Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G10318g2.284ON79079038510.0
Kwal_27.115422.284ON79180324010.0
SAKL0E07722g2.284ON79181418390.0
Suva_9.1042.284ON80585815970.0
Smik_9.842.284ON80885615620.0
YIL095W (PRK1)2.284ON81086415570.0
Skud_9.782.284ON80985315450.0
KLLA0E08405g2.284ON77784714770.0
TDEL0G021502.284ON66147914360.0
NCAS0B062602.284ON72380514270.0
ADL217W2.284ON75059914250.0
NDAI0B035602.284ON75681314160.0
Ecym_33232.284ON74856014000.0
TPHA0C033802.284ON69750613171e-171
NCAS0G038102.284ON66140613121e-171
KAFR0H033302.284ON36931312781e-170
CAGL0G02607g2.284ON68844212971e-168
NDAI0G006402.284ON62131512891e-168
KAFR0J013702.284ON78031612981e-167
Kpol_1003.352.284ON71331512781e-165
ZYRO0A01848g2.284ON70431512721e-164
KNAG0A054302.284ON78883812521e-160
Skud_14.3092.284ON63931412381e-160
YNL020C (ARK1)2.284ON63831412201e-157
TBLA0B059302.284ON71731312271e-157
Suva_14.3272.284ON63230812141e-157
TPHA0D015402.284ON70769712131e-155
Kpol_1039.332.284ON70131512101e-155
Smik_14.3112.284ON63731411961e-154
KNAG0H020202.284ON59231511871e-153
TBLA0B069402.284ON144342411981e-146
CAGL0J03432g2.284ON62230311401e-146
SAKL0D03234g3.273ON8583127993e-93
KAFR0A010403.273ON9123337944e-92
KLTH0C07260g3.273ON9013107935e-92
TBLA0E025903.273ON10613167971e-91
Kpol_251.43.273ON8383137842e-91
Kwal_27.109453.273ON9353087903e-91
KLLA0F18612g3.273ON8143137762e-90
KNAG0J008203.273ON10913197893e-90
Kpol_1052.223.273ON11013097885e-90
KAFR0C004303.273ON9493197762e-89
KNAG0H012203.273ON9133217753e-89
Ecym_26503.273ON8943077716e-89
CAGL0H10208g3.273ON10273127777e-89
NCAS0A105903.273ON10953187791e-88
TPHA0M011203.273ON7883137603e-88
AGR027C3.273ON9613127675e-88
ZYRO0E06864g3.273ON11153147746e-88
TPHA0A040303.273ON10543267603e-86
TDEL0D035203.273ON10493117584e-86
NDAI0A057003.273ON11573257616e-86
CAGL0K11990g3.273ON9913117548e-86
Suva_4.2973.273ON11073117534e-85
Smik_2.1913.273ON11083157518e-85
Skud_2.1793.273ON10903127491e-84
YBR059C (AKL1)3.273ON11083157455e-84
TBLA0I019303.273ON13613137472e-83
Kwal_56.242746.262ON3463372592e-23
KLTH0H03080g6.262ON3463302371e-20
TDEL0A067506.262ON3723482362e-20
Skud_16.426.262ON3643332362e-20
Kpol_2002.241.24ON4872912402e-20
KNAG0F001701.24ON5432022403e-20
Kpol_1023.266.31ON7392712389e-20
NDAI0F045201.24ON4892592351e-19
SAKL0H06754g8.668ON8842102362e-19
Suva_16.706.262ON3643392282e-19
YPL236C (ENV7)6.262ON3643312264e-19
TPHA0E038501.24ON4821972287e-19
NDAI0K021002.496ON9092772319e-19
SAKL0C00946g1.24ON5641972271e-18
Kpol_1072.198.668ON8962942282e-18
Kwal_26.87518.668ON8482072272e-18
Kpol_1037.206.31ON7042762245e-18
TBLA0A074601.24ON5162682225e-18
ZYRO0E07876g6.262ON3693342185e-18
KAFR0A050906.31ON6682422227e-18
Suva_16.1608.668ON9183162221e-17
ZYRO0F18062g1.24ON4711972181e-17
NDAI0C026806.31ON7502762211e-17
TDEL0C067801.24ON4682802171e-17
KLTH0F16676g5.406ON8782052211e-17
KAFR0G012001.24ON5072692172e-17
Smik_13.1596.31ON7052762182e-17
NCAS0A002801.24ON5353022153e-17
TDEL0G043806.31ON7222762173e-17
KNAG0D048107.86ON14401832184e-17
Smik_1.793.177ON9742902174e-17
Ecym_30356.31ON7402762164e-17
Ecym_21536.262ON3633502105e-17
Kwal_33.131121.24ON5052902135e-17
YPL150W8.668ON9013182156e-17
TPHA0J004206.31ON7072762156e-17
NCAS0D021006.31ON7262762147e-17
Kwal_26.73551.271ON14462602167e-17
ACL006W6.31ON7082762138e-17
ABL034W2.479ON14253192158e-17
CAGL0M02299g8.668ON8932142148e-17
Smik_6.4416.262ON3643332089e-17
Suva_13.1636.31ON7052762121e-16
Skud_13.1546.31ON7052762121e-16
Skud_16.1328.668ON9243172131e-16
NDAI0G034508.141ON9483222131e-16
Skud_10.1191.271ON14812792131e-16
YAR019C (CDC15)3.177ON9742892131e-16
YMR001C (CDC5)6.31ON7052762111e-16
TPHA0F024306.31ON7982712112e-16
Kwal_55.215455.406ON8652052112e-16
CAGL0J11638g6.31ON7462772112e-16
Sklu_YGOB_Anc_2.4962.496ON6192822092e-16
Kwal_26.78612.496ON9553012112e-16
Kpol_431.92.479ON15522052112e-16
NCAS0C041008.141ON9053332102e-16
ZYRO0C07480g6.31ON7742762093e-16
Skud_1.723.177ON9742872093e-16
Smik_6.3478.668ON9173182093e-16
NCAS0C016708.668ON8962092094e-16
CAGL0K08514g2.479ON14892232094e-16
Smik_4.3678.279ON10662862094e-16
KLLA0F14190g1.271ON13382542094e-16
Smik_10.1471.271ON14782792094e-16
YDR122W (KIN1)8.279ON10642862084e-16
KLTH0D11044g8.668ON8492102076e-16
Suva_2.2838.279ON10892862076e-16
KNAG0E008506.31ON7112762066e-16
YJL095W (BCK1)1.271ON14782792076e-16
SAKL0H07084g8.654ON9192532076e-16
TPHA0G032002.479ON15342062077e-16
ACR133C8.668ON8512012068e-16
TDEL0A061408.668ON8613092059e-16
KLLA0E21693g5.406ON10162592051e-15
Suva_6.1691.271ON14842792061e-15
SAKL0E01584g6.31ON6952762041e-15
ZYRO0F07194g8.668ON9382102051e-15
KLLA0F11319g8.668ON8432072041e-15
TDEL0A027202.496ON9152712041e-15
YDR523C (SPS1)1.24ON4901972021e-15
KNAG0F029006.31ON6493112031e-15
NDAI0A038702.496ON8952302041e-15
KNAG0B053502.496ON8362732031e-15
ZYRO0D05500g7.86ON12621792042e-15
KLLA0C06138g6.31ON7083412032e-15
CAGL0L03520g1.271ON14473002042e-15
Ecym_10301.24ON4402831992e-15
ZYRO0B01166g2.496ON9632722032e-15
Skud_8.392.496ON9232812032e-15
TPHA0G032902.496ON9732842032e-15
Skud_8.1635.406ON10761992032e-15
Ecym_24342.496ON11222722032e-15
ZYRO0D06776g8.279ON12042162022e-15
KLTH0F00946g1.24ON5122321993e-15
CAGL0M11396g8.279ON11922102023e-15
SAKL0H16632g8.279ON10621962023e-15
Smik_8.422.496ON9392812013e-15
Suva_15.2975.406ON10741992013e-15
TDEL0A025502.479ON13692212023e-15
KAFR0G026906.31ON7132762003e-15
TDEL0F040608.279ON11262862013e-15
Suva_3.1901.52ON10242372013e-15
ABR014W2.496ON9712242004e-15
KAFR0B028008.279ON10952172004e-15
TBLA0B004906.31ON7872751994e-15
NDAI0C017005.406ON10201942004e-15
KLTH0D06006g2.496ON9543011995e-15
Kwal_56.224766.31ON6972761995e-15
CAGL0B01925g8.279ON9442131995e-15
KLTH0D03454g1.271ON14332342005e-15
YHL007C (STE20)2.496ON9392981995e-15
SAKL0G01848g5.406ON8851971995e-15
CAGL0K02673g2.496ON9152961986e-15
ZYRO0G15290g1.271ON14872601996e-15
SAKL0A03344g6.262ON3643551936e-15
KLTH0C10912g6.31ON6972761976e-15
AFR724C1.24ON4402841957e-15
Smik_8.1805.406ON10731991987e-15
Skud_4.3838.279ON10652191988e-15
KNAG0G021108.279ON11921961988e-15
Kpol_1031.105.406ON11271991989e-15
KAFR0A017602.496ON8852701979e-15
Smik_4.8031.24ON4901971941e-14
Kpol_1055.242.496ON9372681961e-14
Suva_1.863.177ON9742911971e-14
Kwal_26.71547.86ON12132071961e-14
TBLA0A047207.86ON12621821961e-14
ACL104C5.406ON9472011961e-14
Suva_7.828.141ON9003031951e-14
KLLA0F13552g2.479ON12673001961e-14
Smik_7.928.141ON8973141951e-14
YGL180W (ATG1)8.141ON8973031952e-14
TBLA0H016605.406ON9962411952e-14
KLTH0G05214g5.591ON6532771942e-14
Suva_8.472.496ON9802971952e-14
KAFR0D033902.496ON7982211942e-14
Ecym_42918.279ON11451961952e-14
Kpol_463.81.271ON14472371952e-14
KAFR0D049505.406ON10082021952e-14
Kpol_1065.36.222ON3762781902e-14
TPHA0I009201.271ON14342381952e-14
Kwal_56.237178.279ON8581971942e-14
NCAS0B044906.222ON3492031892e-14
KLTH0C09548g3.92ON9931921942e-14
NCAS0B037408.279ON10492321942e-14
YHR102W (KIC1)5.406ON10801991942e-14
TBLA0D022308.141ON11543121942e-14
Skud_7.918.141ON8973031932e-14
TBLA0B082503.92ON13471951943e-14
TPHA0G016308.668ON8712031933e-14
KNAG0B017801.271ON15802341933e-14
Smik_3.1896.371ON7191961923e-14
NCAS0A094701.271ON15152241933e-14
AGR058W8.279ON10711961933e-14
Skud_4.7971.24ON4851931903e-14
KLLA0B13607g2.496ON9892371923e-14
NCAS0B086001.52ON11172371923e-14
Suva_2.7031.24ON4851931904e-14
TBLA0I011502.479ON17453081924e-14
KLTH0D10714g8.654ON8722631914e-14
Ecym_55055.406ON10031941914e-14
CAGL0L11550g5.406ON10722301924e-14
Suva_7.838.140ON5692441905e-14
KLTH0G13288g8.279ON11421971915e-14
KNAG0D002106.371ON8331981915e-14
KAFR0A014201.271ON13982331915e-14
KAFR0D012207.86ON10551961915e-14
TBLA0C046008.279ON13152291915e-14
Skud_3.391.52ON10172241916e-14
Skud_16.3403.338ON3882211866e-14
TDEL0H036407.86ON12371841916e-14
NDAI0E023908.668ON8832091906e-14
NCAS0A050502.496ON8932511906e-14
Ecym_24058.668ON8552001906e-14
TBLA0C029401.271ON16432821907e-14
Ecym_60406.371ON8962011907e-14
Kpol_1072.318.652ON5263181887e-14
CAGL0H01639g1.24ON5212791887e-14
CAGL0I07513g3.92ON10761951907e-14
TBLA0B038608.668ON9882091898e-14
CAGL0F00913g7.86ON12061971898e-14
SAKL0D05522g1.271ON14742141898e-14
AFL101C6.222ON3672761849e-14
YKL101W (HSL1)2.479ON15183141899e-14
NCAS0G012106.262ON3673021849e-14
KNAG0J016708.668ON10092001881e-13
SAKL0A04246g6.222ON4002151841e-13
Suva_11.1232.479ON15262221891e-13
AFR092W1.271ON14232711881e-13
TPHA0J008208.279ON12181971881e-13
Ecym_26407.86ON13251771881e-13
NCAS0B050908.279ON12102091881e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G10318g
         (790 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...  1488   0.0  
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   929   0.0  
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   712   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   619   0.0  
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   606   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   604   0.0  
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   599   0.0  
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   573   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   557   0.0  
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   554   0.0  
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   553   0.0  
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   550   0.0  
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   543   0.0  
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   511   e-171
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   509   e-171
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   496   e-170
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   504   e-168
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    501   e-168
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   504   e-167
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   496   e-165
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   494   e-164
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   486   e-160
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   481   e-160
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   474   e-157
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   477   e-157
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   472   e-157
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   471   e-155
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   470   e-155
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   465   e-154
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   461   e-153
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   466   e-146
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   443   e-146
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   312   3e-93
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   310   4e-92
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   310   5e-92
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   311   1e-91
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   306   2e-91
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   308   3e-91
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   303   2e-90
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   308   3e-90
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   308   5e-90
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   303   2e-89
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   303   3e-89
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   301   6e-89
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   303   7e-89
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   304   1e-88
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   297   3e-88
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   300   5e-88
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   302   6e-88
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   297   3e-86
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   296   4e-86
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   297   6e-86
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   295   8e-86
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   294   4e-85
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   293   8e-85
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   293   1e-84
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   291   5e-84
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   292   2e-83
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...   104   2e-23
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    96   1e-20
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    96   2e-20
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    96   2e-20
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    97   2e-20
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    97   3e-20
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    96   9e-20
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    95   1e-19
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    96   2e-19
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    92   2e-19
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    92   4e-19
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    92   7e-19
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    94   9e-19
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    92   1e-18
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    92   2e-18
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    92   2e-18
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    91   5e-18
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    90   5e-18
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    89   5e-18
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             90   7e-18
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    90   1e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    89   1e-17
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    90   1e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    88   1e-17
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    90   1e-17
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    88   2e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    89   2e-17
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        87   3e-17
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    88   3e-17
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    89   4e-17
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    88   4e-17
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    88   4e-17
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    86   5e-17
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    87   5e-17
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    87   6e-17
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    87   6e-17
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      87   7e-17
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    88   7e-17
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    87   8e-17
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    87   8e-17
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    87   8e-17
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    85   9e-17
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    86   1e-16
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    86   1e-16
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    87   1e-16
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     87   1e-16
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    87   1e-16
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    87   1e-16
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    86   1e-16
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    86   2e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    86   2e-16
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    86   2e-16
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    85   2e-16
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    86   2e-16
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    86   2e-16
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     86   2e-16
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    85   3e-16
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    85   3e-16
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    85   3e-16
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    85   4e-16
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    85   4e-16
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    85   4e-16
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    85   4e-16
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    85   4e-16
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    85   4e-16
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    84   6e-16
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    84   6e-16
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    84   6e-16
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    84   6e-16
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    84   6e-16
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    84   7e-16
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    84   8e-16
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    84   9e-16
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    84   1e-15
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    84   1e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    83   1e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    84   1e-15
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    83   1e-15
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    83   1e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    82   1e-15
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               83   1e-15
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     83   1e-15
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    83   1e-15
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    83   2e-15
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    83   2e-15
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    83   2e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    81   2e-15
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    83   2e-15
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    83   2e-15
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    83   2e-15
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    83   2e-15
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    83   2e-15
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    82   2e-15
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    81   3e-15
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    82   3e-15
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    82   3e-15
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    82   3e-15
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    82   3e-15
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    82   3e-15
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    82   3e-15
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    82   3e-15
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    82   3e-15
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    82   4e-15
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    82   4e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    81   4e-15
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    82   4e-15
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    81   5e-15
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    81   5e-15
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    81   5e-15
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    82   5e-15
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    81   5e-15
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    81   5e-15
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    81   6e-15
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    81   6e-15
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    79   6e-15
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    80   6e-15
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    80   7e-15
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    81   7e-15
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    81   8e-15
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    81   8e-15
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    81   9e-15
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    80   9e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    79   1e-14
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    80   1e-14
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    80   1e-14
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    80   1e-14
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    80   1e-14
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    80   1e-14
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    80   1e-14
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    80   1e-14
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    80   1e-14
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    80   2e-14
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    80   2e-14
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    79   2e-14
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    80   2e-14
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    79   2e-14
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    80   2e-14
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    80   2e-14
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    80   2e-14
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    78   2e-14
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    80   2e-14
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    79   2e-14
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     77   2e-14
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    79   2e-14
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    79   2e-14
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    79   2e-14
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    79   2e-14
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    79   2e-14
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    79   3e-14
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    79   3e-14
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    79   3e-14
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    79   3e-14
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    79   3e-14
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    79   3e-14
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    78   3e-14
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    79   3e-14
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    79   3e-14
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    78   4e-14
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    79   4e-14
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    78   4e-14
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    78   4e-14
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    79   4e-14
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    78   5e-14
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    78   5e-14
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    78   5e-14
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    78   5e-14
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    78   5e-14
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    78   5e-14
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    78   6e-14
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    76   6e-14
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    78   6e-14
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    78   6e-14
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    78   6e-14
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    78   6e-14
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    78   7e-14
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    78   7e-14
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    77   7e-14
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    77   7e-14
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    78   7e-14
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    77   8e-14
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    77   8e-14
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    77   8e-14
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    75   9e-14
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    77   9e-14
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    75   9e-14
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    77   1e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    75   1e-13
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    77   1e-13
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    77   1e-13
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    77   1e-13
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    77   1e-13
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              77   1e-13
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    77   1e-13
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    77   1e-13
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    77   1e-13
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    77   1e-13
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    77   1e-13
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    77   1e-13
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    77   1e-13
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    76   1e-13
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    77   1e-13
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    77   1e-13
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    77   1e-13
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    77   1e-13
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    77   1e-13
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    77   2e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    76   2e-13
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    77   2e-13
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    77   2e-13
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    77   2e-13
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    77   2e-13
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    76   2e-13
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    76   2e-13
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    76   2e-13
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    75   2e-13
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    76   2e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    76   2e-13
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    76   2e-13
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    76   2e-13
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    76   2e-13
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    76   2e-13
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    76   3e-13
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    76   3e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    76   3e-13
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    75   3e-13
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    75   3e-13
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    76   3e-13
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    75   3e-13
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    75   3e-13
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    75   3e-13
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    75   3e-13
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    75   4e-13
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    75   4e-13
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    75   4e-13
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    75   4e-13
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    74   4e-13
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    75   5e-13
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    75   5e-13
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    74   5e-13
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              75   5e-13
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    74   5e-13
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    75   5e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    75   5e-13
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    75   5e-13
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    75   5e-13
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    75   5e-13
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    74   6e-13
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    75   6e-13
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    75   6e-13
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    75   6e-13
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    75   6e-13
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    74   7e-13
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    74   7e-13
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    73   7e-13
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    74   7e-13
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    74   7e-13
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    74   7e-13
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     74   8e-13
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    74   8e-13
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    74   8e-13
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    74   8e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    74   8e-13
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    74   9e-13
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    74   1e-12
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    73   1e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    74   1e-12
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    74   1e-12
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    74   1e-12
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    74   1e-12
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    74   1e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    74   1e-12
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    74   1e-12
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    74   1e-12
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    73   1e-12
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    73   1e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    74   2e-12
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    72   2e-12
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    74   2e-12
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    73   2e-12
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    73   2e-12
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    73   2e-12
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    73   2e-12
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    72   2e-12
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    73   2e-12
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     73   2e-12
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    72   2e-12
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    72   2e-12
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    73   2e-12
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    72   2e-12
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    73   2e-12
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    73   2e-12
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    73   2e-12
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    72   2e-12
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    73   2e-12
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    72   2e-12
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    72   3e-12
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    72   3e-12
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    73   3e-12
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    72   3e-12
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     72   3e-12
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    71   3e-12
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    72   3e-12
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    72   3e-12
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    72   3e-12
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    72   3e-12
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    72   4e-12
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    72   4e-12
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    71   4e-12
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    72   4e-12
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    72   4e-12
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    72   4e-12
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    72   4e-12
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    70   4e-12
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    72   4e-12
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    72   4e-12
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    72   4e-12
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    72   4e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    71   5e-12
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    71   5e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    72   5e-12
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    72   5e-12
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    70   5e-12
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    72   5e-12
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    72   5e-12
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    72   5e-12
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    71   6e-12
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    72   6e-12
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    71   6e-12
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    72   6e-12
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    71   6e-12
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    72   6e-12
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    71   6e-12
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    71   6e-12
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    70   6e-12
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    71   6e-12
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    71   6e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    71   6e-12
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    71   6e-12
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    72   6e-12
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    71   6e-12
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    70   7e-12
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    71   7e-12
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    71   7e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    71   7e-12
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    71   7e-12
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    71   7e-12
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    69   8e-12
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    71   8e-12
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    71   8e-12
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    71   8e-12
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    71   8e-12
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    69   8e-12
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    70   9e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    71   9e-12
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    70   9e-12
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    70   9e-12
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    71   9e-12
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    71   9e-12
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    70   9e-12
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    70   9e-12
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    70   1e-11
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    70   1e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    70   1e-11
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    70   1e-11
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    70   1e-11
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    70   1e-11
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    70   1e-11
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               70   1e-11
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    70   1e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    70   1e-11
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    70   1e-11
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    70   1e-11
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    70   1e-11
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    70   1e-11
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    70   1e-11
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    70   1e-11
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    69   1e-11
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    70   1e-11
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    69   2e-11
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    70   2e-11
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    69   2e-11
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    70   2e-11
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    69   2e-11
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    70   2e-11
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    70   2e-11
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    70   2e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    69   2e-11
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               70   2e-11
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    68   2e-11
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    69   2e-11
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    69   2e-11
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    69   2e-11
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    69   2e-11
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    69   2e-11
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    70   2e-11
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    69   2e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    69   2e-11
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    69   2e-11
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    69   2e-11
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    68   2e-11
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    69   3e-11
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    68   3e-11
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    69   3e-11
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    69   3e-11
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    68   3e-11
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    69   3e-11
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    69   3e-11
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    69   3e-11
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    69   3e-11
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    69   3e-11
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    69   3e-11
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    69   3e-11
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    69   3e-11
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    68   3e-11
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    69   3e-11
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    69   3e-11
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    69   4e-11
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    69   4e-11
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    69   4e-11
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    69   4e-11
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    69   4e-11
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    69   4e-11
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    68   4e-11
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    68   4e-11
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    69   4e-11
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    68   4e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    69   4e-11
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    69   4e-11
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    69   4e-11
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    69   4e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    69   5e-11
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    69   5e-11
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    68   5e-11
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    69   5e-11
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    69   5e-11
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    68   5e-11
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    68   5e-11
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    69   5e-11
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              69   5e-11
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    68   5e-11
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    68   6e-11
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    67   6e-11
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    68   6e-11
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    67   6e-11
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    67   6e-11
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    68   6e-11
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    67   7e-11
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    67   7e-11
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    68   7e-11
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    67   7e-11
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    67   7e-11
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    67   8e-11
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    67   8e-11
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     67   8e-11
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    67   8e-11
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    67   8e-11
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    67   9e-11
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    67   9e-11
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    67   9e-11
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    67   9e-11
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    67   1e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    67   1e-10
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    67   1e-10
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    67   1e-10
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    67   1e-10
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    67   1e-10
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    67   1e-10
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    67   1e-10
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    67   1e-10
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    67   1e-10
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    67   1e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    67   1e-10
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    67   1e-10
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    66   1e-10
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    66   1e-10
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    67   1e-10
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    66   1e-10
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    66   1e-10
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    67   2e-10
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    67   2e-10
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    67   2e-10
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    66   2e-10
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    67   2e-10
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    66   2e-10
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    67   2e-10
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    67   2e-10
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    66   2e-10
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      67   2e-10
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    67   2e-10
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    65   2e-10
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    67   2e-10
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    67   2e-10
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    67   2e-10
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    65   2e-10
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               65   2e-10
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    65   2e-10
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               65   2e-10
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    66   2e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    66   2e-10
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    65   2e-10
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    66   3e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    66   3e-10
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    65   3e-10
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    66   3e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    65   3e-10
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    66   3e-10
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    66   3e-10
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    65   3e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    65   3e-10
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       66   3e-10
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    65   3e-10
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    65   3e-10
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    66   3e-10
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    65   3e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    65   3e-10
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    66   3e-10
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    65   4e-10
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    65   4e-10
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    65   4e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    65   4e-10
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    66   4e-10
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    66   4e-10
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    65   4e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    64   4e-10
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    65   4e-10
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    65   4e-10
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    65   4e-10
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    65   4e-10
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    65   4e-10
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    64   4e-10
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    65   4e-10
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     65   4e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    65   4e-10
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    65   4e-10
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    65   5e-10
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    64   5e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    65   5e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    65   5e-10
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    65   5e-10
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    65   5e-10
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    65   5e-10
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    65   6e-10
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    65   6e-10
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    65   6e-10
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    64   6e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    65   6e-10
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    64   6e-10
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    65   6e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    65   6e-10
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    65   6e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       64   6e-10
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    65   7e-10
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    64   8e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    64   8e-10
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    64   9e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    64   9e-10
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    64   1e-09
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    64   1e-09
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    63   1e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    63   1e-09
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     64   1e-09
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    64   1e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    64   1e-09
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    63   1e-09
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    64   1e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    63   1e-09
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    64   1e-09
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    63   1e-09
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    63   1e-09
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    64   2e-09
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    63   2e-09
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    63   2e-09
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    64   2e-09
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    63   2e-09
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    64   2e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    63   2e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    63   2e-09
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    62   2e-09
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    64   2e-09
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    63   2e-09
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    63   2e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    62   2e-09
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    63   2e-09
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    63   2e-09
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    62   2e-09
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    63   2e-09
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    63   2e-09
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    62   2e-09
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    63   2e-09
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              63   2e-09
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    62   2e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    62   2e-09
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    62   2e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    63   3e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    63   3e-09
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    63   3e-09
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    63   3e-09
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    62   3e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    61   3e-09
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    62   3e-09
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    63   3e-09
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    62   3e-09
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    62   3e-09
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    62   3e-09
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    62   3e-09
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    61   4e-09
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    62   4e-09
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    62   4e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    62   4e-09
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    62   4e-09
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    62   4e-09
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    62   4e-09
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              62   4e-09
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    62   4e-09
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    61   4e-09
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    62   4e-09
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    62   4e-09
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    62   4e-09
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    62   4e-09
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    62   4e-09
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    61   4e-09
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    61   5e-09
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    62   5e-09
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    62   5e-09
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    62   5e-09
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    62   5e-09
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    60   6e-09
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    61   6e-09
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    62   6e-09
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    61   6e-09
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    62   6e-09
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    62   6e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    62   6e-09
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    61   7e-09
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    62   7e-09
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    60   7e-09
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    60   7e-09
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    62   7e-09
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    60   7e-09
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    59   8e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    61   8e-09
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    61   8e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    60   8e-09
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               61   8e-09
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    61   8e-09
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    61   8e-09
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    61   8e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    61   8e-09
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    60   8e-09
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    60   8e-09
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    61   9e-09
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    61   9e-09
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    60   9e-09
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    60   9e-09
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    61   9e-09
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    61   9e-09
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    60   9e-09
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    60   9e-09
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    61   9e-09
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    60   9e-09
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    60   9e-09
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    60   1e-08
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    61   1e-08
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    61   1e-08
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    61   1e-08
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    60   1e-08
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    60   1e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    60   1e-08
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    60   1e-08
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    61   1e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    60   1e-08
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    60   1e-08
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    60   1e-08
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    60   1e-08
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    60   1e-08
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    60   1e-08
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    60   1e-08
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    60   1e-08
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    60   1e-08
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    60   1e-08
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    60   1e-08
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    60   1e-08
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    60   1e-08
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    60   1e-08
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    60   1e-08
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    60   1e-08
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    60   1e-08
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    60   1e-08
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    60   1e-08
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    60   1e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    60   1e-08
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    60   1e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    60   1e-08
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    60   1e-08
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    60   1e-08
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    60   2e-08
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    60   2e-08
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    60   2e-08
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    60   2e-08
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     60   2e-08
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    60   2e-08
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    60   2e-08
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    60   2e-08
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    59   2e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              60   2e-08
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    60   2e-08
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    60   2e-08
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     59   2e-08
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     60   2e-08
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    59   2e-08
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    60   2e-08
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    59   2e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               59   2e-08
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    60   2e-08
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     59   2e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    59   2e-08
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    59   2e-08
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    59   2e-08
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    59   2e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     59   2e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    59   2e-08
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    59   2e-08
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    59   2e-08
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     59   3e-08
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    59   3e-08
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    59   3e-08
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              59   3e-08
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    59   3e-08
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    59   3e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    59   3e-08
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    59   3e-08
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    59   3e-08
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    59   3e-08
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    58   3e-08
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    59   3e-08
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    58   3e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    59   3e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    59   3e-08
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    59   3e-08
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    59   3e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    59   3e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    59   3e-08
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    59   3e-08
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    59   3e-08
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    59   3e-08
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    59   3e-08
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    59   3e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    59   4e-08
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    59   4e-08
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    59   4e-08
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    58   4e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    58   4e-08
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    59   4e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    58   4e-08
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     59   4e-08
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    59   4e-08
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    59   4e-08
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    58   4e-08
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    59   4e-08
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    59   4e-08
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    59   4e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    59   5e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    58   5e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    59   5e-08
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    58   5e-08
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    59   5e-08
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     57   5e-08
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    59   5e-08
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    58   6e-08
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    58   6e-08
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    59   6e-08
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    58   6e-08
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    58   6e-08
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    59   6e-08
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    57   6e-08
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    58   6e-08
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    58   6e-08
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    58   6e-08
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    59   6e-08
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    58   7e-08
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    58   7e-08
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    58   7e-08
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    57   7e-08
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    58   7e-08
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    58   7e-08
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    58   7e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    58   7e-08
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    58   7e-08
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    58   7e-08
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    58   7e-08
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    58   8e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    57   8e-08
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    57   8e-08
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    57   8e-08
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    58   8e-08
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    58   8e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    58   8e-08
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    57   8e-08
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    58   8e-08
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    58   8e-08
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    57   9e-08
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    58   9e-08
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    58   9e-08
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    57   9e-08
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    57   9e-08
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    57   1e-07
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    57   1e-07
