIGLQNQDW--VKEWGSE--QVVKEIVRGCK 457

Query: 426 KYWKCFKSTHGND 438
             WK +K+    D
Sbjct: 458 STWKPYKTRRAKD 470

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 90/176 (51%), Gaps = 11/176 (6%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA    A GFC  +++ +  Q + K   + + K+  +D+D+HHG+G +KAF     +  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGR 325
           IS+H +E G ++P T  G+ +    GK      N+P  + GV D+       ++I P+  
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGKNI---VNVPL-YHGVDDNYMTEIVNELIKPLIE 332

Query: 326 EFRPDLVIISSGFDAADGDTVGQCHVTPS-CYGHMTHMLKSLARGNLCAVLEGGYS 380
              P++++I  G D   GD   +  +T S    ++ ++++   + ++  +  GGY+
Sbjct: 333 RHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYN 388

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 86/185 (46%), Gaps = 14/185 (7%)

Query: 171 SYLSAKL--SCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQ 227
           SYL   L  + G  +   K +V       + +    G HHA  + A GFC  +++ +  Q
Sbjct: 181 SYLPMYLQVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQ 240

Query: 228 NILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDR 287
            + KN     +KI  LD+D+HHG+G +KAF     +  ISLH  E G ++PGT  G S+ 
Sbjct: 241 RMRKN---GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPGT-GGLSN- 294

Query: 288 VGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVG 347
               KG     +IP    G+ D       +Q+I+P       + +++  G D   GD   
Sbjct: 295 ----KGSRDLIDIPLS-HGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFN 349

Query: 348 QCHVT 352
           +  +T
Sbjct: 350 EWQLT 354

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 109/255 (42%), Gaps = 17/255 (6%)

Query: 181 GAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRK 239
           GA          R +  ++V    G HHA    A GFC  +++A+  Q + +     + K
Sbjct: 198 GATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAILIQKLRR---RGIHK 254

Query: 240 IMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCN 299
           I  LD+D+HHG+G ++AF     V  IS+H +E G ++PGT  G       G+      N
Sbjct: 255 ISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT--GTLKDASSGRNI---VN 308

Query: 300 IPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVT-PSCYGH 358
           IP    G+ D+       +V++P      P++VII  G D   GD   +  +T       
Sbjct: 309 IP-VLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTDT 367

Query: 359 MTHMLKSLARGNLCAVLEGGYSLDSIAK-----SALAVAKVLIGEPPDELPVVKQPKLEA 413
           +  +++     N+  +  GGY+   +++     +   V+K     P D         +  
Sbjct: 368 IMKVVEDFPSSNIVLLGGGGYNEKLMSRFYTYLTWRIVSKYSENAPTDNPFDRHDDVIPD 427

Query: 414 VEVIDSVIKTQSKYW 428
            E IDS      K+W
Sbjct: 428 HEFIDSYKDEFYKFW 442

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 77/143 (53%), Gaps = 17/143 (11%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA    A GFC  +++ +  Q + K   +   K+  LD+D+HHG+G ++AF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 266 ISLHRHELGKYYP--GTIHGNSDRVGEGKGEGFN-CNIPWPWKGVGDSEYLWAFEQVIMP 322
           ISLH +E G ++P  G++ G+S         GF+  N+P    G+ DS      +QV+ P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGSS---------GFDTVNLPLQ-HGLTDSFLQGLVDQVVNP 311

Query: 323 MGREFRPDLVIISSGFDAADGDT 345
           + +   P++++I  G D   GDT
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDT 334

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 82/336 (24%), Positives = 136/336 (40%), Gaps = 79/336 (23%)

Query: 170 DSYLSAKL--SCGGAIEACKAVV---------EGRVKNALAVVRPPGHHAEPEVAGGFCL 218
           D YLS+K   +  G+I A +  +         E     A   +RPPGHH +     GFCL
Sbjct: 149 DIYLSSKTIEALEGSIAAIETGIDSIFNGPSPEHICNRAFVAIRPPGHHCKVATPSGFCL 208

Query: 219 FSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ------------------------ 254
            +N  ++ +    +Y   +   ++LD+D+HHG+GTQ                        
Sbjct: 209 LNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDICWKRAGFRSEDEPEGSEGYDDF 266