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    57   1e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    57   1e-07
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    57   1e-07
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    58   1e-07
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    57   1e-07
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    57   1e-07
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    57   1e-07
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               57   1e-07
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    57   1e-07
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    57   1e-07
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    57   1e-07
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    57   1e-07
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    57   1e-07
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    57   1e-07
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    57   1e-07
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    57   1e-07
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    57   1e-07
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    57   1e-07
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    57   1e-07
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    56   1e-07
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    57   1e-07
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    57   1e-07
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    57   2e-07
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    57   2e-07
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     57   2e-07
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    57   2e-07
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    57   2e-07
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    57   2e-07
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    56   2e-07
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    56   2e-07
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    56   2e-07
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    57   2e-07
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    57   2e-07
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    57   2e-07
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    56   2e-07
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    57   2e-07
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    56   2e-07
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    56   2e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    56   2e-07
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    57   2e-07
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    56   2e-07
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    56   2e-07
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    57   2e-07
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    57   2e-07
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    57   2e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    56   2e-07
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    57   2e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    56   2e-07
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    56   2e-07
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    56   2e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    56   2e-07
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    55   2e-07
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    56   2e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    56   3e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    56   3e-07
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    56   3e-07
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    55   3e-07
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    56   3e-07
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    56   3e-07
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    56   3e-07
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    56   3e-07
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    56   3e-07
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    56   3e-07
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    56   3e-07
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    56   3e-07
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    55   3e-07
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    56   3e-07
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    55   3e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    56   3e-07
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    56   4e-07
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    55   4e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    55   4e-07
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    55   4e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    55   4e-07
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    55   4e-07
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    55   4e-07
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    56   4e-07
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    55   4e-07
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    55   4e-07
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    55   4e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    55   4e-07
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    55   4e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    54   4e-07
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    55   4e-07
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    55   4e-07
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    55   4e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    55   4e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    55   5e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    55   5e-07
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    55   5e-07
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    54   5e-07
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    55   5e-07
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    55   5e-07
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    55   5e-07
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    55   5e-07
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    55   5e-07
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    55   5e-07
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    55   5e-07
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    55   5e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    55   6e-07
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    55   6e-07
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    55   6e-07
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    55   6e-07
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    55   6e-07
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    55   6e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    55   6e-07
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    55   6e-07
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    54   6e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    55   6e-07
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    55   6e-07
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    54   6e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    55   6e-07
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    54   7e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    55   7e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    55   7e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    55   7e-07
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    54   7e-07
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    55   7e-07
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    54   7e-07
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    55   7e-07
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    55   7e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    55   7e-07
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    54   7e-07
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    55   7e-07
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    55   8e-07
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    54   8e-07
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    55   8e-07
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    54   8e-07
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    54   8e-07
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    54   8e-07
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    54   8e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    54   8e-07
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    55   8e-07
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    54   8e-07
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    55   8e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    55   8e-07
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    54   8e-07
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    55   8e-07
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    55   9e-07
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    54   9e-07
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    54   9e-07
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    54   9e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    55   9e-07
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    54   9e-07
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    54   9e-07
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    54   9e-07
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    54   1e-06
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    54   1e-06
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    54   1e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    53   1e-06
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     54   1e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    54   1e-06
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    54   1e-06
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    54   1e-06
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    54   1e-06
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    54   1e-06
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    54   1e-06
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    53   1e-06
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    54   1e-06
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    54   1e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    54   1e-06
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    54   1e-06
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    54   1e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    54   1e-06
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    54   1e-06
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    54   1e-06
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    54   1e-06
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    54   1e-06
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    53   1e-06
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               54   1e-06
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              53   1e-06
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    54   1e-06
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    54   1e-06
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    54   1e-06
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    54   1e-06
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    54   1e-06
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    54   1e-06
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    54   1e-06
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    54   1e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    54   1e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    54   1e-06
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    54   1e-06
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    54   1e-06
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    52   1e-06
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    54   1e-06
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    54   1e-06
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              54   1e-06
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    54   1e-06
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    54   1e-06
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    54   1e-06
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    54   1e-06
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    54   1e-06
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    53   1e-06
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    54   1e-06
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    54   1e-06
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    53   1e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    53   1e-06
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              54   1e-06
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    54   1e-06
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    54   1e-06
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    54   2e-06
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    54   2e-06
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    54   2e-06
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             54   2e-06
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    54   2e-06
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    54   2e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    54   2e-06
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    54   2e-06
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    54   2e-06
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    54   2e-06
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    52   2e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    53   2e-06
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    53   2e-06
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    54   2e-06
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    53   2e-06
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    53   2e-06
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    54   2e-06
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    53   2e-06
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    53   2e-06
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    54   2e-06
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    53   2e-06
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    52   2e-06
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    52   2e-06
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    53   2e-06
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    54   2e-06
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    53   2e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    53   2e-06
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    53   2e-06
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    53   2e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    53   2e-06
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    53   2e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    53   2e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    53   2e-06
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    52   2e-06
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    53   2e-06
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    53   3e-06
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    53   3e-06
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    53   3e-06
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    53   3e-06
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    53   3e-06
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    53   3e-06
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    52   3e-06
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    53   3e-06
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    52   3e-06
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    53   3e-06
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    52   3e-06
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    52   3e-06
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    52   3e-06
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    53   3e-06
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    52   3e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    53   3e-06
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    52   3e-06
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    52   3e-06
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    52   3e-06
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    52   3e-06
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    52   3e-06
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    52   4e-06
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    52   4e-06
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    52   4e-06
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    52   4e-06
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    52   4e-06
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    52   4e-06
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    52   4e-06
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    52   4e-06
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    52   4e-06
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    52   4e-06
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    52   4e-06
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    52   4e-06
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    52   4e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    52   4e-06
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    52   4e-06
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    52   5e-06
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    52   5e-06
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    52   5e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    51   5e-06
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    52   5e-06
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              52   5e-06
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    51   5e-06
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     52   5e-06
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    52   5e-06
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    52   5e-06
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    52   5e-06
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    52   5e-06
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    51   5e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    52   5e-06
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    52   5e-06
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    52   6e-06
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    52   6e-06
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    52   6e-06
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    52   6e-06
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    52   6e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    52   6e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    52   6e-06
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    51   6e-06
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    51   6e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    52   6e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    52   6e-06
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    52   7e-06
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    51   7e-06
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    52   7e-06
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    52   7e-06
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    51   7e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    52   7e-06
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    51   7e-06
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    52   7e-06
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    52   7e-06
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    51   8e-06
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    51   8e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    51   8e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    52   8e-06
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    51   8e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    51   8e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    51   8e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    52   8e-06
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    51   9e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    52   9e-06
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    51   9e-06
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    50   9e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    51   1e-05
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    51   1e-05
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    51   1e-05
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    51   1e-05
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    51   1e-05
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    51   1e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    50   1e-05
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    51   1e-05
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    51   1e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    51   1e-05
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    51   1e-05
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    51   1e-05
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    51   1e-05
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    50   1e-05
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    50   1e-05
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    50   1e-05
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    51   1e-05
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    50   1e-05
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    50   1e-05
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    51   1e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    50   1e-05
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    50   1e-05
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    50   1e-05
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    50   2e-05
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    49   2e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    51   2e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    50   2e-05
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    50   2e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    50   2e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     50   2e-05
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    50   2e-05
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    49   2e-05
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    50   2e-05
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    50   2e-05
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    50   2e-05
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    50   2e-05
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    49   2e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    50   2e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    50   2e-05
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    50   2e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    50   2e-05
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    49   2e-05
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    50   2e-05
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    50   2e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    50   2e-05
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    50   2e-05
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    50   3e-05
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    50   3e-05
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    50   3e-05
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    50   3e-05
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    50   3e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    49   3e-05
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    49   3e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   3e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    50   3e-05
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    49   3e-05
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    50   3e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    49   3e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    50   3e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    50   3e-05
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    50   3e-05
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    50   3e-05
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    50   3e-05
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    49   3e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    49   3e-05
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    49   3e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    49   3e-05
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    49   3e-05
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    49   3e-05
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               49   3e-05
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    49   3e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    49   3e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    49   3e-05
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    49   3e-05
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    49   3e-05
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               49   3e-05
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               49   4e-05
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    49   4e-05
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    49   4e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    49   4e-05
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    49   4e-05
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    49   4e-05
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    49   4e-05
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    48   4e-05
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    49   4e-05
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    49   4e-05
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    49   4e-05
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    49   4e-05
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    49   4e-05
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    48   4e-05
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    49   4e-05
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    49   4e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    49   4e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    49   4e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    49   4e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    49   4e-05
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    48   4e-05
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    49   5e-05
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    49   5e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    49   5e-05
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    49   5e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    48   5e-05
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    49   5e-05
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    48   5e-05
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    49   5e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    48   5e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    48   5e-05
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     49   5e-05
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    46   5e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    49   5e-05
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    49   5e-05
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    49   5e-05
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    48   5e-05
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    49   5e-05
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    49   5e-05
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    49   6e-05
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    49   6e-05
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    49   6e-05
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    48   6e-05
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    49   6e-05
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    49   6e-05
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    49   6e-05
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    48   6e-05
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    49   6e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    49   6e-05
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    48   6e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    49   7e-05
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    49   7e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    48   7e-05
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    48   7e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    49   7e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    49   7e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    48   7e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    48   7e-05
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    49   8e-05
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    48   8e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    48   8e-05
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    47   8e-05
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    47   8e-05
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    48   8e-05
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    48   8e-05
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    47   8e-05
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    48   8e-05
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    48   8e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    47   8e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    48   9e-05
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    48   9e-05
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    48   9e-05
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    48   9e-05
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    48   9e-05
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    47   9e-05
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    48   9e-05
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    48   9e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    47   1e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    47   1e-04
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    47   1e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    47   1e-04
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    48   1e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    47   1e-04
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    47   1e-04
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    48   1e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    47   1e-04
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    47   1e-04
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    48   1e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    47   1e-04
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    47   1e-04
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    47   1e-04
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    47   1e-04
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    47   1e-04
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    47   1e-04
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    47   1e-04
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    47   1e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    47   1e-04
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    47   1e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    47   1e-04
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    47   1e-04
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    47   1e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    48   1e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    48   1e-04
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    47   1e-04
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    47   1e-04
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    47   1e-04
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    47   1e-04
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    47   1e-04
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    47   1e-04
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    47   1e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    47   2e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    47   2e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    47   2e-04
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    47   2e-04
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    47   2e-04
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    47   2e-04
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    47   2e-04
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    47   2e-04
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    47   2e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    47   2e-04
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    47   2e-04
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    47   2e-04
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    47   2e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    47   2e-04
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    47   2e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     47   2e-04
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     47   2e-04
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    47   2e-04
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    47   2e-04
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    46   2e-04
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    47   2e-04
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    46   2e-04
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    47   2e-04
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    47   2e-04
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    47   2e-04
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    46   2e-04
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    47   2e-04
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    47   2e-04
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    47   2e-04
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    46   2e-04
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               47   2e-04
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    46   2e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    46   3e-04
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    46   3e-04
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    46   3e-04
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    47   3e-04
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    47   3e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    46   3e-04
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    46   3e-04
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    46   3e-04
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    47   3e-04
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    46   3e-04
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    46   3e-04
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    46   3e-04
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    46   3e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    46   3e-04
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    46   3e-04
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    46   3e-04
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    46   3e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    45   3e-04
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    46   4e-04
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    45   4e-04
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    46   4e-04
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    46   4e-04
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    46   4e-04
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    46   4e-04
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    46   4e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    46   4e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    46   4e-04
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    45   4e-04
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    46   4e-04
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    45   4e-04
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    46   4e-04
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    46   4e-04
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    46   4e-04
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    46   4e-04
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    46   4e-04
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    46   4e-04
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    45   4e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    46   4e-04
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    45   4e-04
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    46   4e-04
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    46   4e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    45   5e-04
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    45   5e-04
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    45   5e-04
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    46   5e-04
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    45   5e-04
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    45   5e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    45   5e-04
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    45   5e-04
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    45   5e-04
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    45   5e-04
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    45   5e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    45   5e-04
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    45   5e-04
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    45   5e-04
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    45   6e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    45   6e-04
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    45   6e-04
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    45   6e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    45   6e-04
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    45   6e-04
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    45   6e-04
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    45   6e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    45   6e-04
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    45   6e-04
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    45   6e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    45   6e-04
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    45   6e-04
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    45   6e-04
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    45   6e-04
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    45   7e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    45   7e-04
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    45   7e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    45   7e-04
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       45   7e-04
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    45   7e-04
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    45   7e-04
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    45   7e-04
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    45   7e-04
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    45   7e-04
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    45   7e-04
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    45   7e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    45   7e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    45   8e-04
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    45   8e-04
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    45   8e-04
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    45   8e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    45   8e-04
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    45   8e-04
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       45   8e-04
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    45   8e-04
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    44   9e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    44   9e-04
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    45   9e-04
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    45   9e-04
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    45   0.001
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    45   0.001
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    45   0.001
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    44   0.001
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    44   0.001
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     44   0.001
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    44   0.001
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    44   0.001
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    45   0.001
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    44   0.001
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    44   0.001
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    44   0.001
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    44   0.001
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    45   0.001
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    44   0.001
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    44   0.001
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    44   0.001
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    44   0.001
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    44   0.001
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    44   0.001
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   0.001
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    44   0.001
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    44   0.001
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    44   0.001
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    44   0.001
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               44   0.001
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    44   0.001
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    44   0.001
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    44   0.001
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    44   0.001
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    44   0.001
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    44   0.001
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    44   0.001
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    44   0.001
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    44   0.001
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    43   0.002
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    44   0.002
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    44   0.002
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    44   0.002
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               44   0.002
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    44   0.002
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    44   0.002
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    44   0.002
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    44   0.002
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    44   0.002
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    44   0.002
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    44   0.002
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    44   0.002
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    44   0.002
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    43   0.002
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    44   0.002
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    43   0.002
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    44   0.002
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    44   0.002
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    43   0.002
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    43   0.002
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    43   0.002
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    43   0.002
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     43   0.002
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    43   0.003
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    43   0.003
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    43   0.003
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    43   0.003
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    43   0.003
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    42   0.003
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    43   0.003
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    43   0.003
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    43   0.003
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      43   0.003
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     43   0.003
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    43   0.003
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               43   0.003
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    43   0.003
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    43   0.003
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    43   0.003
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    42   0.003
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    43   0.003
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    43   0.004
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    43   0.004
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    43   0.004
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    43   0.004
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    43   0.004
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    42   0.004
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    43   0.004
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    43   0.004
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    42   0.004
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    42   0.004
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    42   0.004
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    42   0.004
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    42   0.004
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    42   0.004
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    42   0.005
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    42   0.005
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    42   0.005
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    42   0.005
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    42   0.005
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    42   0.005
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    42   0.005
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    42   0.005
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    42   0.006
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    42   0.006
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    42   0.006
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     42   0.006
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               42   0.006
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    42   0.006
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    42   0.006
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    42   0.006
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    41   0.006
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    41   0.007
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    42   0.007
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    42   0.007
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    41   0.007
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    42   0.007
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    42   0.007
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      42   0.008
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    42   0.008
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    42   0.008
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    41   0.008
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    42   0.008
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    42   0.008
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    41   0.008
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    41   0.009
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    41   0.009
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    41   0.009
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    42   0.009
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    41   0.009
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    41   0.009
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    41   0.010
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    42   0.010
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    41   0.010
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    40   0.011
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    41   0.011
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    41   0.011
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    41   0.011
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    40   0.011
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    41   0.012
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    41   0.012
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      41   0.012
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    41   0.012
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    41   0.013
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    41   0.013
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    40   0.013
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    41   0.013
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    41   0.014
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    41   0.014
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    41   0.014
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    40   0.015
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    41   0.015
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      41   0.015
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    41   0.015
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    40   0.015
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    41   0.015
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    40   0.016
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    40   0.016
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    40   0.016
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    40   0.017
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    40   0.017
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    41   0.017
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    40   0.018
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    40   0.018
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    40   0.018
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    40   0.018
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    40   0.018
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    40   0.019
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 40   0.019
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    40   0.019
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    40   0.020
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    39   0.020
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    40   0.022
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    40   0.022
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    40   0.022
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    40   0.023
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    40   0.023
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    40   0.023
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               40   0.025
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    40   0.025
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    40   0.026
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    40   0.028
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    40   0.028
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    39   0.029
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    40   0.030
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    39   0.032
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    40   0.032
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    40   0.033
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    40   0.035
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    39   0.036
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    39   0.036
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    39   0.039
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    39   0.039
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    39   0.040
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    40   0.041
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    39   0.042
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    39   0.044
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    39   0.045
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    39   0.048
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    39   0.048
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    39   0.052
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    39   0.053
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    39   0.056
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    39   0.056
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    39   0.057
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    39   0.057
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    39   0.057
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    39   0.058
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    39   0.058
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    39   0.061
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    39   0.063
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    39   0.063
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    39   0.063
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    38   0.067
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    38   0.067
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    39   0.068
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    39   0.069
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    39   0.071
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    39   0.072
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    38   0.074
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    39   0.075
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    38   0.078
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    38   0.081
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    38   0.082
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    38   0.084
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    38   0.086
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    38   0.087
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    38   0.088
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    38   0.091
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    38   0.093
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    38   0.095
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    38   0.096
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    38   0.099
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    38   0.11 
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    38   0.11 
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    38   0.11 
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    38   0.11 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    38   0.11 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    38   0.11 
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    38   0.11 
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    38   0.12 
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    38   0.12 
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    38   0.12 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    37   0.12 
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    38   0.12 
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    38   0.12 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    38   0.12 
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    38   0.13 
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    37   0.13 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    38   0.13 
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    38   0.13 
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    37   0.14 
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    37   0.14 
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    37   0.15 
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    37   0.15 
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    37   0.16 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    37   0.16 
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    37   0.17 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.17 
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               37   0.17 
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    37   0.17 
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    37   0.18 
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    37   0.18 
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    37   0.19 
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    37   0.19 
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    37   0.20 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    37   0.21 
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    37   0.22 
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    37   0.22 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    37   0.24 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.25 
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    37   0.25 
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    37   0.26 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    37   0.26 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    37   0.27 
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    36   0.27 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    36   0.27 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    37   0.28 
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    37   0.28 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    37   0.29 
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    36   0.30 
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    37   0.30 
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    36   0.36 
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    36   0.36 
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    36   0.37 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    36   0.38 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    36   0.39 
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    36   0.40 
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    36   0.44 
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    36   0.44 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    35   0.46 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    35   0.47 
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    36   0.48 
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    36   0.48 
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    36   0.48 
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    36   0.50 
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    36   0.51 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    36   0.52 
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    35   0.54 
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    35   0.56 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    35   0.57 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    36   0.58 
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    35   0.58 
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    35   0.58 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    35   0.60 
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    35   0.61 
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    35   0.68 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    35   0.69 
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    35   0.70 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    35   0.73 
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    35   0.76 
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    35   0.77 
Kwal_47.17314 s47 complement(347091..348356) [1266 bp, 421 aa] {...    35   0.79 
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    35   0.86 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    35   0.91 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    35   0.94 
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    35   1.0  
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    34   1.1  
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    35   1.1  
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    34   1.2  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    35   1.3  
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    33   1.3  
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    34   1.5  
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    34   1.5  
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    34   1.5  
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    34   1.5  
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    34   1.6  
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    34   1.6  
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    34   1.7  
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    34   1.7  
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    33   2.1  
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    33   2.3  
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             33   2.3  
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    33   2.3  
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    33   2.4  
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    33   2.5  
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    33   2.5  
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    33   2.5  
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    33   2.7  
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    33   3.0  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    33   3.1  
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    33   3.3  
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    33   3.4  
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    33   3.4  
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    33   3.7  
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    33   4.0  
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    32   4.4  
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    33   4.4  
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    32   4.7  
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    32   4.9  
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    32   5.1  
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     32   5.1  
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    32   5.3  
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      32   5.3  
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    32   5.3  
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    32   5.7  
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    32   5.9  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    32   6.8  
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    32   6.9  
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    32   7.2  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    32   7.3  
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    32   7.8  
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    32   8.9  
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    32   9.4  