Query: 255 -KAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKG---EGFNCNIPW-----PWK 305
            K F +  +V Y S+  H++  +   T +     +        +G + NI W     PW 
Sbjct: 267 GKKFAEFPKVGYFSM--HDINSFPTETGYATKVNIRNASTCIMDGHDLNI-WNIHLSPWN 323

Query: 306 GVGDSEYLWA-------------FEQVIMPMGREFRP--DLVIISSGFDAADGD-TVGQC 349
              D + L+              F      M +E +P   LV+IS+GFDA++ + T  Q 
Sbjct: 324 TEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKGLVVISAGFDASEYEQTSMQR 383

Query: 350 H---VTPSCYGHMTHMLKSLA----RGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDE 402
           H   V  + Y   T     LA    +G + ++LEGGYS  ++     A    LIG     
Sbjct: 384 HNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDKALTSGVFA---HLIGFQNQN 440

Query: 403 LPVVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGND 438
                  +  + +V+  +++    +WK +K+    D
Sbjct: 441 WI----NEWGSEQVVKEIVRGCKPHWKPYKTKKSRD 472

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 77/306 (25%), Positives = 120/306 (39%), Gaps = 70/306 (22%)

Query: 190 VEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHH 249
           VE     A   +RPPGHH+      GFCL +N  +A +     Y   V   +VLD+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 250 GNGTQ-------------------------KAFYDDDRVLYISLHR-----HELGKYYPG 279
           G+GTQ                         K F +  +V Y SLH       ELG     
Sbjct: 236 GDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDINSFPTELGYATKE 295

Query: 280 TIHGNSDRVGEG--------------KGEGFNCNIPWPWKGV--GDSEYLWAFEQVIMPM 323
            +   +  + +                 E F       ++ +     EY    +Q +  +
Sbjct: 296 NVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKADEYFRTAKQNMRAL 355

Query: 324 GREFRPDLVIISSGFDAADGDTVGQ----CHVTPSCYGHMTHMLKSLAR----GNLCAVL 375
           G+ F+  LV+IS+GFDA++ +         +V    Y   T     LA+    G L +VL
Sbjct: 356 GKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLAQMHSHGKLLSVL 414

Query: 376 EGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLE---AVEVIDSVIKTQSKYWKCFK 432
           EGGYS  +I+    A    LIG       +  Q  +    + +V+  +++     WK +K
Sbjct: 415 EGGYSDGAISSGVFA---HLIG-------LQNQNWINEWGSAQVVKEIVRGCKPQWKPYK 464

Query: 433 STHGND 438
           +    D
Sbjct: 465 TKRARD 470

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 108/231 (46%), Gaps = 28/231 (12%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA  + A GFC  +++ +  Q +     +  +++  +D+D+HHG+G ++AF     V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLLIQKLR---SKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 266 ISLHRHELGKYYP--GTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPM 323
           IS+H  E G ++P  G++  N       KG+    NIP    G+ D        QV++P+
Sbjct: 252 ISMHLFECG-FFPTSGSLEDNK------KGKNI-ANIPLA-HGLNDEYLNEIVTQVVIPL 302

Query: 324 GREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVL---EGGYS 380
                P ++II  G D   GD   +  +T    G   ++LK + R   C+++    GGY+
Sbjct: 303 TDRHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYN 360

Query: 381 LDSIAKSALAVAKVLIGEP---PDELPVVKQPKLEAVEVIDSVIKTQSKYW 428
              +++    +   LI +P    DE  ++ + K      ID+      K+W
Sbjct: 361 PTVMSRFYTYLTGKLI-DPNFLQDEDTIIPEHKF-----IDAYHDEHYKFW 405

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 87/336 (25%), Positives = 134/336 (39%), Gaps = 79/336 (23%)

Query: 170 DSYLSAKL------SCGGAIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGGFCL 218
           D YLS+K       S G    A  ++ +G     + N A   +RPPGHH       GFCL
Sbjct: 144 DIYLSSKTVEALQGSIGALETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCL 203

Query: 219 FSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ------------------------ 254
            +N  VA +     +   V    +LD+D+HHG+GTQ                        
Sbjct: 204 LNNAHVAIEYAKDRF--GVTHAAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSF 261