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score = 1488 bits (3851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/790 (92%), Positives = 729/790 (92%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 GTPCPLRNFYVTRAMXXXXXXXXPKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQ 360
           GTPCPLRNFYVTRAM        PKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQ
Sbjct: 301 GTPCPLRNFYVTRAMQQQQQHQQPKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQ 360

Query: 361 TFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPPISHDF 420
           TFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPPISHDF
Sbjct: 361 TFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPPISHDF 420

Query: 421 NRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPIYLSSGTQTDDGFA 480
           NRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPIYLSSGTQTDDGFA
Sbjct: 421 NRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPIYLSSGTQTDDGFA 480

Query: 481 SSHALKLERTKXXXXXXXXXXXXXQHTGGSATRRFGQKLKVFTGERRSISPIKSRQNTGD 540
           SSHALKLERTK             QHTGGSATRRFGQKLKVFTGERRSISPIKSRQNTGD
Sbjct: 481 SSHALKLERTKSIASLSSSESVESQHTGGSATRRFGQKLKVFTGERRSISPIKSRQNTGD 540

Query: 541 SVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHSNGFKFRVXXXXXXXXXNVYPRF 600
           SVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHSNGFKFRV         NVYPRF
Sbjct: 541 SVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHSNGFKFRVSSSESIEEENVYPRF 600

Query: 601 XXXXXXXXXXXXXDLDQLQQDDTGAKNYYKSHSPVKVSATQGSRSSIQKRVQDLLKNSQD 660
                        DLDQLQQDDTGAKNYYKSHSPVKVSATQGSRSSIQKRVQDLLKNSQD
Sbjct: 601 SHSRSSSSASIVSDLDQLQQDDTGAKNYYKSHSPVKVSATQGSRSSIQKRVQDLLKNSQD 660

Query: 661 SPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKRNSSVVIKAG 720
           SPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKRNSSVVIKAG
Sbjct: 661 SPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKRNSSVVIKAG 720

Query: 721 QQVSKDAEEVXXXXXXXXXXXXXXXXXXHLKADKIIKEAETSAYEHSVDISDIEIDELEK 780
           QQVSKDAEEV                  HLKADKIIKEAETSAYEHSVDISDIEIDELEK
Sbjct: 721 QQVSKDAEEVPSSRKPAPPKPKRPKKPSHLKADKIIKEAETSAYEHSVDISDIEIDELEK 780

Query: 781 DFKRRFPSAV 790
           DFKRRFPSAV
Sbjct: 781 DFKRRFPSAV 790

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/803 (61%), Positives = 568/803 (70%), Gaps = 25/803 (3%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ  + IY  GT LTVGSH+ARIIKYLTSGGFAHIY+AEI PAD +S   +ACLKRVLV
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK SLNVLRAEVDAMKLLRGN+HVVSYIDSHAAKSG  DGSYEVFLLMEYCS GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL E EVLKI SDITQGIAAMHAL PPLIHRDIKIENVLISDD+TFKVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCGVIRPPKN QEF+YVQ+DILKNTTAQYR+PEMIDLYRG+PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEKVG+AAILHSRFQFP+YPQYSD LK+LIS MLSENP QRPNICQVLEEVSRIQ
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 GTPCPLRNFYVTRAMXXXXXXXX------PKIKFDHSASQPKLDSANNIINVPFKMSHNQ 354
             PCPLRNFY+ R+M              P ++  HS SQP++D  N  +  PFK + + 
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLKNGPVLTPFKHAQSS 360

Query: 355 PLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQP 414
            LR+++TF GA +N + N Y+P LKP   QPV  ++ + PF  I+    LQ K       
Sbjct: 361 ALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQ--- 417

Query: 415 PISHDFNRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPIYLSSGTQ 474
           P S DF RL R+QTF P +    RSS SP   GRGDIS I+SANPTNV+P+PIYL+S  Q
Sbjct: 418 PASADFQRLSRAQTFVPVTKSPKRSSASPSFGGRGDISMIVSANPTNVDPTPIYLNSSVQ 477

Query: 475 TDDGFASSHALKLERTKXXXXXXXXXXXXXQHTGGSATRRFGQKL-KVFTGERRSISPIK 533
           TD+  +  +  K                  Q TGGS +R FG++L KVFTGE+RSISPIK
Sbjct: 478 TDNPGSDLYLSKQNTRLSESSTSSSESIETQSTGGSFSRTFGRRLKKVFTGEKRSISPIK 537

Query: 534 SRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHSNGFKFRVXXXXXXXX 593
           SRQNTG+SV+SAFATLRRGFS GS K E  +K+N++D+++  S SNG+KFRV        
Sbjct: 538 SRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNGYKFRVTSSDSIEE 597

Query: 594 XNVYPRFXXXXXXXXXXXXXDLDQLQQDD-TGAKNYYKSHSPVKVSATQGSRSSIQKRVQ 652
            N    +             DLD LQ D  T AK YY+SHSPVK+S +  +RSSIQKRVQ
Sbjct: 598 ENSGFIYSHSRKASSTSIVSDLDSLQDDSGTNAKKYYRSHSPVKLSGSSDARSSIQKRVQ 657

Query: 653 DLLKNSQDSPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKRN 712
           +LLK+SQDSPVKK+AHGYG +S   E  E   Q T +     V ++      V+ P KR 
Sbjct: 658 NLLKSSQDSPVKKSAHGYGEVSE-KEDKESPEQFTGKPA---VAEARPIKRTVVPPPKRY 713

Query: 713 SSV-----VIKAGQQVSKDAEEVXXXXXXXXXXXXXXXXXXHLKADKIIKEAETSAYEHS 767
           SSV     V  A    +KD E+                   HLKAD+IIK   +S  E+ 
Sbjct: 714 SSVEFSSIVPTAKNTTAKDIEQ----PIRVHHKPKRPTKPPHLKADRIIKHG-SSTTENP 768

Query: 768 VDISDIEIDELEKDFKRRFPSAV 790
              SD+EI+ELEKDF+RRFPSAV
Sbjct: 769 RHSSDLEIEELEKDFQRRFPSAV 791

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/814 (50%), Positives = 520/814 (63%), Gaps = 47/814 (5%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           M+Q   + Y  GT LTVGSH+ARIIKYLTSGGFAHIY+AEI P D +S + IACLKRVLV
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLN LRAEVDAMKLL+ ++ VVSYIDSHAAKS +++GSYEVFLLMEYC+ GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL+E EVLKI S ++QG+AAMHALQPPLIHRDIKIENVLIS+D  FKVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCGVIRPPKNPQE NYVQHDILKNTTAQYR+PEMIDLYRG P++EKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GE AILHS+FQFP+YPQYSD LK+LIS +L ENP QRPNICQ+L EVSRIQ
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 GTPCPLRNFYVTRAMXXXXXXXXPKIK--FDHSASQPKLDSANNIINVPFKMSHNQPLRS 358
           G PCP++NFY+ R M         +      HS SQP++++    I +P  +   QP   
Sbjct: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEA----ITLPITL---QP-HP 351

Query: 359 TQTFAGAPVNAASNGYLPA-----------LKPLPIQPVSSSFTNGPFKFIEGNKALQSK 407
            +  A A V+ A+ G   +            +PLP +       N PF  ++ +  L  K
Sbjct: 352 QKVLASAQVSYANTGLTASPTAQQKLLYSRSQPLPAR-------NDPFLNLDKSNLLPPK 404

Query: 408 QTPHFQPPISHDFNRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPI 467
               F P + ++  +L      TP +T   R SVSP   GRGDISKI+ +NPT+V+    
Sbjct: 405 TKLEF-PELKYNKEQLNGIPATTPYAT--QRRSVSPVRNGRGDISKILKSNPTSVDRLSS 461

Query: 468 YLSSGTQTDDGFA--SSHALKLERTKXXXXXXXXXXXXXQHTGGSATRRFGQKLK-VFTG 524
           Y+ S TQT +     S    +                  Q TGGS TRR G KLK + + 
Sbjct: 462 YVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISN 521

Query: 525 ERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHSNGFKFR 584
           E R+ SPI+SRQNTG S RSAF+TLRRG S  +F S+  +KRNS+D S     S G K R
Sbjct: 522 EPRNTSPIRSRQNTGGSTRSAFSTLRRGTS-SNFSSDR-SKRNSVDFSVRRLGSGGNKVR 579

Query: 585 VXXXXXXXXXNVYPRFXXX---XXXXXXXXXXDLDQLQ-QDDTGAKNYYKSHSPVKVSAT 640
           V             +F                DL++ + +  + ++ Y ++HSP+K+SA 
Sbjct: 580 VSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSAN 639

Query: 641 QGSRSSIQKRVQDLLKNSQDSPVKKTAHGYGMLS--PGDEAAELASQLTNETM-LQNVHQ 697
           + SR+SIQKRV DLLKNSQDSPV+KTA  +G  S  P D AA+    ++++ + + NV  
Sbjct: 640 RESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQDHAAD--HTISDKVIDVHNVTS 697

Query: 698 STASTPKVLSPAKRNSSVVIKAGQQVSKDAEEVXXXXXXXXXXXXXXXXXXHLKADKIIK 757
           S       L    ++++VV    +  ++  E+                   HLK   ++ 
Sbjct: 698 SPVVQKATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVI 757

Query: 758 EAETSAYEHSVDISD-IEIDELEKDFKRRFPSAV 790
             +      +  +SD ++ID+LE+DFK+R+PSA+
Sbjct: 758 PKKGRYSNRANTLSDEVDIDDLEEDFKKRYPSAI 791

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/858 (45%), Positives = 478/858 (55%), Gaps = 121/858 (14%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MN     +Y+PGT LTVGSH A+IIKYLTSGGFA +Y+AEI P D  S A IACLKRV+V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK  LN LRAEVDAMKLL+ N+HVVSYIDSHAAKS V+  +YEVF+LMEYC  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRL+NRLQE E+L I     QGIAAMHALQPPLIHRDIKIENVLIS +  +KVCDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V GVIRPPKNPQEFNYVQHDIL NTTAQYR+PEMIDLYRG PI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GEAAILH+R+Q+PS+PQYSD LK+LI  ML E P+QRPNICQVLEEVSR+Q
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GTPCPLRNFYVTRAMXXXXXXXXPKIKFDHSASQ-------------------------- 334
             PCP+RNFY+ RAM              ++ +Q                          
Sbjct: 300 NRPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQNIQAMPNIVPLSNIKTT 359

Query: 335 PKLDSANNIINVPFKMSHNQPLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGP 394
           P LDSA+N +N   KM     LR TQ     P     N  +P  K   + P+S  FT   
Sbjct: 360 PNLDSASNFVNNNNKMEAMLQLR-TQKLETGP-----NFSIPLTKTKSV-PLSDDFT--- 409

Query: 395 FKFIEGNKALQSKQTPHFQPPISHDFNRLGRSQTFTPTSTLASRSSV--SPPLAGRGDIS 452
                   +L  K+   FQ P  H F  +  SQ+         R S+  SP      +  
Sbjct: 410 --------SLYYKELHPFQKP--HTFKSVEGSQS-------PQRKSIPFSPTPVNSNNYD 452

Query: 453 KIISAN-PTNVEPSPIYLSSGTQTDDGFASSHALKLER----TKXXXXXXXXXXXXXQHT 507
           ++ + N P N      Y+ S TQT D  A+   LKL+     +                T
Sbjct: 453 RVSTINRPNN------YVDSETQTLDSIAT---LKLKPSPTISNKTTGFSKESTVPENVT 503

Query: 508 GGSATRRFGQKLK-VFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELP--- 563
           GG   R    KLK V TGE R+ SPIKSRQNTGDS+RSAF  LR GF+G S  +      
Sbjct: 504 GGKIVRSLSSKLKRVITGESRNGSPIKSRQNTGDSIRSAFGMLRHGFTGSSINNSRSTSF 563

Query: 564 --NKRNSLDISSTSSHSNGFKFRVXXXXXXXXXNVYPRFXXXXXXXXXXXXXDLDQLQQD 621
             N  NS++   TSS SN     +             R              D DQ +++
Sbjct: 564 DNNNANSVNRRLTSSSSNPSSSNLNSDTKRKEELDKKRKLEHRRSMPPSILSDFDQHERN 623

Query: 622 D--TGAKNYYKSHSPVK--------------------VSATQGSRSSIQKRVQDLLKNSQ 659
           +  TG+++YY+SHSPVK                    ++  Q  + SIQ+RV +LL NS+
Sbjct: 624 NSRTGSRDYYRSHSPVKKTQTTPTTTTRPSLKSSNSDINIDQEKKESIQRRVHNLLNNSE 683

Query: 660 DSPVKKTAHGYGMLSPGDEAAELASQLTN-------ETMLQNVHQSTASTPKVLSPAKRN 712
           DS   K+A GYG  +  D  AE  ++ ++       E    N H S        S  K  
Sbjct: 684 DSLSYKSASGYGKYT--DTEAESTNRQSSVRITPITEERFNNYHSSNTMNDHTSSKDKPK 741

Query: 713 SSVVIKAGQQVSKDAEEVXXXXXXXXXXXXXXXXXXHLKADKIIKEAETSAYEHSVDISD 772
           S       + +                         +L++ K   E  +S  E +  I D
Sbjct: 742 SRPPRPPPKPL------------HLRTKIHNTRCSSNLQSRKPPMERISS--EATETIVD 787

Query: 773 IEIDELEKDFKRRFPSAV 790
           + +DELE DF++RFPS V
Sbjct: 788 VNVDELEADFRKRFPSKV 805

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/856 (44%), Positives = 479/856 (55%), Gaps = 114/856 (13%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MN     +Y+PGT LTVGSH A+IIKYLTSGGFA +YTAEI P D  + A IACLKRV+V
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK  LN LRAEVDAMKLL+ N+HVVSYIDSHAAKS V+  +YEVF+LME+C  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL+E E+L+I S   QGIAAMHALQPPLIHRDIKIENVLIS +  +KVCDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V GVIRPP+N QEFNYVQHDIL NTTAQYR+PEMIDLYRG PI+EKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GEA ILH+R+Q+P +PQYSD LK+LI  ML E P++RPNICQVLEEVSR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 GTPCPLRNFYVTRAMXXXXXXXX--------PKIKFDHSASQPKLDSANNIINVPFKMSH 352
             PCP+RNFY+ RAM                P  KF  +     +   +N+I V    SH
Sbjct: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPV----SH 355

Query: 353 NQPLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHF 412
              +R+T   +  P +   N      K + +Q V  S  + P K        ++K     
Sbjct: 356 ---VRTTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLK--------KTKSV--- 401

Query: 413 QPPISHDFNRL--------GRSQTFTPTSTLAS--RSSVSPPLAGRGDISKIISANPTNV 462
             P+S DF  L         +SQTF       S  R S+ PP +     S I+   PT  
Sbjct: 402 --PLSDDFASLYYRELHPFQKSQTFKSVENFQSPQRRSM-PPSSLPPANSIILDKTPTMN 458

Query: 463 EPSPIYLSSGTQTDDGFA-SSHALKLERTKXXXXXXXXXXXXXQHTGGSATRRFGQKL-K 520
            P+  Y+ S TQT D    S   L    T                +GG+  R    KL K
Sbjct: 459 RPNN-YVDSETQTTDIITMSGSKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKK 517

Query: 521 VFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHSNG 580
           V TGE R  SPIKSRQNTGDS RSA   LR GF+G S  +   N+  S D ++ SS++N 
Sbjct: 518 VITGESRGSSPIKSRQNTGDSTRSALGMLRHGFTGSSMNN---NRSASFDSNNGSSNNNS 574

Query: 581 FKFRVXXXXXXXXXNVYP-----------RFXXXXXXXXXXXXXDLDQLQQDD--TGAKN 627
              R+            P           +              D DQ ++ +  TG+++
Sbjct: 575 VNRRLGSSSTSSLSVFNPDTKRQEEIDKKQKLENRRSMPSSILSDFDQHERINSRTGSRD 634

Query: 628 YYKSHSPVK--------------------VSATQGSRSSIQKRVQDLLKNSQDSPVKKTA 667
           YY+SHSPVK                    ++  Q  + SIQ+RV +LLK+S+D    K+A
Sbjct: 635 YYRSHSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHNLLKSSEDPLTYKSA 694

Query: 668 HGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKRNSSVVIKAGQQVSKDA 727
            GYG  +  D            T   N H S   TP  ++  K  S          +KD 
Sbjct: 695 SGYGKYTDTD------------TETSNRHSSVRITP--ITEEKFKSRNKNGLSNNKTKDN 740

Query: 728 EEVXXXXXXXXXXXXXXXXXXHLKADKIIKEAETSAYEHSVDIS-------------DIE 774
           +                    HL+A+  I++  +S+  HS ++S             ++ 
Sbjct: 741 DR------HKSRPPRPPPKPLHLRAE--IQKVRSSSRLHSGELSSERISSDATETIVEVN 792

Query: 775 IDELEKDFKRRFPSAV 790
           +D+LE DF++RFPS V
Sbjct: 793 VDDLEADFRKRFPSKV 808

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/864 (44%), Positives = 476/864 (55%), Gaps = 128/864 (14%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MN     +Y+PGT LTVGSH A+IIKYLTSGGFA +YTAEI P D  S A IACLKRV+V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           P K  LN LRAEVDAMKLLR N+HVVSYIDSHAA+S V+  +YEVF+LME+C  GGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRLQE E+L+I S   QGI AMHALQPPLIHRDIKIENVLIS D  +KVCDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V GVIRPP+N QEFNYVQHDIL NTTAQYR+PEMIDLYRG PI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GEA ILH+R+Q+PS+PQYSD LK+LI  ML E P+QRPNICQVLEEVSR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GTPCPLRNFYVTRAMXX----------XXXXXXPKIKFD-----HSASQP-------KLD 338
             PCP+RNFY+ RAM                  P  KF       S +QP        + 
Sbjct: 300 NKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSINQPPNMMPVTHVS 359

Query: 339 SANNIINVPFKMSHNQPLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFI 398
           +  N+   P  ++ N     T   AG  V + SN   P +K   + P+S  F        
Sbjct: 360 TTPNLGTFPISINDNNKTEVT-AHAGLQVGSHSNLTSPLMKTKSV-PLSDEFA------- 410

Query: 399 EGNKALQSKQTPHFQPPISHDFNRLGRSQTFTPTSTLAS--RSSVSPPLA---GRGDISK 453
               +L  K+   FQ           +SQTF    +  S  R S+ PPL+      DI  
Sbjct: 411 ----SLYYKELHPFQ-----------KSQTFKSVESFQSPQRKSM-PPLSLTPVNNDIFD 454

Query: 454 IISA--NPTNVEPSPIYLSSGTQTDDGFASSHALKLERTKXXXXXXXXXXXXXQH--TGG 509
            +SA   P N      Y+ S TQT D  A  + LKL  T                   G 
Sbjct: 455 RVSAINRPNN------YVDSETQTIDNMAVPN-LKLSPTITSKSLSSTKEIAAPDNINGS 507

Query: 510 SATRRFGQKL-KVFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNS 568
              R    KL KV TGE R  SPIKSRQNTGDS+RSAF  LR GF+G S  +   ++  S
Sbjct: 508 KIVRSLSSKLKKVITGESRGNSPIKSRQNTGDSIRSAFGKLRHGFTGNSVNN---SRSAS 564

Query: 569 LDISSTSSHSNGFKFRVXXXXXXXXXNVYPRFXXXXXXXXXXXX---------------X 613
            D ++ + + N    R+           +P+F                            
Sbjct: 565 FDNNNVNGNGNNTNRRLVSSSTSS----FPKFNSDTKRKEESDKNQRLEKRRSMPPSILS 620

Query: 614 DLDQLQQDD--TGAKNYYKSHSPVK--------------------VSATQGSRSSIQKRV 651
           D DQ ++++  TG+++YY+SHSPVK                    V+  Q  + SIQ+RV
Sbjct: 621 DFDQHERNNSRTGSRDYYRSHSPVKKTQASAKTTSKPTLIPDNGNVNINQEKKESIQRRV 680

Query: 652 QDLLKNSQDSPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKR 711
            +LLK+S D    K+A GYG      +  ++ ++ +N       H S   TP      K+
Sbjct: 681 HNLLKSSDDPVTYKSASGYG------KYTDIGTETSNR------HSSVRITPITEEKFKK 728

Query: 712 N-----SSVVIKAGQQVSKDAEEVXXXXXXXXXXXXXXXXXXHLKADKIIKEAETSAYEH 766
                   +  K+  +                           L++ K+  E  +S  E 
Sbjct: 729 TLKDGVLDIKTKSNGKDKSRPPRPPPKPLHLRTEIQKIRNFSRLQSKKLPIERISS--EA 786

Query: 767 SVDISDIEIDELEKDFKRRFPSAV 790
           +  I D+ +D+LE DF++RFPS V
Sbjct: 787 TETIVDVNVDDLEADFRKRFPSKV 810

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/853 (44%), Positives = 472/853 (55%), Gaps = 107/853 (12%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MN     +Y PGT LTVGSH A+IIKYLTSGGFA +YTAEI P D  S A  ACLKRV+V
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK  LN LRAEVDAMKLL+ N+HVVSYIDSHAAKS V+  +YEVF+LME+C  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQ+RL+E E+L+I S   QGIAAMH LQPPLIHRDIKIENVLIS D  +KVCDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V GVIRPP+N QEFNYVQHDIL NTTAQYR+PEMIDLYR  PI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GEAAILHSR+Q+PS+PQYSD LK LI  ML E P+QRPNICQVLEEVSR+Q
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 GTPCPLRNFYVTRAMXXXXXXXX--PKIKFDHSASQPKLDSANNIINVPF--KMSHNQPL 356
             PCP+RNFY+ RAM          P + +    S  +L  A  +  +     M     +
Sbjct: 300 NEPCPIRNFYLLRAMGQNAQLASEPPSVTY---VSAQQLLPAQTLQGIKHLQSMVPVTHV 356

Query: 357 RSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPPI 416
           R+T           +N    ++ P+  QP S            GN  +++K  P     +
Sbjct: 357 RTTPNLGTLTKAITNNNQTESILPVRTQPESD--------LNLGNPLMKTKSVP-----L 403

Query: 417 SHDFNRL--------GRSQTF-------TPTSTLASRSSVSPPLAGRGDISKIISANPTN 461
           S DF  L         +SQTF       +P   L++ SS SP  +   D      A+ + 
Sbjct: 404 SDDFASLYYRELHPFQKSQTFKSVESFQSPQRKLSTPSSSSPVNSKNND-----RASTST 458

Query: 462 VEPSPIYLSSGTQTDDGFASSHALKLERTKXXXXXXX----XXXXXXQHTGGSATRRFGQ 517
           V+    Y+ S TQT D  A   AL L ++                    TGGS  R    
Sbjct: 459 VDRPNNYVDSVTQTIDNMA---ALNLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSS 515

Query: 518 KLK-VFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLD------ 570
           KLK V TGE RS SPIKSRQNTGDS+RSAF  LR G +G S  +   N+  S D      
Sbjct: 516 KLKKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSN---NRTISFDSNNGNG 572

Query: 571 --------ISSTSSHSNGFKFRVXXXXXXXXXNVYPRFXXXXXXXXXXXXXDLDQLQQDD 622
                   ++S+SS S+ F F               +              D D+ ++++
Sbjct: 573 NGNSVNRRLASSSSSSSNFNFDTKRQDDLDKK----QKLENRRSMPPSILSDFDKHERNN 628

Query: 623 --TGAKNYYKSHSPVK--------------------VSATQGSRSSIQKRVQDLLKNSQD 660
             TG+++YY+SHSPVK                    +   Q ++ SIQ+RV +LL NS+D
Sbjct: 629 SRTGSRDYYRSHSPVKKNQTTPKTASRTTLKSDSSDIDVKQVNKESIQRRVHNLLNNSED 688

Query: 661 SPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKRNSSVVIKAG 720
               K+A GYG  +  D  AE +          N H S   TP       +  +     G
Sbjct: 689 PLAHKSASGYGKYT--DVNAEAS----------NRHSSVRITPITEGKFNKYYNSGTLKG 736

Query: 721 QQVSKDAEEVXXXXXXXXXXXXXXXXXXHLKADKIIK---EAETSAYEHSVDISDIEIDE 777
           +    D  +                        ++     + E  + E +  I D+ +D+
Sbjct: 737 ETSRNDKHKSRPPRPPPKPLHLRTEIQNTRNFSRLQSRQPQMERISSEATETIVDVNVDD 796

Query: 778 LEKDFKRRFPSAV 790
           LE DF++RFPS V
Sbjct: 797 LEADFRKRFPSKV 809

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/847 (43%), Positives = 481/847 (56%), Gaps = 127/847 (14%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ   + Y  GT L VGSH+ +++KYL SGGFAH+Y+ EI P D   P  +ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK SLN LRAEVD+MK LRGN+ +VSYIDSHA KS V+ G YEV+LLMEYCSGGGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRLQE E+L I S ++QG+AAMHALQPPLIHRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V GVIR P+N +EFNYVQ+DI+KNTTAQYR PEMIDLYRG PI+EKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GE+AIL S+F+FP+YP+YSD +K+LIS ML  +P +RPNICQV+EEVSRIQ
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 GTPCPLRNFYVTRAMXXXXXXXXPKI-------KFDHSASQPKLDSANNI-------INV 346
           G PCP++NFY+ R M        P++       +    A+ P   S  ++       +  
Sbjct: 301 GIPCPIKNFYLLRMM---DKQEQPRVSPPPHVPQMTVPATVPTSVSTQHLPPQVVSNVQT 357

Query: 347 PFKMSHNQPLRSTQTFAGAPVNAASN---GYLPALKPLPIQPVSSSFTNGPFKFIEGN-- 401
           P K +  Q L         P+    +      PA K +P Q VS+  ++ PF  I+ +  
Sbjct: 358 PSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVP-QTVSNYTSSDPFSKIDRSAL 416

Query: 402 -----------KALQSKQTPHFQPPISHDFNRLGRSQTFTPTSTLASRSSVSPPLAGRGD 450
                      +A++  Q  + QP +      L RSQ+  P      R+SVSP   GRG 
Sbjct: 417 LSTSATMESLPRAMRIPQLEYQQPHL------LTRSQSVVP------RASVSPVRNGRGA 464

Query: 451 ISKIISANPTNVEPSPIYLSSGTQTDD-----GFASSHALKLERTKXXXXXXXXXXXXXQ 505
           IS I+++N T+++  P Y+ S TQT D     G + S    L R                
Sbjct: 465 ISSILASNRTSLD-RPKYVDSETQTSDHPSELGLSRS----LSRKSVASSLSSAESLEAT 519

Query: 506 HTGGSATRRFGQKL-KVFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPN 564
            TGGS TR+ G K+ KV TGE+R  S I+S QNTG+SV+SAF  LR+G S   F  +  +
Sbjct: 520 STGGSLTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSS 579

Query: 565 KRNSLDI------------SSTSSHSNGFKFRVXXXXXXXXXNVYPRFXXXXXXXXXXXX 612
           +++SL+              +TSS++   +            N Y               
Sbjct: 580 RKSSLEARKYRSTSGKSIPENTSSNTKSHRRSTSSFSFVPENNDY--------------- 624

Query: 613 XDLDQLQQDDTGAKNYYKSHSPVKVSATQGSRSSIQKRVQDLLKNSQDSPVKKTAHGYGM 672
             ++ +Q++        K  S ++ S++  + SSIQKRV+DL+ N+ D P + +A GYG 
Sbjct: 625 ELIEDIQKE--------KPKSSLRRSSSLKTSSSIQKRVKDLI-NADDIPNRSSATGYGK 675

Query: 673 LSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKRNSSVVIKAGQQVSKDAEEVXX 732
                      + +  +T + + H+S A+         R SS VI    +  K       
Sbjct: 676 Y----------TDIGRKTDISDHHKSNAN---------RKSSTVITPVHEAPKSKPA--P 714

Query: 733 XXXXXXXXXXXXXXXXHLKADKIIKEAETSAYEHSVDISDIEIDEL---------EKDFK 783
                           HLKA    K   TS  +  V   D + D +          K+F+
Sbjct: 715 PPKPAHLKPNLPPKPKHLKA----KSFRTSPAKSEVKEQDSDQDSVGSPFQSRKEMKEFE 770

Query: 784 RRFPSAV 790
           RRFPSA+
Sbjct: 771 RRFPSAL 777

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/479 (60%), Positives = 345/479 (72%), Gaps = 27/479 (5%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ     Y PGT LTVGSH A++I YLTSGGFA +Y+AEI PAD    + +ACLKRV+V
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLN LRAEVDAMKLLR N+HVVSYIDSHAAKS   +GSYEVFLLMEYC+GGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRLQE E+L I S +TQGIAAMHALQPPLIHRDIKIENVLIS    +KVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCGVIRPP+NPQEF YVQHD+LKNTTAQYR+PEMIDLYRG+PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GE AILHSRFQFP+ P YSD LK LI  ML ENP QRPN+CQVLE+VSR+Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 GTPCPLRNFYVTRAMXXXXXXXXPKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQ 360
           G  CP+RNFY+ RAM         ++++  S +QP L+    II+ P     +Q      
Sbjct: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRY--SRTQPVLNVP--IISQPVGFPMHQ------ 350

Query: 361 TFAGAPVNAASNGYLP--ALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPPISH 418
             +GAP+ ++++  +P  ++  L  +P S+            N   +S QTP      + 
Sbjct: 351 -ISGAPLGSSTSHIVPSNSVPILAARPRSAG----------SNGTGRSFQTPSTSSLSAK 399

Query: 419 DFNRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPIYLSSGTQTDD 477
                 R+ + +P ST     S SP   GRG+IS+I+ +N T+ +  P Y+ S TQT D
Sbjct: 400 SSQTFHRAASRSPVST---HLSTSPVRHGRGNISQIVESNRTSFD-RPRYVDSVTQTSD 454

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/805 (43%), Positives = 442/805 (54%), Gaps = 97/805 (12%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ     Y PGT LTVGSH  +IIKYLTSGGFA IYT EI P +  + ++ ACLKRV+V
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK  LN LRAEVDAMKLL+ N+HVVSYIDSHAA+S V  G+YEVFLLMEYC GGGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL E E+L I S   QG++AMHALQP LIHRDIKIENVLIS    FK+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VC  IRPP+NPQE  YVQHD+LKNTTAQYRAPEM+DLYRG PINEKSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GEAAILHSR+Q+P++P Y+D LK+LI   L E+P++RPNICQ+LEE+SRIQ
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 GTPCPLRNFYVTRAMXXXXXXXXPKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQ 360
           G PCP+ NFY++R +        P I        P   +A        K S +    S Q
Sbjct: 301 GIPCPINNFYLSRTINVQASLMNPIIT-------PTQQTA-------LKHSQSSATISDQ 346

Query: 361 TFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPPISHDF 420
           ++A  P+ ++ +      KP+ I+      + G                       S D 
Sbjct: 347 SYA-VPLASSRSSTTTGNKPILIETEIPDMSQG-----------------------SDDV 382

Query: 421 NRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPI-YLSSGTQTDDGF 479
               R   F  + TL + S  S P+   G + +  +++ +N   +   Y+ S TQT   F
Sbjct: 383 --YSRIHPFQKSQTLRTPSRSSSPIKYTGTLLQKSTSSNSNTSGNKSHYVDSETQT---F 437

Query: 480 ASSHALKLERTKXXXXXXXXXXXXXQH-TGGSATRRFGQKLK-VFTGERRSISPIKSRQN 537
           ++S       +              +H TGGS T+ F   LK V TGE R+ SPI+SRQN
Sbjct: 438 STSSRRLSRSSSVRSASSRSSDQLKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQN 497

Query: 538 TGDSVRSAFATLRRGFSGGS---------FKSELPNKRNSLDISSTSSHSNGFKFRVXXX 588
           TG S+RSAF  LR G +G +             + +       S      N  K R+   
Sbjct: 498 TGGSIRSAFDALRSGITGNTNSRVSSLASSVRNVSSSSKHSKHSDADDEPNKIKIRMKKA 557

Query: 589 XXXXX-XNVYPRFXXXXXXXXXXXXXDLDQLQQDDTGAKNYYKSHSPVKVSATQGSRSSI 647
                  N+Y  F                    +DT     Y S+SPVK+ +    R SI
Sbjct: 558 HRRSVPPNLYSDFYA-----------------NEDT--PKLYSSNSPVKLKSLSTQRESI 598

Query: 648 QKRVQDLLKNSQDSP-VKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVL 706
           Q RV+ LL+  ++ P   KTA GYG  +             +E +   V +     P   
Sbjct: 599 QNRVKALLETFEEEPSTIKTASGYGKYT------------DSEFITSPVPERGGRIPTPT 646

Query: 707 SPAKRNSSVVIK-AGQQVSKDAEEVXXXXXXXXXXXXXXXXXXHLKADKIIKEAETSAYE 765
           +  KR SSV+I    + +S                         +  D+ I    T    
Sbjct: 647 N--KRYSSVIINPVTEPISIRPSPPPKPKHLRPIPPPKPTRLSKIYPDERISSTATER-- 702

Query: 766 HSVDISDIEIDELEKDFKRRFPSAV 790
               I +++++ LEKDFKRRFPS +
Sbjct: 703 ----IVNLDVESLEKDFKRRFPSRI 723

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/599 (53%), Positives = 370/599 (61%), Gaps = 54/599 (9%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEIC-PADLSSPAKIACLKRVL 59
           MNQ   D  QPG  LTVGSH  +II+YLTSGGFA IY+ E+  P  +     +ACLKRV 
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQ--GSLACLKRVH 58

Query: 60  VPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLID 119
           VPDKPSLN LRAEVDAMK+L+G++HVVSYIDSHAAKS  HDG+YEV+LLMEYC  GGLID
Sbjct: 59  VPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLID 118

Query: 120 FMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFG 179
           FMN+RLQ RL E EVLKI S + QGI AMHAL PPLIHRDIKIENVLIS D  FKVCDFG
Sbjct: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178

Query: 180 SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKL 239
           SV GVIRPPKN  EFNYVQHDILKNTTAQYRAPEMIDLYR  P++EKSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238

Query: 240 CYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299
           CY+TTPFEKVGE AIL ++FQFPSYPQY+D LK+LIS MLSE+P QRPNICQVLEEVSRI
Sbjct: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298

Query: 300 QGTPCPLRNFYVTRAMXXXXXXXXPKIKFDHSASQPKLDSANNIINVPFKM-SHNQPLRS 358
           QG PCPL NFY+ R                HSASQP L  A +  +    M +H QP   
Sbjct: 299 QGVPCPLPNFYLERMKHGACT------PVHHSASQPALPLATHQFSTSTPMVTHPQP--- 349

Query: 359 TQTFAGAPVNAASNGYLPALKPLP--IQPVSSSFT---------------NGPFKFIEGN 401
                  P N  S        PLP  IQP++S+                   P   I+ N
Sbjct: 350 -------PANQMS--------PLPHGIQPITSNMVYMMHNTTPNIKDIPRENPAATIQKN 394

Query: 402 KALQSKQTPHFQPPISHD--FNR--LGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISA 457
            AL S         +S D  FNR  L  S TF   S +  RSS +P    R +I K +S 
Sbjct: 395 -ALYSMSGSEHLSALSSDMHFNRPQLENSHTF---SGVGPRSSSNPIKIPRNEIQKFLSG 450

Query: 458 NPTNVEPSPIYLSSGTQTDDGFASSHALKLERTKXXXXXXXXXXXXXQHTGGSATRRFGQ 517
            P      P Y+ S TQT D   S+ +                    Q TG S   R  +
Sbjct: 451 TPPTSAKKPTYVDSETQTGDIITSNKSGSRPFAMSLSPLSSPELFSEQSTGNSLLGRLSR 510

Query: 518 KLKVFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSS 576
           K        +  +P+KS+ + GD + S  ++  R  S  + +S   +KRNS D+SS  S
Sbjct: 511 KTIRSPTSDKGSNPLKSKSSVGDDLASLLSSPSRNLSFPA-QSSKSSKRNSADLSSRKS 568

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/813 (43%), Positives = 455/813 (55%), Gaps = 83/813 (10%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ    +Y  GT LTVG+HRA I KYLTSGGFA IY  EI P D  S + +ACLKRV+V
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           P K  LN LRAEVDAMKLL+ N+HVVSYIDS+A KS  ++GSYEV LLMEYC GGGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MN+RLQNRL E E+L I S   QG+A MHALQP L+HRDIKIENVL S +  FK+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCG IRPP+N QE +YVQHDILKNTTAQYR PEM+DLYRG PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GE AILHS+FQ+P++P YSD LK+LI  MLSENPT+RPNIC++LEE+S IQ
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 GTPCPLRNFYVTRAMXXXXXXXXPKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQ 360
           G PCP++NFY+ RA          +I+     + PK+ +A  I  +  +         TQ
Sbjct: 301 GVPCPIQNFYLIRAQQLAN-----QIQLQRQTTVPKIATAQPIQQLNAR---------TQ 346

Query: 361 TFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQ-SKQTPHFQPPISHD 419
           T     +N  +N  L  + P+ + PV S  T  P        AL+   + P F P +  D
Sbjct: 347 TMPI--INTKANTSL--VTPITV-PVLSENTRLP--------ALELDIKVPQFSPSLDKD 393

Query: 420 FNRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPIYLSSGTQTDDGF 479
                +   F  + TL + S  +     R  IS+  S + TN +   I     +Q D   
Sbjct: 394 M--YMKLHPFQKSGTLLTPSKTASVSPIRRYISRSPSRDNTNYD---IQRRRTSQYDHDQ 448

Query: 480 ASSHAL--KLERT---KXXXXXXXXXXXXXQHTGGSATRRFGQKLK-VFTGERRSISPIK 533
             S+ +   L RT   K              +TG S  ++F  K+K V TGE R+ SPI+
Sbjct: 449 NQSNYMGRSLSRTSSIKSTSALSFEGNLQGNNTGDSFAQKFTNKIKRVVTGESRNASPIR 508

Query: 534 SRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHSNGFKFRVXXXXXXXX 593
           SRQ+TG SVRSAF  +R  F+ GS ++       SLD ++ +S  N              
Sbjct: 509 SRQDTGGSVRSAFGAIRGAFT-GSMRAP------SLDNNTNNSMHNNSNNNTSRNSSYGR 561

Query: 594 XNVYPRFXXXXXXXXXXXXX-------------DLDQLQQDDTG--AKNYYKSHSPVKVS 638
            N+                              DL+ L+ ++ G  A  YY+SHSP K  
Sbjct: 562 HNIITNPIKEEDSRNMTKAKLAKRHTMPPGMLYDLENLEIENEGYHASEYYRSHSPTKPF 621

Query: 639 ATQGSRSSIQKRVQDLLKNSQDSPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQS 698
            T+ +R +IQ+RVQ+LL  S+  P+              E   + +  TN      + ++
Sbjct: 622 VTKTTRDNIQQRVQNLLSESEQ-PM--------------ERNNIDTHHTNAVSHSMIPRN 666

Query: 699 TASTPKVLSPAKRNSSVVIKAGQQVSKDAEEVXXXXXXXXXXXXXXXXXXHLKADKIIKE 758
             S  K    + R SSVVI   + +    ++                      +    KE
Sbjct: 667 LNSREK---DSLRYSSVVINPLEDIGSSPKKAPPLPFKPHHLRPKPPPKPTYLSKMFSKE 723

Query: 759 -AETSAYEHSVDISDIEIDELEKDFKRRFPSAV 790
              ++A E  V    +++D LE+DF++RFPS +
Sbjct: 724 RISSTATEQLV---TLDVDTLERDFRKRFPSTL 753

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/560 (52%), Positives = 370/560 (66%), Gaps = 27/560 (4%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ   D +QPGT LTVGSH+ +++KYLTSGGFA IY  E+   D S    +ACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHV 59

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK SLN LRAEVDAMKLLRGN+H+VSYIDSHA+KS +++GSYEV LLMEYCS GGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQ+RL+E EVL+I + + QGI AMHALQPPLIHRDIKIENVLI+++   KVCDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCGVIRPPKN  E +YVQHDILKNTTAQYRAPEMIDLYRG+ ++EKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GE AIL + FQFPSYPQYS+ LK+LI+ ML+ENP  RPN CQVLEEV RIQ
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 GTPCPLRNFYVTRAMXXXXXXXXPKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQ 360
           G PCP++NFY+ R++           +  HS SQP +        +P  +   Q      
Sbjct: 300 GQPCPVKNFYLERSLKQQIPS-----QLRHSVSQPMIAMNPQQAKIPIVIPQVQ------ 348

Query: 361 TFAGAPVNAASNGYL-----PALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPP 415
             +  P N  + GY+     PA +P  ++   ++      K +  + A    +T +F P 
Sbjct: 349 -NSVLPSNTMNMGYVTGAFQPASQPNEVRG-DTALRVSKAKLL--STACDWDKTQNFVP- 403

Query: 416 ISHDFNRLGRSQT-FTPTSTLAS-RSSVSPPLAGRGDISKIISANPTNVEPSPIYLSSGT 473
              ++N     ++   PTS+L + RSSVSP  +GRG+I+KII+ANP N++  P+Y+ S  
Sbjct: 404 -GSNYNSKASVESGHLPTSSLPTPRSSVSPVRSGRGNINKIIAANPINIK-RPVYVDSEM 461

Query: 474 QTDDGFASSHALKLERTKXXXXXXXXXXXXXQHTGGSATRRFGQKLKVFTGERRSISPIK 533
           QT D  +   A     +               +TG SA     Q     T ++ ++  + 
Sbjct: 462 QTTDLASLKKANSRPLSLSLSSLPSQESFSLHYTGISAVESSQQFQGPVTFDKNNLL-VN 520

Query: 534 SRQNTGDSVRSAFATLRRGF 553
           S+ NTGDS  S+   + R  
Sbjct: 521 SKSNTGDSKSSSPELINRTL 540

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  511 bits (1317), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 270/506 (53%), Positives = 333/506 (65%), Gaps = 41/506 (8%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ    +Y PG  L VGSH+A+I+KYLTSGGFA +Y  EI P D+ S + IACLKRV+V
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKS----GVHDGSYEVFLLMEYCSGGG 116
           PDK SLNV RAEV+AMKLLR N++VVSYIDSHAAKS    GV +GSYEVFLLMEYCSG G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVC 176
           LIDFMNTRLQNRL+E E+L I S ++QG+AAMHALQPPL+HRDIKIENVLIS+   FK+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFL 236
           DFGSVCGVIRPP N  E ++VQHDILKNTTAQYR+PEM+ L +  PINEKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           YK+CYYTTPFEK GE AILHSR+Q+P+YPQYSD+LK+LI  ML  +P++RPNICQV+EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SRIQGTPCPLRNFYVTRAMXXXXXXXX---------PKIKFDHSASQPKLDSANNII--- 344
           SR+QG PCPL+NFY+ RA+                 P +   HS S P L + NN I   
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS 360

Query: 345 NVPFKMS---------------HNQP--LRSTQTFAGAPVNAASNGYLPALKPLPIQPVS 387
           N+ F  +               +N P  L ++ T    P   A++   P +   P Q  +
Sbjct: 361 NINFLQNVNNSAIQTANTTSRINNNPYSLHNSSTLQNTPQTIAADRRYP-VSTAPKQQHN 419

Query: 388 SSFTNGPFKFIEGNKALQSKQTPHFQPPISHDFNRLGRS-------QTFTPTSTLASRSS 440
               N     I   K+L +         I+   N   R        ++ T  +   +   
Sbjct: 420 IPAYNNQINDITLQKSLSATMADAPVSTINISDNAFDRGLHLSELQKSVTALNNDMNHIY 479