Query: 255 -KAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKG---EGFNCNIPW-----PWK 305
            K F +  RV Y S+  H++  +   + +   + V           + NI W     PW+
Sbjct: 262 GKKFAEYPRVGYFSM--HDINSFPTESGYATKENVKNASTCIMNAHDVNI-WNIHLSPWE 318

Query: 306 GVGDSEYLWA-------------FEQVIMPMGREFRP--DLVIISSGFDAADGD-TVGQC 349
              D   L+              F+Q  + M  + +P   LV+ISSGFDA++ + T  Q 
Sbjct: 319 TEEDFAKLYHTKYRSLFVKADEFFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQR 378

Query: 350 H---VTPSCYGHMTHMLKSLAR----GNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDE 402
           H   V    Y   T     L++    G + +++EGGYS  +I     A    LIG     
Sbjct: 379 HGTNVPTYFYTAFTKDALKLSQMHCHGKVLSIMEGGYSDKAIVSGVFA---HLIGLQNQN 435

Query: 403 LPVVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGND 438
              +K+   E   V+  +++     WK +K+    D
Sbjct: 436 W--IKEWGSE--HVVKEIVRGCKSNWKPYKTKKARD 467

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA    A GFC  +++ +  Q++ +   +  +++  +D+D+H+G+G  KAF   + V  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGR 325
           IS+H +E G ++PGT       + E +      N+P    G+ D   L     VI P+  
Sbjct: 250 ISVHLYEPG-FFPGT-----GSLEETRNSKQMVNLP-VLHGMDDKYLLELISSVITPLIE 302

Query: 326 EFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGG 378
            F  + ++I  G D   GD   +  ++     H    +  + R     +L GG
Sbjct: 303 TFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGG 355

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 77/337 (22%), Positives = 136/337 (40%), Gaps = 81/337 (24%)

Query: 170 DSYLSAKL--SCGGAIEACKAVVEG--------RVKN-ALAVVRPPGHHAEPEVAGGFCL 218
           D YLS++   +  G+I A +  V+          + N A   +RPPGHH   +   GFCL
Sbjct: 147 DIYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVAIRPPGHHCHVDTPSGFCL 206

Query: 219 FSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ------------------------ 254
            +N  +A +     Y   +   ++LD+D+HHG+GTQ                        
Sbjct: 207 LNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICWKRAGFRTEAEPETTEGYDEF 264

Query: 255 -KAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKG---EGFNCNIPW-----PWK 305
            K F +  +V Y S+  H++  +   + +   + +           + NI W     PW+
Sbjct: 265 GKKFAEFPKVGYFSM--HDINSFPTESQYATKENIRNASTCVMNAHDVNI-WNIHLSPWE 321

Query: 306 GVGD----------------SEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQC 349
              D                 E+    ++ +  +G+ F+  LV+IS+GFDA++ +     
Sbjct: 322 TEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ-GLVVISAGFDASEFEQTSMQ 380

Query: 350 HVTPSCYGHMTHMLKSLA--------RGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPD 401
             + +   H   M    A         G + +++EGGYS  +IA     V   LIG    
Sbjct: 381 RHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAIAS---GVFSHLIGLQNQ 437

Query: 402 ELPVVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGND 438
               +K+   E  +V+  +++    +WK +K+    D
Sbjct: 438 NW--IKEWGSE--QVVKEIVRGCKPHWKPYKTKKSRD 470

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 79/338 (23%), Positives = 136/338 (40%), Gaps = 75/338 (22%)

Query: 162 GDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVK-----NALAVVRPPGHHAEPEVAGGF 216
           GD +Y +  +  + + S G       ++ +G  +      A   VRPPGHH+      GF
Sbjct: 146 GD-IYLSQQTIAALEGSIGALETGIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGF 204

Query: 217 CLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ---------------------- 254
           CL +N  +A +     +  +V   +VLD+D+HHG+GTQ                      
Sbjct: 205 CLLNNAHIAIEYAADTF--NVTHAVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDE 262

Query: 255 --KAFYDDDRVLYISLHR-----HELGKYYPGTIHGNSDRVGEGKG-------------- 293
             K F +  +V Y S+H       ELG      I   S  +                   
Sbjct: 263 FGKKFAEFPKVGYFSMHDINSFPTELGYATKENIKNASTCIMNAHDLNIWNVHLSHYETE 322