Query: 441 VSPPLAGRGDISKIISANPTNVEPSP 466
                 GRG IS I+++NP +++ SP
Sbjct: 480 SQKQEGGRGKISSILNSNPNSLDQSP 505

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  509 bits (1312), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 251/406 (61%), Positives = 291/406 (71%), Gaps = 19/406 (4%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ    +YQPGT LTVGSH+ +++KYLTSGGFA IYT +I P D  +   +ACLKRV+V
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLN LRAEVD MKLLR N HVVSYIDSHAAK   ++GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQ RL+E E+L I S +TQGIAAMHAL PPL+HRDIKIENVL++    +KVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCG+IRPP N QE +YVQHDI+KNTTAQYRAPEMIDLYRG PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GEAAILH+ FQFP+YPQYSD LK LI++ML E P+QRPN  QVLEEVS +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 GTPCPLRNFYVTR---AMXXXXXXXXPKIKFDHSAS---QPKLDSANNIINVPFKMSHNQ 354
              CP+ NFY+               P+      AS   QP + + N + N P  +S N 
Sbjct: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMND 360

Query: 355 ---------PLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFT 391
                     + ST      P   A+N      + +P+QPV  S T
Sbjct: 361 IQMMNAINLKVNSTHNTGMIPPTMATN----MARTIPMQPVQKSQT 402

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  496 bits (1278), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/313 (73%), Positives = 261/313 (83%), Gaps = 1/313 (0%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ   D Y PGT L VGSH+ RIIKY+TSGGFA IYT EI P D    + IACLKRV+V
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLN LRAEVDAMKLLR N+HVVSYIDSHA+KS  ++GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL E EVL ITS + QGIAAMHALQPPL+HRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V G+IRPP NPQE  YVQHD+LKNTTAQYR+PEMID YRG PI+EKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEKV-GEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299
           YYTTPFEK  GEAAIL +R+++P++P YS+ LKHLI  ML ENP QRPNI QV+EE+S++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QGTPCPLRNFYVT 312
           Q  PCP+ NFY+ 
Sbjct: 301 QNVPCPIVNFYLV 313

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  504 bits (1297), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 256/442 (57%), Positives = 306/442 (69%), Gaps = 39/442 (8%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ   D    GT+LTVG+H  +I+KYLTSGGFA IY  EI    L + + +ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK SLN+LRAEVDAMKLL  N+HVVSYIDSHA +S  +DG+YEVFLLMEYC GGGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL E E+L I S  TQGIA MHAL PPL+HRDIKIENVL+S    +KVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V GVIRPP+N QE  YVQHDI+KNTTAQYR PEM+DLYRG PI+EK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK+GE AILH+RFQFPS+P YSD LK+LI  ML E+P+ RPN+CQVLEEVSR+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 GTPCPLRNFYVTRAMXXXXXXXXPKIKFDHSASQPKLD-------SANNIINVPFKMSHN 353
             PCP+RNFY+ RAM         K+K       P+L         A+N+ N    M   
Sbjct: 301 NVPCPIRNFYLLRAME--------KVKLSTEIDYPQLQLQKLRNAQADNLSN---PMIKP 349

Query: 354 QPLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQ 413
            P+    TF+G       NG +   + LP   VS++          G++   + + P  Q
Sbjct: 350 MPIAQRPTFSG-------NGMVNNNRTLPTVMVSNNVIGN------GSQVWDNSKPPEPQ 396

Query: 414 PPISHDFNRLGRSQTFTPTSTL 435
           P        + +S++F  +STL
Sbjct: 397 P--------IPQSRSFVKSSTL 410

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 64/150 (42%), Gaps = 14/150 (9%)

Query: 644 RSSIQKRVQDLLKNSQDSPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTAS-- 701
           R SIQ RVQ LL N   + VKK+A GYG  +  DE +   + +   T    V        
Sbjct: 550 RKSIQLRVQHLLDNMSSNEVKKSAQGYGKYT--DELSSTGTNIPKVTPDSPVLADLIDFN 607

Query: 702 -TPKVLSPAKRNSSVVIKAGQQVSKDAEEVXXXXXXXXXXXXXXXXXXHLKADKIIKEAE 760
             P +  P+ +N   + K+G+       +                     + D+I  +A 
Sbjct: 608 DVPTIRIPSDKNQ--LSKSGKIKPAPPPKPKKLRSNKKISTLSALRLEPKQNDRITSDA- 664

Query: 761 TSAYEHSVDISDIEIDELEKDFKRRFPSAV 790
           T    H      + +D+LE+DFKRRFPSAV
Sbjct: 665 TDVLMH------LNVDDLEEDFKRRFPSAV 688

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  501 bits (1289), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 229/315 (72%), Positives = 261/315 (82%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ    IY PGT L+VGSH+ARIIKYLTSGGFA +YTAEI P D    + I CLKRV+V
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLN LRAEVDAMKLLR N HVVSYIDSHAAK   + GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL E E+L I S ++QG+AAMHALQPPL+HRDIKIENVL++    +K+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCG+IRPP NPQEF YVQHDI+KNTTAQYR+PEMI+L +G PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GE AILH+ FQFP++P YSD +K LI   L+  P+QRPNI Q+LEEVS+IQ
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 GTPCPLRNFYVTRAM 315
             PCP+ +FY+ R +
Sbjct: 301 NVPCPIPDFYLQRKL 315

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  504 bits (1298), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/316 (71%), Positives = 267/316 (84%), Gaps = 1/316 (0%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MN    + +  G  LTVGSH A++IKYLTSGG+A +Y  EI P+D    + IACLKRV+V
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLN LRAEVDAMKLL+ N+HVVSYIDSHA+KS +++G+YEVF+LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MN+RLQ+RL E E+L I S  +QGIAAMH LQP L+HRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCG++RPPKN QEFN+V HDI+KNTTAQYR+PEM+DL +G PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKV-GEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299
           YYTTPFEK  GEAAIL +RFQ+PSYP YSD LK+LI  MLS+NP+ RPN+CQVLEEVSR+
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QGTPCPLRNFYVTRAM 315
           QG PCP+RNFY+ RAM
Sbjct: 301 QGIPCPIRNFYLLRAM 316

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/296 (28%), Positives = 136/296 (45%), Gaps = 54/296 (18%)

Query: 507 TGGSATRRFGQKLK-VFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNK 565
           TG S  R+   KLK V TGE      IKSRQNTGDS+RSA  ++R GF+G +  +   + 
Sbjct: 526 TGSSLVRKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASY 580

Query: 566 RNSLDISSTSSHSNGFKFRVXXXXXXXXXNVYPRFXXXXXXXXXXXXXDLDQLQQD--DT 623
            N   +SS + H +                  PR+             D+++ ++   +T
Sbjct: 581 DNGKRLSSVNLHMHSAILEQDDSDEFEM----PRYNSVSSNTLK----DVEEHERRTVNT 632

Query: 624 GAKNYYKSHSPVKVSATQGSRSSIQKRVQDLLKNSQDSPVK--KTAHGYGMLSPGDEAAE 681
            ++ YY+S SPV++S  +  ++SIQKRVQDLLKN++++     +TA GYG  +  ++  +
Sbjct: 633 SSREYYRSQSPVRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKD 692

Query: 682 LASQLTNETMLQNVHQSTASTPKVLS-------PAKRNSSVVIKAGQQVSKDAEEVXXXX 734
             S    ++ +   +QSTA+   +         P KR+S       +     +  V    
Sbjct: 693 EIS--PTKSRVAQFNQSTAALASLSGKRKKPPVPYKRDSLKPTPPAKPAFLSSRPVASS- 749

Query: 735 XXXXXXXXXXXXXXHLKADKIIKEAETSAYEHSVDISDIEIDELEKDFKRRFPSAV 790
                                     ++A +  VD+S   +D++EKD +RRFPS V
Sbjct: 750 -----------------------RVSSNATDMLVDLS---VDDIEKDIRRRFPSTV 779

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  496 bits (1278), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/315 (71%), Positives = 264/315 (83%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ     Y  G  L VG H A I+KYLTSGG+A +Y A+I P D  + + I CLKR++V
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK SLN  RAEVDAMKLLR   HVVSYIDS+AAKSG+H+G+YEV LLME+C+ GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRLQE E+L I S +TQG+AAMH+L+PPL+HRDIKIENVLIS+   +K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCGVIRPP + QEFN+VQHDILKNTTAQYRAPEMIDL R  PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GEAAILHSR+++ +YP YSD+LK+LI  ML+  P+QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 GTPCPLRNFYVTRAM 315
           G PCP++NFY+ RA+
Sbjct: 301 GIPCPIKNFYLERAI 315

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  494 bits (1272), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 224/315 (71%), Positives = 265/315 (84%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MN      Y PGT L+VG+H A+I+KY+ SGGFA +Y+AE+ PAD  +     CLKRV++
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           P+K  LN LRAEV+AMKLL+G++HVV YIDSHAA+S + +G+YEVFLLME+C+ GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL+E E+L I S +TQGIAAMHALQPPLIHRDIKIENVLIS D  +KVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V G IRPP+NPQEF +VQHDILKNTTAQYR+PEMIDLYR   I+EKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AILHSR+QF ++P YSD LK+LIS+MLS+ P QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 GTPCPLRNFYVTRAM 315
           G   P+RNFY+ RAM
Sbjct: 301 GVSSPMRNFYLLRAM 315

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 619 QQDDTGAKNYYKS-HSPVKVSATQGSRSSIQKRVQDLLKNSQDSPVKKT 666
           Q+  TG  N   +  S  ++ +   ++ SIQK+VQ LLK ++DSP  K+
Sbjct: 553 QRSPTGGANVPTTPDSLARIKSNPDTKESIQKKVQSLLKAAEDSPKNKS 601

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  486 bits (1252), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 324/838 (38%), Positives = 436/838 (52%), Gaps = 99/838 (11%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ +   Y PG  + VGSH+A+I+KYLTSGGFA IY+ EI P D  + + IACLKRV+V
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           P+K  LNVLR EVDAMKLL+ N+HVVSYIDS+AAKS   +GSYEVFLLMEYC  G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNT+L+ RLQE EVL I + + QGIAAMH L PPLIHRDIKIENVLIS D  FKVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKS---DIWALGVFLY 237
           VCG+IRPP+NPQE  YVQHD++KNTTAQYR+PEMIDL +G+PI  K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVS 297
            L +YT  F +  E AIL+ R+Q+P+YP YSD LK+++  +LS +P +RPNICQ+LEE+S
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 RIQGTPCPLRNFYVTRAMXXXXXXXXPKIKFDHSASQPKLDSA---NNIINVPFKMSHNQ 354
           +IQ  PCP+ NFY+ R+         P + F  + +    D +      I V  ++S  +
Sbjct: 298 KIQNIPCPIDNFYLERSRHQGAVSVMP-VNFSRANTTQFTDQSAKETTAIRVGKEISPLK 356

Query: 355 PLRSTQTFAGAPV----NAASNGYLPALKPLPIQPVSSSFTNGPF--KFIEGNKALQSKQ 408
           P  S    +  PV        N +     P PI  VS+     P      +GN  L++  
Sbjct: 357 PQLSPIKSSYGPVLVMTKTTPNSFNSHHTPPPIGIVSNKTIAKPLYNSLEDGNNGLENHY 416

Query: 409 TPHFQPPISHDFNRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPIY 468
                P IS+  N+                         R      I A  +    +  Y
Sbjct: 417 LSSSVPAISYLANQHANDNI-------------------RNTTKLNIPAQNSTGSKNKTY 457

Query: 469 LSSGTQTDDGFASSHALKLERTKXXXXXXXXXXXXXQHTGGSATRRFGQKLK-VFTGERR 527
           + S TQT +  +  H   L                  +TG S   R G +L+ V T +  
Sbjct: 458 VDSETQTLEEPSLQHTRILPHI---------STDRTDNTGNSIVSRLGVQLRNVITNDSS 508

Query: 528 SISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHSN--GFKFRV 585
           + S I + Q TG+S++SA  +L+   SG      + N   +L + +  +H    G  + +
Sbjct: 509 ASSSIDTVQETGNSIKSAIESLKNSVSG------MANNVKALSVENARNHLERLGSSYSI 562

Query: 586 XXXXXXXXXNVYPRFXXXXXXXXXXXXXDL----------DQLQQDDT----GAKNYYKS 631
                    N  P                           D+ +  DT      K  ++S
Sbjct: 563 GSNNNIAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENELYDTLHLPDPKTSFQS 622

Query: 632 HSPVKVSATQGSRSSIQKRVQDLLKNSQDSPVKKTAHGYG-------MLSPGDEAAELAS 684
            SP+K +  +  ++SI+KRV +LLKN++DSPVKKTA GYG       M+SP +    L  
Sbjct: 623 PSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPKMVSPTNPHYHLVR 682

Query: 685 QLTNETMLQNVHQSTASTPKVLSPAKRNSS---VVIKA--------GQQVSKDAEEVXXX 733
           Q            S + TP +LS   R SS   VV+ A        G+  +K        
Sbjct: 683 Q-----------NSVSQTPLILS--ARGSSGHPVVVPALINRDNDNGKYPAKSKAPPVVP 729

Query: 734 XXXXXXXXXXXXXXXHLKADKIIKEAETSAYEHSVD-ISDIEIDELEKDFKRRFPSAV 790
                          HL + KI K+  T+      D +SD  +DELEK FK+R+PS V
Sbjct: 730 KKPDHLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAVDELEKSFKQRYPSTV 787

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  481 bits (1238), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 259/314 (82%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ     Y  GT+LTVGSH+  I+KYLTSGGFA +Y+A I P D  S + IACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLN LRAEVDAM+LLR N++VVSYIDSHAAK+ +H+GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL E E+L+I S +TQG+AAMHALQPPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCGVIRPP+NPQE +YVQ DI KNTTAQYR+PEM+D++RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GE AIL   F+FP YP YS+ L+ LI  +L +NP QRPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 GTPCPLRNFYVTRA 314
             PCP+ +  V +A
Sbjct: 301 NVPCPISDIQVPQA 314

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  474 bits (1220), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 258/314 (82%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ     Y  GT+LTVGSH+  IIKYLTSGGFA +Y+A I P D  S + +ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLN LRAEVDAM+LL+ N++VVSYIDSHAAK+ +H+GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL E E+L+I S +TQG+AAMHALQPPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCG+IRPP+N QE +YVQ DILKNTTAQYR+PEMID +RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AIL  +F+FP YP YS+ LK LI  +L ++P  RPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 GTPCPLRNFYVTRA 314
             PCP+ +  V +A
Sbjct: 301 NVPCPINDIQVVQA 314

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  477 bits (1227), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/313 (69%), Positives = 252/313 (80%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ     Y PGT+L VG H+  IIKYLTSGGFA IY  ++ P +  +   +ACLKRV+V
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           P+K  LN LRAEV+AM+LL+G  HVV YIDS+AA+S  +DG+YEV  LME+C GGGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL+E EVL I + +TQGI AMH+L PPLIHRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V G+IRPPKN +EFN+VQ DI+KNTTAQYR PEM+DLYRG PINEKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFE  GE AILH+R+Q+P YP YS  LK+LI  ML E P QRPN+CQVLEEVS +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 GTPCPLRNFYVTR 313
           G PCPL NFY+ R
Sbjct: 301 GIPCPLPNFYLQR 313

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  472 bits (1214), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 210/308 (68%), Positives = 258/308 (83%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ     Y  GT+LTVGSH+  IIKYLTSGGFA +Y+A I P D  + + +ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK SLN LRAEVDAMKLLR N++VVSYIDSHAAK+ +H+GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL E E+L+I   +TQG+AAMHALQPPLIHRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCGVIRPP+NPQE +YV+ D+LKNTTAQYR+PEM+D++RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GE AIL+ +F+F  YP YS+ L++LI  +L +NP+QRPN+ Q+L++++ +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 GTPCPLRN 308
             P P+R+
Sbjct: 301 NAPYPIRD 308

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  471 bits (1213), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 285/697 (40%), Positives = 380/697 (54%), Gaps = 67/697 (9%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           M+Q   D Y+ GT+L V SH   I  YLTSGGFA +YTA I     +   ++ CLKRV+V
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           P+K SLN+LRAEVDAMK+L+ N+++VSYIDSHA +    + SY V LLMEYCSG GL+DF
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MN RL+ RL+E E+LKI +D++QG+  MH LQPPL+HRDIKIENVL+S D  FK+CDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V GV+R P + +EF Y+Q+DILKNTTAQYR+PEM++L  G+PINEKSDIWALG+ LYKLC
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFE+ G  AI+  +F +P+YPQY+DSLK++I  +LS NP QRPNICQ+LEE+ RIQ
Sbjct: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300

Query: 301 GTPCPLRNFYVTRA-----MXXXXXXXXPKIKFDHSASQPKLDSANNIINVPFKMSHNQP 355
               PL NFYV RA     M        P +K+               ++ P   S + P
Sbjct: 301 HKSSPLPNFYVQRAMSSLQMDTTQPHRIPILKYTQ-------------MSKPVISSQSSP 347

Query: 356 LRSTQTFAGAPVNAASNGYLPALKPLP-IQPVSSSFTNGPFKFIEGNKA---LQSKQTPH 411
            +  QTF+               K  P IQP  S+       ++ G+ +   L+S  +  
Sbjct: 348 SKHCQTFSQ--------------KDYPYIQPNLSNSARAKDYYLGGSSSTDTLESSLSKQ 393

Query: 412 FQPPISHDFN------RLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIIS-ANPTNVEP 464
                 +D N           +  TP    A +   SP +     ++ + S  +  +   
Sbjct: 394 LSEDRVYDVNVNTMDSHCTYRRKLTPNYDHALKKGSSPSINDNSTLNNMTSLKHEHSFNS 453

Query: 465 SPIYLSSGTQTDDGFASSH-ALKLE------RTKXXXXXXXXXXXXXQHTGGSATRRFGQ 517
              Y+         F +S+ AL L       R                 TGGS  +  G 
Sbjct: 454 REAYIHPDFSGSKHFITSNDALNLNCRTPRSRDSSINSNSSVDSISRNSTGGSLIKSLGT 513

Query: 518 KLKVFT-GERRSISPIKSRQNTGDSVRSAFATLRRGFS--GGSFKSELPNKRNSLDISST 574
           K+K+ T G +RS SPIKSRQNTGDS+RSAF  +R+G +       S     RNS      
Sbjct: 514 KIKLTTTGGKRSQSPIKSRQNTGDSIRSAFNKVRQGINLRSSRISSNDSVVRNSEQFGGI 573

Query: 575 SSHSNGFKFRVXXXXXXXXXNVYPRFXXXXXXXXXXXXXDLDQLQQDDTGAKNYYKSHSP 634
              SN  K++              R                     D T       S+ P
Sbjct: 574 PELSNDNKYQFDTTSKN-------RHEYNSLSRKLSLSSQKQNSLNDST-------SNDP 619

Query: 635 VKVSATQGSRSSIQKRVQDLLKNSQDSPVKKTAHGYG 671
           + +     ++ SI+ RVQ L+K+S D+ V  +AHGYG
Sbjct: 620 IILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYG 656

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  470 bits (1210), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 261/315 (82%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ    +Y P T +TVGSH A+I+KYL SGG+A +Y+A + P D S    IACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDK SLN LRAEVDA+K+LR  ++VVSYIDSHA+K   H GSYEVF+LMEYCSGG LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           +NTRL+NRL+E E+L I + +  G+A MH LQP LIHRDIKIEN+LIS++  +KVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCGVIRPP++ +E  Y+QHDI+KNTTAQYR+PEM+DL +GY INEKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GE AIL S+FQ+P+YP YSDSLK++I  +LS +P +RPNICQ++EE+SR+Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 GTPCPLRNFYVTRAM 315
           G   P++NFY++RA+
Sbjct: 301 GIVPPMKNFYLSRAL 315

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 1/52 (1%)

Query: 507 TGGSATRRFGQKLK-VFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGS 557
           TG S  R   +KLK V TGE+RS+SP++SRQNTG S RS F  L  GF+GG+
Sbjct: 500 TGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTGGN 551

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 26/37 (70%)

Query: 635 VKVSATQGSRSSIQKRVQDLLKNSQDSPVKKTAHGYG 671
           +K+  T+ ++ SI++RV++LL  S+D    +TA GYG
Sbjct: 602 IKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYG 638

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  465 bits (1196), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 210/314 (66%), Positives = 253/314 (80%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ     Y  GT LTVGSH+  IIKYLTSGGFA +Y+  I P D  +   +ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLN LRAEVDAM+LL+ N++VVSYIDSHAAK+ + +GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MNTRLQNRL E E+L+I S +TQG+AAMHALQPPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           VCG+IR P+N QE +YVQ DILKNTTAQYR+PEMID++RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GE AIL  +F+FP YP YS+ LK LI  +L +NP  RP++ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 GTPCPLRNFYVTRA 314
             PCP+ +    +A
Sbjct: 301 NVPCPINDIQTVQA 314

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  461 bits (1187), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 253/315 (80%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MNQ     Y  GT LTVGSH+ +IIKYLT+GGFA IY   I P D  S   IACLKRV+V
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
           PDKPSLNVLRAEVDAMKLLR N+ VVSYIDSHAAKS   +G+YEVFLLMEYC  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           +N+RLQNRL+E EV+ I   ++QG+AAMHALQPPL+HRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
           V G IRPP NPQE   VQ+DI++NTTAQYR+PEMID+ RG+PI+EKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           YYTTPFEK GEA IL SR++FP++P YSD L+HLIS +L+  P  RPNI  V++E+S ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 GTPCPLRNFYVTRAM 315
              CP+ NFY+   M
Sbjct: 301 NISCPIINFYLKPNM 315

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  466 bits (1198), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 231/424 (54%), Positives = 295/424 (69%), Gaps = 44/424 (10%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAK-----IACL 55
           MNQ     Y+ G  L +G+H+  I KYL  GGFA +Y+  +     SS A+     +ACL
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVID---SSNARNELGTMACL 57

Query: 56  KRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGG 115
           KRV+VPDK  LN LRAEVDAMKLL+GN+++VSYIDSHA +S +  G YEVFLLMEYCS G
Sbjct: 58  KRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRG 117

Query: 116 GLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKV 175
           G+IDF+NTRL +RLQE E+LKI SD+ QG+AAMH LQPPLIHRDIKIENVLIS++  +K+
Sbjct: 118 GVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKI 177

Query: 176 CDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVF 235
           CDFGS C V+RPPK PQE  ++ HDI+ NTTAQYR+PEMID Y GYPI+EKSDIWALGVF
Sbjct: 178 CDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVF 237

Query: 236 LYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEE 295
           LYKLCYYTTPFEK GE AIL+ +FQFPSYPQYSD ++++I+ ML+++P +RPNICQVLE+
Sbjct: 238 LYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297

Query: 296 VSRIQGTPCPLRNFYVTRAMXXXXXXXXPKIKFDHSASQP-KLDSANNIINVPFKMSHNQ 354
           VS++QG PCP+ NF +TR            IK  +S +   K  S N+  N  F    N 
Sbjct: 298 VSKLQGVPCPIENFMLTR------------IKLQNSRNNSNKSTSLNDTTNNSF----NN 341

Query: 355 PLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQP 414
            L   Q  + +P N+++               +S+F++         K+L    TP+ +P
Sbjct: 342 ELALDQCNSLSPTNSSTRR-------------NSTFSDT------KRKSLMEADTPYLKP 382

Query: 415 PISH 418
           PIS+
Sbjct: 383 PISN 386

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 29/40 (72%), Gaps = 1/40 (2%)

Query: 633  SPVKVSATQGSRSSIQKRVQDLLKNSQ-DSPVKKTAHGYG 671
            S +++ +   ++  I+KRV +LLKNS+ D+ V +TAHGYG
Sbjct: 1196 SSLRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYG 1235

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 518 KLKVFTGERRSI-SPIKSRQNTGDSVRSAF 546
           K+KV T    S  SP+ SRQNTGDS++SAF
Sbjct: 854 KIKVSTDSFSSTASPLSSRQNTGDSIKSAF 883

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  443 bits (1140), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 200/303 (66%), Positives = 244/303 (80%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNV 68
           Y+PGT +TVGSH   I+KYLTSGG+A IY+A+I PAD      +A LKRV+VPDK  LN 
Sbjct: 9   YEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNT 68

Query: 69  LRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNR 128
           LRAEVDAMK L+ ++++VSYIDSHAAKS   DG+YEVFL+MEYCS GGLIDFMNTRLQNR
Sbjct: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128

Query: 129 LQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPP 188
           L E E+L I   I+QG+AAMH LQPPLIHRDIKIENVLIS+D  +K+CDFGSV G IRPP
Sbjct: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188

Query: 189 KNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEK 248
           K P+E  YV+HDI+ +TTAQYRAPEM+DL +G+ +N+KSDIWALGVFLYKLCYYTTPFE+
Sbjct: 189 KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ 248

Query: 249 VGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTPCPLRN 308
            GEA IL+   +FP YP YSD++K LI  ML++NP  RPNI Q+++ VS++    CP+ N
Sbjct: 249 TGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIPN 308

Query: 309 FYV 311
            +V
Sbjct: 309 IHV 311

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  312 bits (799), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 159/312 (50%), Positives = 202/312 (64%), Gaps = 13/312 (4%)

Query: 11  PGTELTVGSHRARIIKYLTSGGFAHIYTAEICP--ADLSSPA------KIACLKRVLVPD 62
           PGT + VGSH+  I+KYL  GGFAHIY  +      +L +P+       +ACLKRVLV D
Sbjct: 34  PGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTD 93

Query: 63  KPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGS--YEVFLLMEYCSGGGLIDF 120
           +  LN LR EV+ MK L+ + ++V Y DS+A++    DGS  YEV LLME C    L+D+
Sbjct: 94  ENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRR--RDGSPGYEVLLLMELCPNKSLLDY 151

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MN RL  +L E EVLKI  D+T+ +A MH L  PLIHRDIKIENVL+  +  FK+CDFGS
Sbjct: 152 MNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGS 211

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
                      Q+   + ++I  +TT QYRAPEMIDLYR  PI+EKSDIWALG+FLYKL 
Sbjct: 212 TSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLL 271

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           +YTTPFE  G+ AILHS++  P+   YS  L +LI  ML+ENP  RPNI QV+ +V  I 
Sbjct: 272 FYTTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIM 330

Query: 301 GTPCPLRNFYVT 312
               P  + Y T
Sbjct: 331 KVDVPFEDKYQT 342

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  310 bits (794), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 159/333 (47%), Positives = 206/333 (61%), Gaps = 26/333 (7%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP--ADLSS---------- 48
           +N S  + + PG  + VG H+  IIKYL  GGFA IY+        + S+          
Sbjct: 11  INPSSGEKFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNI 70

Query: 49  ---------PAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVH 99
                    P  +ACLKRV+VPD+  LN LR EV+ M+ L+G  ++V Y DS+A++   H
Sbjct: 71  DEFQQFKLEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRR--H 128

Query: 100 DGS--YEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIH 157
           DG+  +EV LLME C    L+D+MN RL  +L E E+LKI  D+T GI+ MH LQ PLIH
Sbjct: 129 DGNPGFEVLLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIH 188

Query: 158 RDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL 217
           RDIKIENVL+     FK+CDFGS         + QE   +  +I  +TT QYR+PEMIDL
Sbjct: 189 RDIKIENVLVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDL 248

Query: 218 YRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISF 277
           YR  PI+EKSDIWALGVFLYKL +YTTPFE  G+ AILHS+++ P    YS  L +LI  
Sbjct: 249 YRNLPIDEKSDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIII 307

Query: 278 MLSENPTQRPNICQVLEEVSRIQGTPCPLRNFY 310
           ML+ENP  RPNI QV+ +V    G   P+++ Y
Sbjct: 308 MLAENPNLRPNIYQVMHQVCITIGIEPPIKDKY 340

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  310 bits (793), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 154/310 (49%), Positives = 199/310 (64%), Gaps = 14/310 (4%)

Query: 12  GTELTVGSHRARIIKYLTSGGFAHIYTA---------EICPADLSSPAKIACLKRVLVPD 62
           G+++ VG+HR  I+KYL  GGFAHIY           E  P+      + ACLKRVLV D
Sbjct: 32  GSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTD 91

Query: 63  KPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDG--SYEVFLLMEYCSGGGLIDF 120
           +  LN +R EV  MK L G  ++V Y DSHA++S   DG   +EV LLME C    L+D+
Sbjct: 92  ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRS--RDGVPGFEVMLLMELCPNNSLLDY 149

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           MN RL  +L E E+LKI  D+T+ +A MH L  PLIHRD+KIENVL+  D  FK+CDFGS
Sbjct: 150 MNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGS 209

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240
               +      QE   + ++I  +TT QYR+PEMIDLYR  PI+EKSDIWALG+FLYKL 
Sbjct: 210 TSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLL 269

Query: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           +YTTPFE  G+ AILHS+++FP    YS  L +LI  ML+ENP  RPNI Q+++ +  I 
Sbjct: 270 FYTTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIM 328

Query: 301 GTPCPLRNFY 310
               P+ + Y
Sbjct: 329 KVENPIEDKY 338

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  311 bits (797), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 198/316 (62%), Gaps = 15/316 (4%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP-----ADLSS---------PAKIAC 54
           Y  GT + VGSH+  +IKY+  GGFA IYT +        A L           P  IAC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSG 114
           LKRVLV D   LN +R EV+ M+ L+G   VV Y DS+A+        YEV LLME+C  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 GGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFK 174
             L+D+MN RL  RL E E++KI  D T GIA +H L+ PLIHRDIKIENVL+  +  FK
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 VCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGV 234
           +CDFGS         N ++      +I  NTT QYR+PEMIDLYR  PI+EKSDIWALGV
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 235 FLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLE 294
           FLYKL ++TTPFE+ G+ AILHS+++FP    YS  L +LI  ML+ENP+ RPNI QVL+
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 295 EVSRIQGTPCPLRNFY 310
            +  I G   PL + Y
Sbjct: 398 YLCSINGWKVPLNDKY 413

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  306 bits (784), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 153/313 (48%), Positives = 195/313 (62%), Gaps = 10/313 (3%)

Query: 7   DIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP---------ADLSSPAKIACLKR 57
           D Y PGT + VG H+  ++KYL  GGFA IY  +             ++       CLKR
Sbjct: 27  DSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKR 86

Query: 58  VLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGL 117
           VLV D   LN +R EV+ M+ L+G   VV Y DS+A++       YEV LLME CS   L
Sbjct: 87  VLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSL 146

Query: 118 IDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCD 177
           +D+MN RL  +L E E+LKI  D+T  +A MH L  PLIHRDIKIENVL+     FK+CD
Sbjct: 147 LDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCD 206

Query: 178 FGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLY 237
           FGS    +    + Q+   +  +I  +TT QYR+PEMIDLYR  P+NEKSDIWALGVFLY
Sbjct: 207 FGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLY 266

Query: 238 KLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVS 297
           KL +YTTPFE+ G+ AILHS+++FP    YS  L +LI  ML+ENP  RPNI QVL ++ 
Sbjct: 267 KLMFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQIC 325

Query: 298 RIQGTPCPLRNFY 310
            I G   P+ + Y
Sbjct: 326 YISGIKNPMDDAY 338

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  308 bits (790), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 153/308 (49%), Positives = 195/308 (63%), Gaps = 10/308 (3%)

Query: 12  GTELTVGSHRARIIKYLTSGGFAHIYTA---------EICPADLSSPAKIACLKRVLVPD 62
           G+++ VG+HR  I+KYL  GGFAHIY           E  P        +ACLKRVLV D
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMN 122
           +  LN +R EV  MK L G  ++V Y DSHA+++      +EV LLME C    L+D+MN
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193

Query: 123 TRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVC 182
            RL  +L E E+LKI  D+T+ +A MH L  PLIHRD+KIENVL+  +  FK+CDFGS  
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 183 GVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYY 242
                    QE   + ++I  +TT QYR+PEMIDLYR  PINEKSDIWALG+FLYKL +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 243 TTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGT 302
           TTPFE  G+ AILHS+++FP    YS  L +LI  ML+ENP  RPNI QV++ +  I   
Sbjct: 314 TTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372

Query: 303 PCPLRNFY 310
             PL + Y
Sbjct: 373 KNPLEDKY 380

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  303 bits (776), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 150/313 (47%), Positives = 197/313 (62%), Gaps = 11/313 (3%)

Query: 8   IYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP----------ADLSSPAKIACLKR 57
           +  P T++ VG+HR  I+++L  GGFA+IY  +             + L     IACLKR
Sbjct: 28  LLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKR 87

Query: 58  VLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGL 117
           V+VPD+  LN LR EV+ MK LRG+ ++V Y DS+A++       +E+ LLME C    L
Sbjct: 88  VIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSL 147

Query: 118 IDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCD 177
           +D+MN +L  +L E E+LKI  D++  IA MH L  PLIHRDIKIENVL+  D  FK+CD
Sbjct: 148 LDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCD 207

Query: 178 FGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLY 237
           FGS           Q+   + ++I  +TT QYR+PEMIDLYR  PINEKSDIWALG+FLY
Sbjct: 208 FGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 267

Query: 238 KLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVS 297
           KL +YTTPFE  G+ AILHS+++ P    YS  L +LI  ML+ENP+ RPNI QV+  V 
Sbjct: 268 KLLFYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVC 326

Query: 298 RIQGTPCPLRNFY 310
            I     P  + Y
Sbjct: 327 SILKCDVPFTDKY 339

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  308 bits (789), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 155/319 (48%), Positives = 202/319 (63%), Gaps = 20/319 (6%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTA-------EICPADLSSP--------AKIA 53
           +  G  + VGSH   I+KYLT GGFA IY         E    D+ +           + 
Sbjct: 29  FSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIGDLV 88

Query: 54  CLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCS 113
           CLKRV+V D+  L+ ++ EV+ MK LRG  +VV Y DS+A ++   +G +EVFLLMEYC 
Sbjct: 89  CLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLMEYCP 148

Query: 114 GGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTF 173
              L+D+MN RL  +L E E+L I  DIT G++ +H L  PLIHRDIKIENVL+  +  F
Sbjct: 149 NKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHNNRF 208

Query: 174 KVCDFGSVCGVIRPP--KNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWA 231
           K+CDFGS    I PP     Q+ + + HDI  +TT QYR+PEMIDL+R  P+NEK+DIWA
Sbjct: 209 KLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKADIWA 266

Query: 232 LGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQ 291
           LGVFLYKL +YTTPFE  G+ AILHS+++ P    YS+ L +LI  ML+ENP  RPNI Q
Sbjct: 267 LGVFLYKLLFYTTPFELTGQFAILHSKYEIPQS-HYSERLLNLIVVMLAENPNLRPNIYQ 325

Query: 292 VLEEVSRIQGTPCPLRNFY 310
           VL E+  I     P+ + Y
Sbjct: 326 VLSEICSILNVEVPIPDIY 344

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  308 bits (788), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 154/309 (49%), Positives = 194/309 (62%), Gaps = 11/309 (3%)

Query: 12  GTELTVGSHRARIIKYLTSGGFAHIY-------TAEICPADLSSPAKI---ACLKRVLVP 61
           G+ + VG+ +  I+KYLT GGFA IY       + E    + + P KI   ACLKRVLV 
Sbjct: 28  GSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRVLVQ 87

Query: 62  DKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFM 121
           D+  LN +R EV+ MKLL+G  ++V Y DS+A++       +EV LLME C    L+DFM
Sbjct: 88  DENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNKSLLDFM 147

Query: 122 NTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSV 181
           N RL  +L E E+L I  D+T  +A MH L PPLIHRDIKIENVL+     FK+ DFGS 
Sbjct: 148 NQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLADFGST 207

Query: 182 CGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCY 241
                     Q+   +  DI  +TT QYR+PEMIDLY+  PI+EKSDIWALG+FLYKL +
Sbjct: 208 SKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFLYKLLF 267

Query: 242 YTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQG 301
           Y TPFE  G+ AILHS++ FP    YS  L +LI  MLSENP  RPNI QVL E+  I G
Sbjct: 268 YITPFEMTGQFAILHSKYDFPQT-NYSSRLINLIIIMLSENPNLRPNIYQVLHEICSISG 326

Query: 302 TPCPLRNFY 310
           T   + + Y
Sbjct: 327 TRLEITDKY 335

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  303 bits (776), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 198/319 (62%), Gaps = 18/319 (5%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTA-------EICPADLSSPAKI--------- 52
           ++ G  L VG+H+  I+ YLT GGFA IY         E    D  S  +I         
Sbjct: 31  FEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLKLGD 90

Query: 53  -ACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEY 111
            ACLKRVLV D+  LN +R EV+ MK LRG  ++V Y DS+A +S   +  YEV LLME 
Sbjct: 91  VACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLLMEL 150

Query: 112 CSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDR 171
           CS   L+++MN RL  +L E EVLKI  D+T G+A MH L+ PLIHRDIKIENVL+  + 
Sbjct: 151 CSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVDSNN 210

Query: 172 TFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWA 231
            FK+CDFGS           Q+   +  ++  +TT QYR+PEMIDLYR  PINEKSDIWA
Sbjct: 211 NFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSDIWA 270

Query: 232 LGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQ 291
           LGVFLYKL +YTTPFE  G+ A+LHS+F  P+  +YS  + +L+  MLSEN   RPNI Q
Sbjct: 271 LGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRPNIYQ 329

Query: 292 VLEEVSRIQGTPCPLRNFY 310
           V+  + ++     P+ + Y
Sbjct: 330 VMHYICQLIQVDTPILDIY 348

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  303 bits (775), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 151/321 (47%), Positives = 201/321 (62%), Gaps = 20/321 (6%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP-------------ADLSSPAKIACL 55
           YQPG  + VGSHR  I++Y+  GGFA IY+ +                 D      +ACL
Sbjct: 18  YQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDLACL 77

Query: 56  KRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAK------SGVHDGSYEVFLLM 109
           KRV+V D+  LN LR EV+ MK L G  ++V Y DS+A++      S   +  +EV LLM
Sbjct: 78  KRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVLLLM 137

Query: 110 EYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISD 169
           E C    L+D+MN RL  +L E E+L++  D++  IA MH L+ PLIHRDIKIENVL+  
Sbjct: 138 ELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVLVDQ 197

Query: 170 DRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDI 229
              FK+CDFGS           ++  Y+  +I  +TT QYR+PEMIDLYR  PI+EKSDI
Sbjct: 198 KNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDI 257

Query: 230 WALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNI 289
           WALG+FLYKL ++TTPFE+ G+ AILHS+F+FP    YS  L +LI  MLSENP  RPNI
Sbjct: 258 WALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLRPNI 316

Query: 290 CQVLEEVSRIQGTPCPLRNFY 310
            QVL ++ +++  P P+ + Y
Sbjct: 317 YQVLHQICQLKQVPIPIADKY 337

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  301 bits (771), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 192/307 (62%), Gaps = 9/307 (2%)

Query: 12  GTELTVGSHRARIIKYLTSGGFAHIYTAEICPA--------DLSSPAKIACLKRVLVPDK 63
           G+ L VG HR  II+YL  GGFAHIY                +     IACLKRV V D+
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDE 90

Query: 64  PSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNT 123
             LN LR EV+ MK L+G  +VV Y DS+A++       +EV LLME CS G L+D+MN 
Sbjct: 91  NGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQ 150

Query: 124 RLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCG 183
           RL  +L E EVLKI  DIT+GI+ MH L+ PLIHRDIKIENVL+     FK+CDFGS   
Sbjct: 151 RLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTST 210

Query: 184 VIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYT 243
            +      QE   + ++I  +TT QYR+PEMIDLYR   INEKSDIWALG+FLYKL +YT
Sbjct: 211 CLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYT 270

Query: 244 TPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTP 303
           TPFE  G+ AILHS++  P    +S  L +LI  ML+ENP  RPNI Q+L  +  I    
Sbjct: 271 TPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMECD 329

Query: 304 CPLRNFY 310
            P+ + Y
Sbjct: 330 VPIEDHY 336

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  303 bits (777), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 197/312 (63%), Gaps = 11/312 (3%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP-----ADLSSPA-----KIACLKRV 58
           Y  G  ++VG+HR  I+ YL  GGFA IY  +          L S +      IACLKRV
Sbjct: 20  YPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRV 79

Query: 59  LVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLI 118
           +V D+  LN +R EV+ MK L+ + ++V Y DS+A++       +EV LLME C    L+
Sbjct: 80  IVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLL 139

Query: 119 DFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDF 178
           D+MN RL+ +L E E+LKI  D++ GI+ MH L  PLIHRDIKIENVL+  +  FK+CD 
Sbjct: 140 DYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDM 199

Query: 179 GSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYK 238
           GS      P  + Q+   +  +I  +TT QYRAPEMIDLYR  PINEKSDIWALG+FLYK
Sbjct: 200 GSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYK 259

Query: 239 LCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSR 298
           L +YTTPFE  G+ AILHS++ FP   +YS  + +LI  ML+ENP  RPNI QV+  +  
Sbjct: 260 LLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIFQVVYHICS 318

Query: 299 IQGTPCPLRNFY 310
           I   P P+ + Y
Sbjct: 319 IMNLPVPIEDRY 330

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  304 bits (779), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 152/318 (47%), Positives = 200/318 (62%), Gaps = 15/318 (4%)

Query: 6   NDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP------ADLSSP----AKIACL 55
           N+ Y PGT++ VG+H+  IIKY+  GGFA IY  +          +   P      +ACL
Sbjct: 19  NERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACL 78

Query: 56  KRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDG--SYEVFLLMEYCS 113
           KRVLV D+  LN +R EV+ MK L+G  ++V Y DS+A++   H+G   +EV LLME C 
Sbjct: 79  KRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRR--HNGFPGFEVLLLMELCP 136

Query: 114 GGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTF 173
              L+D+MN RL  +L E E+LKI  D+T  ++ MH L  PL+HRDIKIENVL+     F
Sbjct: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196

Query: 174 KVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALG 233
           K+CDFGS           Q+   +  +I  +TT QYR+PEMIDLYR  PI+EKSDIWALG
Sbjct: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256

Query: 234 VFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
           +FLYKL ++TTPFE  G+ AILHS+++FP    YS  L +LI  ML+ENP  RPNI QVL
Sbjct: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVL 315

Query: 294 EEVSRIQGTPCPLRNFYV 311
             +  I G   P+ + Y 
Sbjct: 316 HNICSISGMKVPIEDQYA 333

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  297 bits (760), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 150/313 (47%), Positives = 192/313 (61%), Gaps = 10/313 (3%)

Query: 7   DIYQPGTELTVGSHRARIIKYLTSGGFAHIYTA---------EICPADLSSPAKIACLKR 57
           D Y PG  + VG H+  IIKYL  GGFA IY A         +I    +  P  + CLKR
Sbjct: 97  DTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLKR 156

Query: 58  VLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGL 117
           VLV D   LN +R EV  MK L G  ++V   DS+A++       YEV LLME CS   L
Sbjct: 157 VLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKSL 216

Query: 118 IDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCD 177
           +D+MN RL  +L E E+LKI  D+T  +A MH L  PLIHRDIKIENVL+     FK+CD
Sbjct: 217 LDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLCD 276

Query: 178 FGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLY 237
           FGS    +      ++   +  ++  +TT QYR+PEMID+YR   INEKSDIWALG+FLY
Sbjct: 277 FGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFLY 336

Query: 238 KLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVS 297
           KL +Y TPFE+ G+ AILHS+++FP +  YS  L +LI  ML+ENP  RPNI QVL  + 
Sbjct: 337 KLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYIC 395

Query: 298 RIQGTPCPLRNFY 310
           +I     P+ + Y
Sbjct: 396 KIINIKTPIDDIY 408

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  300 bits (767), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 151/312 (48%), Positives = 198/312 (63%), Gaps = 9/312 (2%)

Query: 7   DIYQPGTELTVGSHRARIIKYLTSGGFAHIY-------TAEICPAD-LSSPAKIACLKRV 58
           ++ Q G+ + VG H+  +I+YL  GGFAHIY       T E+   D +  P    CLKRV
Sbjct: 27  EMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRV 86

Query: 59  LVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLI 118
            V D+  LN LR EV+ MK LR   ++V Y DS+A++ G     YEV LLME C  G L+
Sbjct: 87  RVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLL 146

Query: 119 DFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDF 178
           D+MN RL  +L E EVLKI  DIT G++ MH  + PLIHRDIKIENVL+  D  FK+CDF
Sbjct: 147 DYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDF 206

Query: 179 GSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYK 238
           GS    +    + QE   + ++I  +TT QYR+PEMIDLYR  PINEKSDIWALG+FLYK
Sbjct: 207 GSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYK 266

Query: 239 LCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSR 298
           L +YTTPFE  G+ AILHS+++ P    +S  L +L+  ML+ENP  RPN+ QV+  +  
Sbjct: 267 LLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHICS 325

Query: 299 IQGTPCPLRNFY 310
           +      + + Y
Sbjct: 326 MMECEVKIDDLY 337

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  302 bits (774), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 196/314 (62%), Gaps = 12/314 (3%)

Query: 7   DIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP----------ADLSSPAKIACLK 56
           D Y PGT + VG+ +  II ++  GGFA IY+ +             A L  P  IACLK
Sbjct: 20  DGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQ-PGDIACLK 78

Query: 57  RVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGG 116
           RVLVPD+  L+ +R EV+ MK LRG + ++ Y DS+A++       YEV LLME C    
Sbjct: 79  RVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPNNS 138

Query: 117 LIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVC 176
           L+D+MN RL  RL E E+LK+  D T  I+ MH L  PLIHRDIKIENVL+     FK+C
Sbjct: 139 LLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFKLC 198

Query: 177 DFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFL 236
           DFGS           Q+   +  +I  NTT QYR+PEMIDLYR  PINEKSDIWALG+FL
Sbjct: 199 DFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 258

Query: 237 YKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           YKL ++ TPFE  G+ +ILHS+++FP+  +YS  L +LI  ML+ENP  RPNI QV+  +
Sbjct: 259 YKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQVMHHI 317

Query: 297 SRIQGTPCPLRNFY 310
             + G   P+ + Y
Sbjct: 318 CSVIGCEVPIEDKY 331

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  297 bits (760), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 194/326 (59%), Gaps = 35/326 (10%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP------------ADLSSPAKI---A 53
           Y+ GT LTVG  R  I+KYLT GGFA IYT                  + S   KI   A
Sbjct: 40  YKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIGDVA 99

Query: 54  CLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGS----------- 102
           CLKRVLVPD+  L+ +R EVD MK L    ++V Y DS+A+K  + D S           
Sbjct: 100 CLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASK--IKDNSNIDTTNNNDNN 157

Query: 103 ------YEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
                 +E+ LLMEYC    L+DFMN RL  +L E E+LK  +DIT  +  MH L  PLI
Sbjct: 158 KNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPLI 217