Query: 294 EGFNCNIPWPWKGV--GDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVG-QCH 350
           E F       ++ +     E+    ++ +   G++F+  LV+IS+GFDA++ +    Q H
Sbjct: 323 EDFVKLYQSKYRSLFAKADEFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRH 381

Query: 351 --VTPSCYGHM-----THMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDEL 403
               P+C+ +M       + +    G + +V+EGGYS  +I+     V   LIG      
Sbjct: 382 GVNVPTCFYNMFTKDALKLAQMHTSGKVLSVMEGGYSDGAISS---GVFSHLIG------ 432

Query: 404 PVVKQPKLE---AVEVIDSVIKTQSKYWKCFKSTHGND 438
            +  Q  +    + +V+  +I+     WK +K+    D
Sbjct: 433 -LQNQNWINEWGSAQVVKEIIRGCKPQWKPYKTKKARD 469

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 103/255 (40%), Gaps = 67/255 (26%)

Query: 197 ALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ-- 254
           A   +RPPGHH       GFCL +N  +A +   + Y   V   ++LD+D+HHG+GTQ  
Sbjct: 186 AFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDI 243

Query: 255 -------------------KAFYDD--------DRVLYISLHRHELGKYYPGTIHGNSDR 287
                              K  YDD         +V Y S+  H++  +   + +   D 
Sbjct: 244 CWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSM--HDINSFPTESGYATKDN 301

Query: 288 VGEGKG---EGFNCNIPW-----PWKGVGD----------------SEYLWAFEQVIMPM 323
           +        +  + NI W      W    D                 E+    +  +  M
Sbjct: 302 IKNASTCVMDAHDLNI-WNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEM 360

Query: 324 GREFRPDLVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLAR----GNLCAVL 375
            + F+  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+    G + +VL
Sbjct: 361 NKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVL 419

Query: 376 EGGYSLDSIAKSALA 390
           EGGYS  +IA    +
Sbjct: 420 EGGYSDKAIASGVFS 434

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 118/298 (39%), Gaps = 69/298 (23%)

Query: 197 ALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ-- 254
           A   +RPPGHH+      GFCL +N  +A +     Y  +V   +VLD+D+HHG+GTQ  
Sbjct: 187 AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQDI 244

Query: 255 ----------------------KAFYDDDRVLYISLHR-----HELGKYYPGTIHGNSDR 287
                                 K F +  +V Y S+H       ELG      I   +  
Sbjct: 245 CWKRAGFKPDECADSGEFDEFGKKFAEYPKVGYFSVHDINSFPTELGYATKENIRNAATC 304

Query: 288 VGEG--------------KGEGFNCNIPWPWKGV--GDSEYLWAFEQVIMPMGREFRPDL 331
           + +                 E F       ++ +     E+    +Q +  +G+ F+  L
Sbjct: 305 IMDAHDVNIWNVHLQPYDSEEAFTKLYQTKYRTLFAKADEFFRISKQTMKALGKPFK-GL 363

Query: 332 VIISSGFDAADGDTVGQ----CHVTPSCYGHMTHMLKSLAR----GNLCAVLEGGYSLDS 383
           V+IS+GFDA++ +         +V    Y   T     LA+    G + +V+EGGYS  +
Sbjct: 364 VVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDALKLAQMHSHGKVLSVMEGGYSDGA 423

Query: 384 IAKSALAVAKVLIGEPPDELPVVKQPKLE---AVEVIDSVIKTQSKYWKCFKSTHGND 438
           I     A    LIG       +  Q  +    + +V+  +++     WK +K+    D
Sbjct: 424 ITSGVFA---HLIG-------LQNQSWINEWGSAQVVKEIVRGCKPNWKPYKTKRARD 471

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 95/373 (25%), Positives = 146/373 (39%), Gaps = 76/373 (20%)

Query: 132 ILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKL--SCGGAIEACKAV 189
           + +VH KE  + + +      ++L K   +    +   D YLS+K   +  G I A +  
Sbjct: 108 VYKVHGKEWPKEVIQLCKEADEKLAKGEIEVPESWNAGDIYLSSKTIQALQGTIGALETG 167

Query: 190 VEGRVK---------NALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240
           V+   K          A   +RPPGHH       GFCL +N  VA +     Y   V  +
Sbjct: 168 VDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--GVTHV 225

Query: 241 MVLDWDVHHGNGTQ--------------------------KAFYDDDRVLYISLHR---- 270
            VLD+D+HHG+GTQ                          K F +  +V Y S+H     
Sbjct: 226 AVLDFDLHHGDGTQDLCWKRAGFKPDEDINPKEGEYDDFGKKFAEFPKVGYFSMHDINSF 285

Query: 271 -HELGKYYPGTIHG------NSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQV---- 319
             E G      I        NS  +        N N    +  +  S+Y   F +     
Sbjct: 286 PTESGFATKENIKNASTCLMNSHDLNIWNIHMSNWNNEEEFVKLYRSKYRVLFAKADEYF 345

Query: 320 ------IMPMGREFRPDLVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLA-- 367
                 +  +GR F+  +V+IS+GFDA++ + T  Q H   V    Y   T     LA  
Sbjct: 346 KTAKLEMAALGRPFK-GMVLISAGFDASEFEQTTMQRHGSNVPTEFYTMFTKDALKLAQM 404

Query: 368 --RGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSVIKTQS 425
             +G + +++EGGYS  +I     A    LIG    +   +K+   E   VI  +++   
Sbjct: 405 HCQGKVLSLMEGGYSDKAITSGVFA---HLIGLQNQDW--IKEWGSE--HVIKEIVRGCK 457

Query: 426 KYWKCFKSTHGND 438
             WK +K+    D
Sbjct: 458 PAWKPYKTKRSKD 470

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 79/175 (45%), Gaps = 24/175 (13%)

Query: 181 GAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRK 239
           GA  A    +     +ALAV    G HHA    A GFC  +++A+  Q + +   +   +
Sbjct: 167 GATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGFLR 223

Query: 240 IMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNC- 298
           +  +D+D+HHG+G + AF     V   SLH  E G ++PGT            G   NC 
Sbjct: 224 VSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPGT------------GACKNCT 270

Query: 299 -----NIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQ 348
                N+P    GV DS      + ++ P  +   P+++II  G D   GD  G+
Sbjct: 271 DNSVLNVPL-LHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGE 324

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 87/348 (25%), Positives = 146/348 (41%), Gaps = 76/348 (21%)

Query: 154 QLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEG----RVKN-ALAVVRPPGHHA 208
           ++ KE   GD +Y ++ +  + + + G        +  G     + N    VVRPPGHH 
Sbjct: 136 EVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHHC 194

Query: 209 EPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ-------------- 254
                 GFCL +N  ++ +     Y   V    +LD+D+HHG+GTQ              
Sbjct: 195 HVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQDICWKRAGFKPDGA 252

Query: 255 -----KAFYDD--------DRVLYISLHRHELGKYYPGTIHGNSDRVGEGKG---EGFNC 298
                +  YDD         +V Y S+  H++  +   + +  S+ +        +  + 
Sbjct: 253 TREENEEPYDDFGKRTAAFPKVGYFSM--HDINSFPTESGYATSENIRNASTCIMDSHDL 310

Query: 299 NIPW-----PWKGVGD------SEY--LWA-----FEQVIMPMGREFRP--DLVIISSGF 338
           NI W     PW    D      S+Y  L+A     F+   + M ++  P   LV+IS+GF
Sbjct: 311 NI-WNVHLAPWATEEDFMKLYRSKYRTLFAKADEYFKTARLEMQKQGTPFKGLVVISAGF 369

Query: 339 DAADGD-TVGQCH---VTPSCYGHMTHMLKSLA----RGNLCAVLEGGYSLDSIAKSALA 390
           DA++ + T  Q H   V    Y   T  +  LA    +G + +V+EGGYS  +I     A
Sbjct: 370 DASEFEQTSMQRHSVNVPTEFYTLFTKDVLKLAQMHTQGKVLSVMEGGYSDKAITSGVFA 429

Query: 391 VAKVLIGEPPDELPVVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGND 438
               LIG    +   +++   E  +V+  +++     WK +K+    D
Sbjct: 430 ---HLIGLQNQDW--IREWGSE--QVVKEIVRGCKPNWKPYKTKRAQD 470