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMID 216
           HRDIKIENVL+  +  FK+ DFGS   +  P    Q+   +  DI  NTT QYR+PEMID
Sbjct: 218 HRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEMID 277

Query: 217 LYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLIS 276
           LY+  PI+EKSDIWALGV LYKL +YTTPFE  G+ AILHS+++FP+   YS    +LI 
Sbjct: 278 LYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFINLII 336

Query: 277 FMLSENPTQRPNICQVLEEVSRIQGT 302
            ML+ENP  RPNI QVL  +  I  T
Sbjct: 337 IMLAENPNLRPNIFQVLYYLKSISNT 362

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  296 bits (758), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 146/311 (46%), Positives = 194/311 (62%), Gaps = 10/311 (3%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP--ADLSSPAKI-------ACLKRVL 59
           + PG  + VG+HR  ++ YL  GGFA IY  +      +  + +K+       ACLKRVL
Sbjct: 22  FLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVACLKRVL 81

Query: 60  VPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLID 119
           V D+  L+ +R EV+ MK L G Q++V Y DS+A +    +  +EV LLME C    L+D
Sbjct: 82  VQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPNKSLLD 141

Query: 120 FMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFG 179
           +MN RL  +L E E+LKI  D++  ++ MH L+ PLIHRDIKIENVL+    +FK+CDFG
Sbjct: 142 YMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFKLCDFG 201

Query: 180 SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKL 239
           S           QE   +  +I  +TT QYR PEMIDLYR  PINEKSDIWALG+FLYKL
Sbjct: 202 STSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 240 CYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299
            ++ TPFE  G+ AILHS+++FP    YS  L +LI  ML+ENP  RPNI QVL  +  +
Sbjct: 262 LFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLNHICTM 320

Query: 300 QGTPCPLRNFY 310
            G   P+ + Y
Sbjct: 321 IGVEVPIEDKY 331

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  297 bits (761), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 151/325 (46%), Positives = 200/325 (61%), Gaps = 29/325 (8%)

Query: 12  GTELTVGSHRARIIKYLTSGGFAHIYTAEICPA-----------------DLSSP----- 49
           GT++ VGSH+  IIKY+  GGFA IY  +   +                 D  +P     
Sbjct: 27  GTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNPMIL 86

Query: 50  --AKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGS--YEV 105
               IACLKRVLV D+  LN +R EV+ MK L+G  +VV Y DS+A++   H+G+  +EV
Sbjct: 87  KLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRR--HNGASGFEV 144

Query: 106 FLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENV 165
            LLME C    L+D+MN RL  +L E E+LKI  DIT  ++ MH L+ PL+HRDIKIENV
Sbjct: 145 LLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIENV 204

Query: 166 LISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINE 225
           L+     FK+CDFGS    +      Q+   +  +I  +TT QYR+PEMIDLYR  PI+E
Sbjct: 205 LVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIDE 264

Query: 226 KSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQ 285
           KSDIWALG+FLYKL ++ TPFE  G+ AILHS+++FP    YS  L +LI  ML+ENP  
Sbjct: 265 KSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNL 323

Query: 286 RPNICQVLEEVSRIQGTPCPLRNFY 310
           RPNI QVL+ +  +     P+ + Y
Sbjct: 324 RPNIYQVLDNICSMMNVEVPIEDIY 348

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  295 bits (754), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 151/311 (48%), Positives = 194/311 (62%), Gaps = 18/311 (5%)

Query: 12  GTELTVGSHRARIIKYLTSGGFAHIYTAEICP--------ADLS-----SPAKIACLKRV 58
           G  +TVGSHR  ++ YL  GGFA IY  +            D S      P   ACLKRV
Sbjct: 99  GKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRV 158

Query: 59  LVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAK----SGVHDGSYEVFLLMEYCSG 114
           LV D+  LN +R+EV+ MK L+G  ++V Y DS+A++    SG     +EV LLME C  
Sbjct: 159 LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPN 218

Query: 115 GGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFK 174
             L+D+MN RL  +L E E+ KI  DIT  +A MH L  PLIHRDIKIENVL+  +  FK
Sbjct: 219 KSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278

Query: 175 VCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGV 234
           +CDFGS         + Q+   +  D+  +TT QYR+PEMIDL++  PINEKSDIWALGV
Sbjct: 279 LCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGV 338

Query: 235 FLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLE 294
           FLYKL ++TTPFE+ G+ A+LHS+F+FP    YS  L +LI  ML+ENP+ RPNI QVL 
Sbjct: 339 FLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPNIYQVLY 397

Query: 295 EVSRIQGTPCP 305
            +S +     P
Sbjct: 398 YLSEVTNREVP 408

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  294 bits (753), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 192/311 (61%), Gaps = 10/311 (3%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP------ADLSSPAKI---ACLKRVL 59
           Y PG  + VG+H+  I+ YL  GGFA IY  +            S P KI   ACLKRVL
Sbjct: 22  YTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGDVACLKRVL 81

Query: 60  VPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLID 119
           V D+  LN +R EV+ MK L+G  +VV Y DS+A++       +EV LLME C    L+D
Sbjct: 82  VHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMELCPNKSLLD 141

Query: 120 FMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFG 179
           +MN RL  +L E E++KI  D+   I+ MH L  PLIHRDIKIENVL+  +  FK+ DFG
Sbjct: 142 YMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAENNFKLADFG 201

Query: 180 SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKL 239
           S           Q+   +  +I  +TT QYR+PEMIDLYR  PINEKSDIWALG+FLYKL
Sbjct: 202 STSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 240 CYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299
            ++TTPFE  G+ AILHS+++FP   +YS  L +LI  ML+ENP  RPNI QVL  +  I
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYHICDI 320

Query: 300 QGTPCPLRNFY 310
                P+ + Y
Sbjct: 321 LNAEVPIEDKY 331

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  293 bits (751), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 150/315 (47%), Positives = 193/315 (61%), Gaps = 10/315 (3%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP------ADLSSPAKI---ACLKRVL 59
           + PG  + VG+H+  +I YL  GGFA IY  +            S P KI   ACLKRVL
Sbjct: 22  FTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGDVACLKRVL 81

Query: 60  VPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLID 119
           V D+  LN +R EV+ MK L+G  +VV Y DS+A++       +EV LLME C    L+D
Sbjct: 82  VQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLD 141

Query: 120 FMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFG 179
           +MN RL  +L E E++KI  D+   I+ MH L  PLIHRDIKIENVL+  +  FK+ DFG
Sbjct: 142 YMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANNNFKLADFG 201

Query: 180 SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKL 239
           S           Q+   +  +I  +TT QYR+PEMIDLYR  PINEKSDIWALG+FLYKL
Sbjct: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 240 CYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299
            ++TTPFE  G+ AILHS+++FP   +YS  L +LI  ML+ENP  RPNI QVL  +  I
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLCEI 320

Query: 300 QGTPCPLRNFYVTRA 314
                P+ + Y   A
Sbjct: 321 LNIEVPIEDKYTEGA 335

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  293 bits (749), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 192/312 (61%), Gaps = 10/312 (3%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP------ADLSSPAKI---ACLKRVL 59
           Y PG  + VG+H+  I+ YL  GGFA IY  +            S P KI   ACLKRVL
Sbjct: 22  YTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGDLACLKRVL 81

Query: 60  VPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLID 119
           V D+  LN +R EV+ MK L+G  +VV Y DS+A++       +EV LLME C    L+D
Sbjct: 82  VHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMELCPNKSLLD 141

Query: 120 FMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFG 179
           +MN RL  +L E E++KI  D+   I+ MH L  PLIHRDIKIENVL+    +FK+ DFG
Sbjct: 142 YMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKDSFKLADFG 201

Query: 180 SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKL 239
           S           Q+   +  +I  +TT QYR+PEMIDLYR  PINEKSDIWALG+FLYKL
Sbjct: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 240 CYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299
            ++TTPFE  G+ AILHS+++FP   +YS  L +LI  ML+ENP  RPNI QVL  +  I
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLCHLCDI 320

Query: 300 QGTPCPLRNFYV 311
                P+ + Y 
Sbjct: 321 LNVEVPIEDKYA 332

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  291 bits (745), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 191/315 (60%), Gaps = 10/315 (3%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICP------ADLSSPAKI---ACLKRVL 59
           Y PG  + VG+H+  ++ YL  GGFA IY  +            S P KI   ACLKRVL
Sbjct: 22  YTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVL 81

Query: 60  VPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLID 119
           V D+  LN +R EV+ MK L+G  ++V Y DS+A++       +EV LLME C    L+D
Sbjct: 82  VQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLD 141

Query: 120 FMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFG 179
           +MN RL  +L E E++KI  D+   I+ MH L   LIHRDIKIENVL+     FK+ DFG
Sbjct: 142 YMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG 201

Query: 180 SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKL 239
           S           Q+   +  +I  +TT QYR+PEMIDLYR  PINEKSDIWALGVFLYKL
Sbjct: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261

Query: 240 CYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299
            ++TTPFE  G+ AILHS+++FP   +YS  L +LI  ML+ENP  RPNI QVL  +  I
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLCEI 320

Query: 300 QGTPCPLRNFYVTRA 314
                P+ + Y   A
Sbjct: 321 LNVEVPIEDKYAEGA 335

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  292 bits (747), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 193/313 (61%), Gaps = 12/313 (3%)

Query: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEIC---------PADLSS--PAKIACLKR 57
           Y+PG  ++VG+H+ +I  YL  GGFA IY  +              L+S     IACLKR
Sbjct: 35  YKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIACLKR 94

Query: 58  VLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGL 117
           VLV D+  LN +R EV+ MKLL+G  ++V Y DS+A +       YE+ LLME C    L
Sbjct: 95  VLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPNNSL 154

Query: 118 IDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCD 177
           +D+MN RL+ +L E E++KI  D T  ++ MH L  PLIH+DIK+EN+L+  +  FK+CD
Sbjct: 155 LDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFKLCD 214

Query: 178 FGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLY 237
           FGS         +  +   +  +I  +TT QYR+PEMIDLYR  PINE SDIWALGVFLY
Sbjct: 215 FGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGVFLY 274

Query: 238 KLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVS 297
           KL ++ TPFE+ G+ +ILH++F  P    Y   L +LI  MLSEN   RPNI QV+ E+ 
Sbjct: 275 KLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVMYEIC 333

Query: 298 RIQGTPCPLRNFY 310
            I  TP P+ + Y
Sbjct: 334 SITNTPLPIEDKY 346

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score =  104 bits (259), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 87/337 (25%), Positives = 142/337 (42%), Gaps = 63/337 (18%)

Query: 15  LTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVD 74
           +++   + RI K L  GG + +Y  E      S   ++  LK+   P       + +   
Sbjct: 19  VSINGRKYRIQKLLGEGGLSFVYLVE------SKEGELFALKKTRCP----FGSIGSISP 68

Query: 75  AMKLLRGNQ-----HVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQN-- 127
           AMK +   Q     ++   +DS   +    DGS  V++L+ Y + G L D +N  L +  
Sbjct: 69  AMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCT 126

Query: 128 RLQEGEVLKITSDITQGIAAMHALQP---------------------------------- 153
           ++ E ++L++   I +G+  +H   P                                  
Sbjct: 127 QMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQ 186

Query: 154 -PLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNP-QEFNYVQHDILKNTTAQYRA 211
               HRD+K  N++IS +    + D GS C   R   N  Q     Q     N T  Y A
Sbjct: 187 QSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYAA 245

Query: 212 PEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEA-------AILHSRFQFPSY 264
           PE++D+     I EK DIW+ G  +Y +C+  +PFE+  +        AI   ++  P  
Sbjct: 246 PEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRG 305

Query: 265 PQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQG 301
             YS SL  LI   LS NP QRP++ +++  +  +QG
Sbjct: 306 TSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/330 (24%), Positives = 142/330 (43%), Gaps = 51/330 (15%)

Query: 15  LTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVD 74
           ++V  HR  I + L  GGF+ +Y  E     L +  KI C    +    P++     EVD
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVESRENGLMALKKIRCPFGSIGSISPAMK----EVD 74

Query: 75  AMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQ--EG 132
             +  + + ++   IDS   +    DGS  V++L+ Y S G L D +N  L +  Q  E 
Sbjct: 75  NYQKFK-SPYIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVPEL 131

Query: 133 EVLKITSDITQGIAAMHALQPP-----------------------------------LIH 157
           EV+++   + +G+  +H   P                                      H
Sbjct: 132 EVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAYAH 191

Query: 158 RDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL 217
            DIK  N++IS +    + D GS         + Q     Q    ++ T  + APE++D+
Sbjct: 192 HDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEILDV 251

Query: 218 YRGYPINEKSDIWALGVFLYKLCYYTTPFEK---VGEAAILHS----RFQFPSYPQYSDS 270
                I EK D+W+ G  +Y +C+  +PFE+   +  A++ +S    ++  PS   YS  
Sbjct: 252 KLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYSSG 311

Query: 271 LKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           L  ++   L+ +P  RP++ +++  +  +Q
Sbjct: 312 LIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 151/348 (43%), Gaps = 65/348 (18%)

Query: 15  LTVGSHRARIIKYLTSGGFAHIYTAEICPA-------DLSSPAKIACLKRVLVP--DKPS 65
           +++   R  I + L  G  + +Y  +   +        L +  ++  LKR+  P  +  S
Sbjct: 26  VSINGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIES 85

Query: 66  LNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRL 125
           ++    EVD  K  + + ++++ +DS   +    DGS  + +L+ Y   G L D +N  L
Sbjct: 86  ISAAMKEVDNYKRFQ-SPYIITLVDSQVVQE--KDGSKTLCILLPYFPLGSLQDMVNRNL 142

Query: 126 Q--NRLQEGEVLKITSDITQGIAAMH----------------------------ALQPPL 155
                + E E ++I   I +G+  +H                                PL
Sbjct: 143 LKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPL 202

Query: 156 ----------------IHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQH 199
                           +HRDI++ N+L S +    V D GS C          + N +Q 
Sbjct: 203 ELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQD 262

Query: 200 DILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEK---VGEAAILH 256
            +  N +  Y APE++++     I+ K+DIW++G   Y + +  +PFE+   V  A++ +
Sbjct: 263 WVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTY 322

Query: 257 S----RFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300
           +    ++ FP   +YS+SL  +I   L  +PT RP+I ++L+ +  +Q
Sbjct: 323 AIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 143/333 (42%), Gaps = 61/333 (18%)

Query: 13  TELTVGSHRARIIKYLTSGGFAHIYTAEICPADLS-----SPAKIACLKRVLVPDKPSLN 67
           T + V   R +I + L  GG + +Y  ++    LS     + A++  LK+++ P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  VLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQN 127
               E++  K  + + +V+  IDS   +    DGS  +++++ Y S G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 R--LQEGEVLKITSDITQGIAAMHA---------------------------------LQ 152
              + E E ++I   +T+G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDI 201
             ++           HRDI   N+L S D    + D GS         N  + + +Q  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 LKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEA-------AI 254
             N T  Y APE+++L     ++ K DIW++G   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LHSRFQFPSYPQYSDSLKHLISFMLSENPTQRP 287
              ++ FP   ++S+ L  +I   +  +P QRP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 85/291 (29%), Positives = 139/291 (47%), Gaps = 37/291 (12%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60
           MN  + +  QP +  ++     R       G F  +Y A     D ++ A +A     L 
Sbjct: 1   MNNKIYNYTQPSSIYSIQECVGR-------GNFGDVYKA----FDKTNGAIVAVKVVNLE 49

Query: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120
             +  +++L  E+  +  LR   ++ +YI +      + D S  ++++MEYC GG   D 
Sbjct: 50  HTEEDIDLLAQEIFFLAELRS-PYITNYITTM-----IEDVS--MWIVMEYCGGGACSDL 101

Query: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180
           + T   N L E +V  IT ++ +G+  +H  +   IHRDIK  N+L++D+   K+ DFG 
Sbjct: 102 IKTVYINGLPENKVGFITREVLKGLKYLHDQKK--IHRDIKAANILLTDEGKVKLGDFG- 158

Query: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLY-RGYPINEKSDIWALGVFLYKL 239
           V G IR       F           T  + APE+++    GY  NEK+DIW+LG+ +Y+L
Sbjct: 159 VSGQIRATMKRGTF---------VGTPYWMAPEVVNKESNGY--NEKADIWSLGITVYEL 207

Query: 240 CYYTTPFEKVGEAAILHS--RFQFPS-YPQYSDSLKHLISFMLSENPTQRP 287
                P  K     ++ S  R + P  + QYSD  K  ++  L ++P  RP
Sbjct: 208 LKGLPPLSKCDPMKVMVSLPRRKPPKLHGQYSDVAKGFVAACLVKDPNLRP 258

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 101/202 (50%), Gaps = 16/202 (7%)

Query: 103 YEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKI 162
           Y ++++MEYC GG   D + T  +  L E +V  +   +  G+  +HA     IHRDIK 
Sbjct: 85  YLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKA 142

Query: 163 ENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYP 222
            N+L++D    KV DFG V   +R     + F           T  + APE++ +  G  
Sbjct: 143 ANILLTDSGLVKVADFG-VSAEMRSTMKAKTF---------VGTPYWMAPEVV-MNEGMG 191

Query: 223 INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS---RFQFPSYPQYSDSLKHLISFML 279
            NEKSDIW+LG+  Y+L     P  K     ++ +   R     +  Y++ +KH I+  L
Sbjct: 192 YNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIATCL 251

Query: 280 SENPTQRPNICQVLEEVSRIQG 301
            ++P +RP+  ++LE    ++G
Sbjct: 252 IKDPEKRPSASELLEHDFMVKG 273

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 127/271 (46%), Gaps = 28/271 (10%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A   ++ +  + + N L +E+   K +R +Q++V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMR-HQNIV 158

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID         +    V++L+E C  G L+D +  R    L E EV   T+ I   + 
Sbjct: 159 HFIDCF-------EDDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+    +IHRD+K+ N+    D   K+ DFG     I   +N +++           T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG--LAAIINNENERKYTIC-------GT 258

Query: 207 AQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL----HSRFQFP 262
             Y APE+I   +    + + DIW+LGV ++ +     PF+    + I     H  + FP
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFP 318

Query: 263 SYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
           +    S  +K LI  +LS NP +RP I ++L
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 123/259 (47%), Gaps = 26/259 (10%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +       L E +V  IT ++ +G+  +H  +   IHRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAAN 149

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI-DLYRGYPI 223
           VL++DD   K+ DFG V G +R       F           T  + APE+I +   GY  
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTF---------VGTPYWMAPEIISNSSHGY-- 197

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS---RFQFPSYPQYSDSLKHLISFMLS 280
           NEK+DIW+LG+ +Y+L     P+ K     ++ +   +        +SD+ K  IS  L 
Sbjct: 198 NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISACLI 257

Query: 281 ENPTQRPNICQVLEE--VSRIQGTPCPLRNFYVTRAMXXXXXXXXPKIKFDH----SASQ 334
           ++P +RP   ++L++  V  I+ T   LRN  +            PK   D+    + S+
Sbjct: 258 KDPDERPTATELLQQPFVKNIKIT--DLRNEVMEIKRTRKEGNKVPKYSLDNRLYQTFSK 315

Query: 335 PKLDSANNIINVPFKMSHN 353
           PK  +  N  +V    S N
Sbjct: 316 PKSGNFWNFDSVRLTKSKN 334

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 104/210 (49%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L +++   +Q+R+   E  K+ + I   +   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRA 211
           N+L+      K+ DFG            +VCG                      T  Y A
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLETVCG----------------------TTVYMA 195

Query: 212 PEMIDL--YRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ-FPSYPQYS 268
           PE+I+   Y G+ I    DIW+LGV LY + + T PF++  E     ++++     P Y+
Sbjct: 196 PELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFDEEDETK---TKWKIINEEPFYN 248

Query: 269 DSL-----KHLISFMLSENPTQRPNICQVL 293
           D +     K LIS +L ++P+QRP + QVL
Sbjct: 249 DDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/339 (23%), Positives = 144/339 (42%), Gaps = 61/339 (17%)

Query: 13  TELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIAC-----LKRVLVPDKPSLN 67
           T + V   R +I + L  GG + +Y  ++    L     +A      LK+++ P+  S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  VLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQN 127
               E++  K  + + +V+  IDS   +    DGS  +++++ + + G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 128 R--LQEGEVLKITSDITQGIAAMHA---------------------------------LQ 152
              + E E ++I   + +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDI 201
             ++           HRDI   N+L S D    + D GS         N  +   +Q  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 LKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEK---VGEAAILHS- 257
             N T  Y APE++ L     ++ K DIW+LG   Y L +  +PFE+   +  A+I ++ 
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 258 ---RFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
              ++ FP   ++S+ L  +I   +  +P QRP   Q+L
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 80/331 (24%), Positives = 139/331 (41%), Gaps = 61/331 (18%)

Query: 15  LTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIA-----CLKRVLVPDKPSLNVL 69
           + V   R RI + L  GG + +Y  ++    L     IA      LK+++ P   S++  
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNG 82

Query: 70  RAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNR- 128
             E++  K  + + +V+  IDS   +    DGS  +++++ Y S G L D +N RL    
Sbjct: 83  MREIENYKRFQ-SPYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGT 139

Query: 129 -LQEGEVLKITSDITQGIAAMHA---------------------------------LQPP 154
            + E E ++I   +T+G+  +H                                  L+  
Sbjct: 140 FVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 155 LI-----------HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILK 203
           ++           HRDI   N+L S D    + D GS        +N  + + +Q  +  
Sbjct: 200 MLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVND 259

Query: 204 NTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEA-------AILH 256
           N T  Y  PE+++L     ++ K DIW+LG   Y L +  +PFE+  +        AI  
Sbjct: 260 NCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 257 SRFQFPSYPQYSDSLKHLISFMLSENPTQRP 287
            ++ FP   ++S+ L  +I   +  +P QRP
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 92.4 bits (228), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 97/197 (49%), Gaps = 24/197 (12%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +       + E +V  I  D  +G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMID-LYRGYPI 223
           +L++D    K+ DFG V G IR       F           T  + APE+I+   +GY  
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTF---------VGTPYWMAPEVINKQCKGY-- 191

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS------YPQYSDSLKHLISF 277
           NEK+DIW+LG+  Y+L     P  K     ++      P       + QYS+  K+ +S 
Sbjct: 192 NEKADIWSLGITAYELLKGVPPLSKYDPFKVM---LNIPKRKPPKLHGQYSEKAKYFVSL 248

Query: 278 MLSENPTQRPNICQVLE 294
            L ++P QRP+I  +LE
Sbjct: 249 CLIKDPKQRPSIEALLE 265

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 135/277 (48%), Gaps = 47/277 (16%)

Query: 31  GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQH--VVSY 88
           G    +Y A     D+S+   IA +K++ +  +P   ++  E+  MK   G++H  +V++
Sbjct: 636 GASGGVYIAN----DVSTNESIA-IKQMNLEKQPKKELIINEILVMK---GSKHPNIVNF 687

Query: 89  IDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAM 148
           IDS+     + DG  +++++MEY  GG L D +   +   L EG++  +  +   G+  +
Sbjct: 688 IDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLQFL 737

Query: 149 HALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA- 207
           H+    ++HRDIK +N+L+S +   K+ DFG  C              V    LK TT  
Sbjct: 738 HSKG--VLHRDIKSDNILLSINGNIKLTDFG-FCA------------QVNETTLKRTTMV 782

Query: 208 ---QYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAILHSRFQFP 262
               + APE++      P   K DIW+LG+ + ++     P+  E    A  L +    P
Sbjct: 783 GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTP 839