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 109/268 (40%), Gaps = 37/268 (13%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESV---RKIMVLDWDVHHGNGTQKAFYDDDR 262
           HHA    A GFC  +++ V+  N L+  P      RK+  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 263 VLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWK-GVGDSEYLWAFEQVIM 321
           +  IS+H  E G +YP T      + G+ K    N  I  P K G+ +S        +I+
Sbjct: 265 IQIISIHLFEPG-FYPCT---GGLKFGKPKS---NNIINLPVKHGLSNSNMFELVTNIII 317

Query: 322 PMGREFRPDLVIISSGFDAADGDTVGQCHVT----PSCYGHMTHMLKSLARGNLC--AVL 375
           P+    + D ++I  G D  + D   +  +T      C   +        +   C   VL
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLTIIGLTRCIIKIIAAFVGPHQPGSCKNVVL 377

Query: 376 EGG----------------YSLDSIAKSALAVAKVLIGEPPDELPVVKQPKL--EAVEVI 417
            GG                Y +  +A      A  L  E P      K  +L  +  E I
Sbjct: 378 LGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHEHI 437

Query: 418 DSVIKTQSKYWKCFKSTHGNDGCSFKEQ 445
           D   K   KYW C++  +G DG SFK Q
Sbjct: 438 DEYEKEYYKYW-CYEIENGLDGLSFKRQ 464

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 91/371 (24%), Positives = 144/371 (38%), Gaps = 74/371 (19%)

Query: 132 ILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKL--SCGGAIEACKAV 189
           + +VH       + K       +LLK   +    + + D YLS+K   +  G I A +  
Sbjct: 110 VFKVHGSHWPAELIKLCQEADSKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 190 VEGRVK---------NALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240
           V+   K          A   +RPPGHH       GFCL +N  VA +     Y  +V  +
Sbjct: 170 VDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHV 227

Query: 241 MVLDWDVHHGNGTQ------------------------KAFYDDDRVLYISLHR-----H 271
           +VLD+D+HHG+GTQ                        K F +  +V Y S+H       
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEEAKDTSYDDFGKKFAEFPKVGYFSMHDINSFPT 287

Query: 272 ELGKYYPGTIHGNSDRVGEGKG--------------EGFNCNIPWPWKGV--GDSEYLWA 315
           E G      I   S  +                   E FN      ++ +     E+  +
Sbjct: 288 ESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFKS 347

Query: 316 FEQVIMPMGREFRPDLVIISSGFDAADGD-TVGQCH-VTPSCYGHMTHMLKSL------A 367
            +  +   G+ F   LV+IS+GFDA++ + T  Q H V    Y + T    +L       
Sbjct: 348 AKVEMKQQGKSFE-GLVVISAGFDASEFEQTSMQRHSVNVPTYFYTTFTKDALKLAQMHC 406

Query: 368 RGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSVIKTQSKY 427
            G + +++EGGYS  +I     A    LIG    +   V +   E  +V+  +++     
Sbjct: 407 HGKVLSLMEGGYSDKAICSGVFA---HLIGLQNQDW--VNEWGSE--QVVKEIVRGCKPA 459

Query: 428 WKCFKSTHGND 438
           WK +K+    D
Sbjct: 460 WKPYKTRRAKD 470

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 23/153 (15%)

Query: 206 HHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLY 265
           HHA    A GFC  +++ +  Q + KN      ++  +D+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 266 ISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNC------NIPWPWKGVGDSEYLWAFEQV 319
            SLH  E G ++PGT            G   NC      NIP  + G+ D       + +
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPL-FHGLDDESLDEIVDNI 297

Query: 320 IMPMGREFRPDLVIISSGFDAADGDTVGQCHVT 352
           ++P   +  P++++I  G D   GD   +  +T
Sbjct: 298 LIPCVNKHDPEVLVIQCGADGLSGDKYKEWQLT 330

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 190 VEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHH 249
           VE     A   +RPPGHH+      GFCL +N  +A +   + Y   V   ++LD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 250 GNGTQ 254
           G+GTQ
Sbjct: 234 GDGTQ 238

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 13/98 (13%)

Query: 168 NNDSYLSAKL--SCGGAIEACKAVVEGRVK---------NALAVVRPPGHHAEPEVAGGF 216
           + D YLS+K   +  G+I A +  V+   K          A   +RPPGHH       GF
Sbjct: 144 SGDIYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGF 203

Query: 217 CLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ 254
           C+ +N  VA +    +Y   V  + VLD+D+HHG+GTQ
Sbjct: 204 CVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 97/248 (39%), Gaps = 60/248 (24%)

Query: 198 LAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQ--- 254
              +RPPGHH       GFCL +N  +  +     Y   V   ++LD+D+HHG+GTQ   
Sbjct: 183 FVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHAVILDFDLHHGDGTQDLC 240

Query: 255 ---------------------KAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKG 293
                                K F +  +V Y S+  H++  +   +     + +     
Sbjct: 241 WKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSM--HDINSFPTESGFATKENIKNAST 298

Query: 294 EGFNCNIPWPWK-------------GVGDSEYLWAFEQV----------IMPMGREFRPD 330
              N +    W               +  S+Y   F +           +  +G+ F+  
Sbjct: 299 CIMNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFKNSKNEMNELGKPFK-G 357

Query: 331 LVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLA----RGNLCAVLEGGYSLD 382
           LV+IS+GFDA++ + T  Q H   V  S Y   T     LA    +G + ++LEGGYS  
Sbjct: 358 LVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHCQGKVLSLLEGGYSDK 417

Query: 383 SIAKSALA 390
           +I     +
Sbjct: 418 AITSGVFS 425

>AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL128C (CWC23)
          Length = 273

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%)

Query: 99  AENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKE 158
            EN L+    +  VD++ DL+    V+    E ILQV  + H ++    T ++ D+ + E
Sbjct: 202 TENDLVLYAVMPDVDTMLDLLNNWAVKPPLSEHILQVQPRVHTDYFHFKTDISLDKTITE 261

Query: 159 TEKGDSVYFNN 169
               D+ Y ++
Sbjct: 262 AIDADNQYMSS 272

>Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL012W
           (REAL)
          Length = 1226

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 53/136 (38%), Gaps = 30/136 (22%)

Query: 305 KGVGDSEYLWAFEQVIMPMGREF-RPDLVIISS---GFDAADGDTVGQCH-----VTPSC 355
           K V +     AF+ +I  MGR+   P+ +I  S   G+D A  D +         ++   
Sbjct: 835 KDVNEKSRETAFDTLI-NMGRKMNEPNSIIKLSQIPGYDPATPDQLSSISEFFKIISAGL 893

Query: 356 YGHMTHMLKSLARGNLCAVLEGGYSLDS--------------------IAKSALAVAKVL 395
            G   HM+ S   G  C V E    +DS                    I KSA+   KV 
Sbjct: 894 IGESQHMVSSSITGYACLVFEFKNEIDSGILMDIYDTIELYLTSNSREIVKSAIGFTKVC 953

Query: 396 IGEPPDELPVVKQPKL 411
           +   P+EL   K P+L
Sbjct: 954 VLGLPEELMRPKVPEL 969

>KLTH0F02882g Chr6 (248890..251325) [2436 bp, 811 aa] {ON} similar
           to uniprot|P53848 Saccharomyces cerevisiae YNL256W FOL1
           Multifunctional enzyme of the folic acid biosynthesis
           pathway has dihydropteroate synthetase
           dihydro-6-hydroxymethylpterin pyrophosphokinase and
           dihydroneopterin aldolase activities
          Length = 811

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 536 DVIKWASSRNYGVIDINIPQSLHEQDNYSAV-ITAQEVLVHIWDNYLKYFPSLNRVAFVA 594
           D +K+  S NY VI  +I   ++ + NY ++ + A+ VL HI D Y    P +  +A  A
Sbjct: 65  DELKY--SLNYAVISKDISHFVNPRQNYKSLGLLAERVLHHIKDGY----PGIQSLALKA 118

Query: 595 -IGDAH 599
             GDAH
Sbjct: 119 QAGDAH 124

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,713,033
Number of extensions: 3616787
Number of successful extensions: 9580
Number of sequences better than 10.0: 110
Number of HSP's gapped: 9529
Number of HSP's successfully gapped: 130
Length of query: 708
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 591
Effective length of database: 40,065,477
Effective search space: 23678696907
Effective search space used: 23678696907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)