Query: 263 SYPQ---YSDSLKHLISFMLSENPTQRPNICQVLEEV 296
              +    SD LKH + + LS NP QR +  ++LE+V
Sbjct: 840 ELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 103/197 (52%), Gaps = 24/197 (12%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +    +  L E +V  IT +I +G+  +H+ +   IHRDIK  N
Sbjct: 105 MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAAN 162

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL-YRGYPI 223
           +L++DD   K+ DFG V G +   +    F           T  + APE+I    +GY  
Sbjct: 163 ILLTDDGKVKLGDFG-VSGQMMATRRRDTF---------VGTPFWMAPEVIARSEQGY-- 210

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSY------PQYSDSLKHLISF 277
           NEK+DIW+LG+ +++L     P  +     +L S    PS        +YS +++  +S 
Sbjct: 211 NEKADIWSLGITVFELLKGQPPLSQHDPMKVLMS---IPSRRPPKLEDRYSHAIREFVSL 267

Query: 278 MLSENPTQRPNICQVLE 294
            L+++P +RP   ++L+
Sbjct: 268 CLNKDPAKRPTASELLK 284

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 133/294 (45%), Gaps = 66/294 (22%)

Query: 17  VGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVP--DKPSLNVLRAEVD 74
           VG+++  I+K +  G F  +Y A      L  P      K+V++   DK   NV+R    
Sbjct: 36  VGNYK--ILKQIGEGSFGKVYLA------LHKPTH----KKVVLKSSDKTDPNVVR---- 79

Query: 75  AMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEV 134
             ++    Q    YI        V     +V++++EYC    L D++ ++   R+   E 
Sbjct: 80  --EIFYHRQFDFPYI---TKLYEVIITETKVWMVIEYCPNKELYDYLLSK--KRISLDES 132

Query: 135 LKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEF 194
            +I + I   +   H+L    +HRD+K+EN+L+  D   K+ DFG               
Sbjct: 133 ARIFAQIVGAVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDFG--------------- 175

Query: 195 NYVQHDILKNT-------TAQYRAPEMI--DLYRGYPINEKSDIWALGVFLYKLCYYTTP 245
                D  KNT       T  Y APE++  + Y GY I    DIWALG+ LY +   T P
Sbjct: 176 --FTRDFSKNTQLETICGTTVYMAPELLRREKYDGYKI----DIWALGILLYTIINGTMP 229

Query: 246 FE----KVGEAAILHSRFQFPSYPQ--YSDSLKHLISFMLSENPTQRPNICQVL 293
           F+    K  E  I+ +    P Y    ++D    L++ +LS++P+ RP I Q+L
Sbjct: 230 FDEDDPKKTELKIISAS---PDYDNKYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 101/207 (48%), Gaps = 47/207 (22%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           V++ +EYC G  L +++  +    L+E    ++ S I   +   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEE--CSELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAP 212
           +L+      K+ DFG            ++CG                      T  Y AP
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGILETICG----------------------TTVYMAP 196

Query: 213 EMIDL--YRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQF-PSYPQ-YS 268
           E+I+   Y GY I    D W+LG+ LY + + T PF++V E    +    + P+Y   Y 
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDNDYI 252

Query: 269 DSL-KHLISFMLSENPTQRPNICQVLE 294
           DS  K LIS +L ++P QRP++ QVL+
Sbjct: 253 DSNGKELISQLLEKDPNQRPSLTQVLQ 279

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 132/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A L    +  + +   L +E+   K ++ +Q+VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMK-HQNVV 142

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID     + V       ++L+E C  G L+D +  R    L E EV   T+ I   I 
Sbjct: 143 QFIDCFEDDTNV-------YILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG +  V+    N +E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 242

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+  + + DIW++GV LY L     PF+   +   ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGH--SYEVDIWSIGVMLYALLIGKPPFQS-KDVNTIYERIKCCDFS 299

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S+  K LI  +LS +P +RP+I ++++ V
Sbjct: 300 FPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/268 (29%), Positives = 126/268 (47%), Gaps = 32/268 (11%)

Query: 26  KYLTSGGFAHIYTAEICPADLSSPAKIACLKRV-LVPDKPSLNVLRAEVDAMKLLRGNQH 84
           K +  G F  +Y A     ++ S  KI  +K V L      + +L  E+  +  LR + +
Sbjct: 19  KCVGRGNFGDVYKA----VEIKS-GKIVAIKVVNLEHTNEDIELLSQEIFFLAELR-SPY 72

Query: 85  VVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQG 144
           V  Y+ +      + D S  ++++MEYC GG   D +    +  L E +   IT ++ +G
Sbjct: 73  VTKYLTTL-----LEDVS--IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKG 125

Query: 145 IAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKN 204
           +  +H  +   IHRDIK  N+L++DD   K+ DFG V G I+       F          
Sbjct: 126 LRYLHEQKK--IHRDIKAANILLTDDGMVKLGDFG-VSGQIKATLKKDTF---------V 173

Query: 205 TTAQYRAPEMIDLYR-GYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS---RFQ 260
            T  + APE++     GY  NEK+DIW+LG+ +Y+L     P  K     ++ S   R  
Sbjct: 174 GTPYWMAPEVVKKDESGY--NEKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRA 231

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPN 288
              +  YS+  K  IS  L ++P  RPN
Sbjct: 232 PKLHGHYSEDAKSFISHCLIKDPNARPN 259

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 137/334 (41%), Gaps = 62/334 (18%)

Query: 15  LTVGSHRARIIKYLTSGGFAHIYTAE-ICPADLSSPAK--IACLKRVLVP--DKPSLNVL 69
           L++   R  I K L    F+ IY  + I     SS  +  +  LKR+  P  +  S++  
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 70  RAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNR- 128
             EVD  K  + + +++  +DS  A+    DGS  V++L+ Y   G L D  +  L N  
Sbjct: 86  MKEVDNYKRFQ-SPYIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLLNGT 142

Query: 129 -LQEGEVLKITSDITQGIAAMHA---------------------------------LQPP 154
            + E E ++I   I +G+  +H                                  L+  
Sbjct: 143 FISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELD 202

Query: 155 LI------------HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
           ++            HRDIK  N+L S D    + + GS            +   +Q  + 
Sbjct: 203 ILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVS 262

Query: 203 KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEA-------AIL 255
            + T  Y APE++ +     ++ K DIW+LG   Y + +  +PFE+  +        AI 
Sbjct: 263 DHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIG 322

Query: 256 HSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNI 289
              F FPS  +YS+ L  LI+  L  NP  RP+I
Sbjct: 323 TGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 117/242 (48%), Gaps = 46/242 (19%)

Query: 72  EVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQE 131
           E++  KL+ G+++++S ID     + +       ++++E C  G L D +  R +  L+E
Sbjct: 99  EIEIHKLVNGHKNIISMIDHFEIDATM-------YMVLELCGAGSLYDII-CRSKRSLRE 150

Query: 132 GEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNP 191
            E  ++   +   +  +H  +  ++H D+K+ N+LI      ++CDFG            
Sbjct: 151 WEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH----------- 197

Query: 192 QEFNYVQHDILKNT-----TAQYRAPEMI---------DLYRGYPINEKSDIWALGVFLY 237
              ++V  DI  N+     T  Y +PE+I         DLY  +P  ++SDIW++G+ LY
Sbjct: 198 ---SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLY--FP--KESDIWSIGIVLY 250

Query: 238 KLCYYTTPFE----KVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
            + +  TPFE    +     I+  ++ F    + S+ +K LI  +L   P +R  I +++
Sbjct: 251 AMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIV 310

Query: 294 EE 295
            +
Sbjct: 311 SD 312

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 88/316 (27%), Positives = 143/316 (45%), Gaps = 75/316 (23%)

Query: 1   MNQSLNDIYQPGT--ELT-VGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKR 57
           +  S N +Y   T  ELT VG+++  I+K +  G F  +Y A   P       +  CLK 
Sbjct: 19  IGSSYNRLYSQFTSDELTEVGNYK--ILKQVGEGSFGKVYLALHRPT-----HRKVCLK- 70

Query: 58  VLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGL 117
               DK   N++R      ++    Q    YI        V     +V++ +EYC G  L
Sbjct: 71  --TSDKNDPNIVR------EVFYHRQFDFPYITKLYE---VIVTETKVWMALEYCPGKEL 119

Query: 118 IDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCD 177
            D + +   +R+   E  ++ + I+  +   H++    +HRD+K+EN+L+  +   K+ D
Sbjct: 120 YDHLLS--LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTD 175

Query: 178 FG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMID--LYRGYPI 223
           FG            +VCG                      T  Y APE+I+   Y G+ I
Sbjct: 176 FGFTRECMTKTTLETVCG----------------------TTVYMAPELIERRTYDGFKI 213

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS-YPQYSDSL-----KHLISF 277
               DIW+LGV LY L   + PF+   E   + ++++  +  P Y  +L     K LIS 
Sbjct: 214 ----DIWSLGVILYTLITGSLPFDDDDE---VKTKWKIVNEEPNYDSTLIPDDAKDLISR 266

Query: 278 MLSENPTQRPNICQVL 293
           +L++NP +RP++ QVL
Sbjct: 267 LLAKNPKERPSLPQVL 282

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 98/197 (49%), Gaps = 24/197 (12%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +     N + E +V  ITS + +G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHEQKK--IHRDIKAAN 143

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYR-GYPI 223
           +L++D+ T K+ DFG V G IR       F           T  + APE++     GY  
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGTF---------VGTPYWMAPEVVSKENDGY-- 191

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS------YPQYSDSLKHLISF 277
           +EK+DIW+LG+ +Y+L     P  K     ++      P       +  YS S K+ +S 
Sbjct: 192 DEKADIWSLGITVYELLKGAPPLSKCDPMKVM---INLPKRKPPALHGHYSHSAKNFVSS 248

Query: 278 MLSENPTQRPNICQVLE 294
            L +NP  R +  +++E
Sbjct: 249 CLVKNPVGRASAYEMVE 265

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 130/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A   ++ +  + +   L +E+   K ++ + ++V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMK-HSNIV 155

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID         +    V++L+E C  G L+D +  R    L E EV   T+ I   I 
Sbjct: 156 QFID-------CFEDDANVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            +H+ +  +IHRD+K+ N+    D   KV DFG +  V+    N +E  Y         T
Sbjct: 207 YLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANDRERKYTVCG-----T 255

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+    + DIW++GV +Y L     PF+   +  +++ R     + 
Sbjct: 256 PNYIAPEVLMGKHSGHSF--EVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYERIKLCKYG 312

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           +P     S   + LI  +LS NP QRP I  ++++V
Sbjct: 313 YPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 129/280 (46%), Gaps = 40/280 (14%)

Query: 31  GGFAHIYTAEICPADLSSPAKIACLKRV-LVPDKPSLNVLRAEVDAMKLLRGNQHVVSYI 89
           G F  +Y A  C        K+  +K V L      +N+L  E+  +  L+ + ++ +YI
Sbjct: 26  GNFGDVYKA--CE---KVSGKVVAVKVVNLEHTDEDINLLAQEIFFLAELK-SPYITNYI 79

Query: 90  DSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMH 149
            +             ++++MEYC GG   D +       L E +   IT ++ +G+  +H
Sbjct: 80  TTMTE-------DVSMWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLH 132

Query: 150 ALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQY 209
             +   IHRDIK  N+L++D+   K+ DFG V G IR       F           T  +
Sbjct: 133 EQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATLKRGTF---------VGTPFW 180

Query: 210 RAPEMIDL-YRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS----- 263
            APE++     GY  +EK+DIW+LG+ +Y+L   + P  K     ++      P      
Sbjct: 181 MAPEVVSKDSDGY--DEKADIWSLGITVYELLKGSPPLYKCDPMKVM---VNLPKRKPPV 235

Query: 264 -YPQYSDSLKHLISFMLSENPTQRPNICQVL--EEVSRIQ 300
            +  YS + KH ++  L +NP  RP+  ++L  E V+ +Q
Sbjct: 236 LHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 103/205 (50%), Gaps = 30/205 (14%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY    E++++MEYC+GG L   +      ++ E  +  I  ++   IA MH  +  +I
Sbjct: 83  GSYLNNTELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMHIHKDGVI 137

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA---QYRAPE 213
           HRDIK  NVLI++D   K+CDFG    +             Q  I + T A    + APE
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAAQL------------SQTKIRRQTMAGTPYWMAPE 185

Query: 214 MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVG--EAAILHSRFQFPSYP--QYSD 269
           +I    G   + K DIW+LG+  Y++     P+  V    A  L ++ + P     Q+S 
Sbjct: 186 VI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRQHSS 243

Query: 270 SLKHLISFMLSENPTQRPNICQVLE 294
           +LK  I+  L E+P +RP+  ++L+
Sbjct: 244 ALKEFIALCLDEDPKERPSAEELLK 268

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 127/269 (47%), Gaps = 31/269 (11%)

Query: 31  GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYID 90
           G F  +Y A     D  +   +A     L      +++L  E+  +  L+ + ++++YI 
Sbjct: 25  GNFGDVYKA----IDNITKKYVAIKVINLEYSDEDIDLLAQEIFFLAELKSD-YIINYIT 79

Query: 91  SHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHA 150
           +      + D S  ++++M+YC GG   D +     N + E +V  I  ++  G+  +H 
Sbjct: 80  TI-----MEDVS--MWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLHE 132

Query: 151 LQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYR 210
            +   IHRDIK  N+L++DD   K+ DFG V G I+       F           T  + 
Sbjct: 133 QKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIKATLKRDTF---------VGTPYWM 180

Query: 211 APEMI--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS---YP 265
           APE+I  ++  GY  +EK DIW+LG+  Y+L     P  K     ++ S  +      + 
Sbjct: 181 APEVINKEINNGY--DEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHG 238

Query: 266 QYSDSLKHLISFMLSENPTQRPNICQVLE 294
            Y+D  K  ISF L ++P  RPN+  +L+
Sbjct: 239 PYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +    D+ +   +A   +  +  + +   L +E+   K +  + ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID     S V       ++L+E C  G L++ +  R    L E EV   T+ I   I 
Sbjct: 143 QFIDCFEDDSNV-------YILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG +  V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+    + DIW+LGV LY L     PF+   +   ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGHSF--EVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     SD  K LI  +LS +P +RP++ ++++ V
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 143/302 (47%), Gaps = 38/302 (12%)

Query: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRV-L 59
           M+  L  I +  T     +H   + + +  G F  +Y A     D ++  K+  +K V L
Sbjct: 1   MHDKLLSIRREYTPRISKAHNYIVKECVGRGNFGDVYRA----IDRTT-NKVVAIKVVDL 55

Query: 60  VPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLID 119
                 L VL  E+  +  L+ + ++++YI +      + D S  ++++MEYC GG   D
Sbjct: 56  ENTNERLEVLAQEIFFLAELK-SPYIINYITTL-----LEDAS--MWIVMEYCGGGSCSD 107

Query: 120 FMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFG 179
            +     N L E +V  IT +I +G+  +H  +   IHRDIK  N+L++++   K+ DFG
Sbjct: 108 LLKYYFNNGLPEKKVAYITREILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG 165

Query: 180 SVCGVIRPPKNPQEFNYVQHDILKNT---TAQYRAPEMIDL-YRGYPINEKSDIWALGVF 235
            V G ++              + + T   T  + APE+      GY  +EK DIW+LG+ 
Sbjct: 166 -VSGQLK------------STLRRGTIVGTPYWMAPEVASQNIEGY--DEKIDIWSLGIT 210

Query: 236 LYKLCYYTTPFEKVGEAAILH--SRFQFPSYP-QYSDSLKHLISFMLSENPTQRPNICQV 292
           +++L     P  K+    +L   SR   P     YSD+ K  ++  L +NP +RP    +
Sbjct: 211 VFELLKGVPPLVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDL 270

Query: 293 LE 294
           L+
Sbjct: 271 LK 272

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 132/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A L    +  + +   L +E+   K +R + ++V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMR-HANIV 161

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID    ++ V       ++L+E C  G L++ +  R    L E EV   T+ I  GI 
Sbjct: 162 QFIDCFEDETNV-------YILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG +  V+    N +E  Y         T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYTVCG-----T 261

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+  + + DIW++GV +Y L     PF+   +   ++ R     F 
Sbjct: 262 PNYIAPEVLMGKHSGH--SYEVDIWSIGVMIYALLIGKPPFQ-AKDVNTIYERIKCCDFV 318

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S   + L+  +LS +P +RP+I +VL+ V
Sbjct: 319 FPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 83/183 (45%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFK 174
            G ID  +   L+N + E EV  I   I  GI  +H     +IHRDIK ENV++      K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  VCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI--DLYRGYPINEKSDIWAL 232
            + DFGS   V   P           D+   T   Y APE++  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQV 292
            G+ LY + +   PF  + E  IL     F      S   K LIS +L+ N  +RP I  +
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDI 1432

Query: 293  LEE 295
              +
Sbjct: 1433 YND 1435

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 80/290 (27%), Positives = 133/290 (45%), Gaps = 38/290 (13%)

Query: 10  QPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVL 69
           Q  +E +V  H  ++I     G +  +Y A     D     ++  +K ++  +   LN +
Sbjct: 16  QRASEKSVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDI 67

Query: 70  RAEVDAMKLLRGNQH-VVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNR 128
            AE+  +K L  N H +V Y        G    SYE+++L+EYC+ G L   + +R    
Sbjct: 68  MAEISLLKNL--NHHNIVKY-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTG 117

Query: 129 LQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPP 188
           L E E     +    G+  +H     +IHRDIK  N+L+S D T K+ DFG V  ++   
Sbjct: 118 LSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSS 174

Query: 189 KNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEK 248
                       +    T  + APE++   RG   +  SDIW+LG  + ++     P+  
Sbjct: 175 A-----------LTLAGTLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHN 220

Query: 249 VGEAAILHSRFQFPSYP--QYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           + +A I ++      YP   +S+SLK  +S    +N  +RP   Q+L+ V
Sbjct: 221 LTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A   ++ +  + +   L +E+   K +R + ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMR-HPNIV 133

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            + D         +    V++L+E C  G L+D +  R Q  L E EV   T+ I   I 
Sbjct: 134 QFTD-------CFEDDTNVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---ANDRERKYTI-----CGT 233

Query: 207 AQYRAPEMID-LYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE++   + G+    + D+W++GV +Y L     PF+   E   ++ R     F 
Sbjct: 234 PNYIAPEVLTGKHTGHSF--EVDVWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDFN 290

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S   K LI  +LS +P +RP++ +++E V
Sbjct: 291 FPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 82/350 (23%), Positives = 143/350 (40%), Gaps = 67/350 (19%)

Query: 12  GTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRA 71
           G  +++      +   L  G    +Y  + CP   S    +  LK+V  P   +  V RA
Sbjct: 21  GVRISINGKSYLVTTLLREGELTALYQVK-CPKR-SHSGGVYALKKVTCPIGRADFVTRA 78

Query: 72  EVDAMKLLRGNQ-HVVSYIDSHAAKSGVHD-GSYEVFLLMEYCSGGGLIDFMNTRL--QN 127
             +     R N  ++ + +D   A+   HD G+  +++L+ Y   G L D +N  +   +
Sbjct: 79  MTEISNYQRFNSPYITNILDFQVAQ---HDNGTKIIYMLLPYFPAGSLQDLINNMIIRGD 135

Query: 128 RLQEGEVLKITSDITQGIAAMH-------------------------------------A 150
            L E  V+++  DI +G+  MH                                      
Sbjct: 136 SLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDL 195

Query: 151 LQPPL--------IHRDIKIENVLISDDRTFKVCDFGSVCGVIRPP---KNPQEFNYVQH 199
           L PPL        +H  +  EN+++S +    + +  S    +R P    +  +   +Q 
Sbjct: 196 LSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLGLQE 252

Query: 200 DILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF---EKVGEAAILH 256
            + +N+   Y  PE++DL+    I  + DIW+LG   Y L Y  + F   +++    I H
Sbjct: 253 WLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKH 312

Query: 257 S----RFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGT 302
           S     F FP  P+YS SLK ++   L  +P +RP+I + L +   +  T
Sbjct: 313 SISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQELLDT 362

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 131/290 (45%), Gaps = 37/290 (12%)

Query: 11  PGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLR 70
           P T +   S    I + +  G F  +Y A     D  +   +A     L   +  ++VL 
Sbjct: 25  PDTAVEKPSQLYDIKECVGKGSFGDVYRA----IDKETGEMVAVKIINLEETQDDIDVLA 80

Query: 71  AEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQ 130
            E+  +  LR    V +Y      K+ V D S  ++++ME+C GG   D +    ++RL 
Sbjct: 81  QEIYFLSELRA-PFVTTYY-----KTYVEDVS--MWIVMEFCGGGSCADLLKHLPEHRLP 132

Query: 131 EGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKN 190
           E +V  I  ++  G+  +H+ +   IHRD+K  N+L++D+   K+ DFG V G I     
Sbjct: 133 ENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQIMATLK 189

Query: 191 PQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVG 250
              F           T  + APE+I    GY  +EK+DIW+LG+   +L     P+ K  
Sbjct: 190 RNTF---------VGTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAKYD 238

Query: 251 EAAILHS-------RFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
              +L +       R Q     +++ S +  I+  L+++P  RP    +L
Sbjct: 239 PMKVLMNIPLRKPPRLQ----GRFTSSARDFIALCLTKDPALRPTASDLL 284

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 91/318 (28%), Positives = 143/318 (44%), Gaps = 79/318 (24%)

Query: 1   MNQSLNDIYQPGT--ELT-VGSHRARIIKYLTSGGFAHIYTAEICPADLSSPA-KIACLK 56
           +  S N +Y   T  ELT VG+++  I+K +  G F  +Y A      L  P  +  CLK
Sbjct: 19  IGSSYNRLYSQFTSDELTEVGNYK--ILKQIGEGSFGKVYLA------LHRPTHRKVCLK 70

Query: 57  RVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGG 116
                DK   N++R      ++    Q    YI        V     +V++ +EYC G  
Sbjct: 71  ---TSDKNDPNIVR------EVFYHRQFDFPYITKLYE---VIVTESKVWMALEYCPGKE 118

Query: 117 LIDFMNTRLQNRLQE-GEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKV 175
           L D + +  +  L E GE+    + I+  +   H++    +HRD+K+EN+L+  +   K+
Sbjct: 119 LYDHLLSLRRISLLECGELF---AQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKL 173

Query: 176 CDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMID--LYRGY 221
            DFG            +VCG                      T  Y APE+I+   Y G+
Sbjct: 174 TDFGFTRECMTKTTLETVCG----------------------TTVYMAPELIERRTYDGF 211

Query: 222 PINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS-YPQYS-----DSLKHLI 275
            I    DIW+LGV LY L     PF+   EA    ++++  +  P+Y      D  + LI
Sbjct: 212 KI----DIWSLGVILYTLITGYLPFDDDDEA---KTKWKIVNEEPKYDAKVIPDDARDLI 264

Query: 276 SFMLSENPTQRPNICQVL 293
           S +L++NP +RP++ QVL
Sbjct: 265 SRLLAKNPGERPSLSQVL 282

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +        + +   +A L    +  + +   L +E+   K ++ N ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMK-NVNIV 143

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID     + V       ++L+E C  G L+D +  R    L E EV   T+ I   I 
Sbjct: 144 QFIDCFEDDTNV-------YILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    D   K+ DFG +  V+    N +E  Y         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 243

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+  + + DIW++GV LY L     PF+   +   ++ R     F 
Sbjct: 244 PNYIAPEVLMGKHTGH--SYEVDIWSIGVMLYALLIGKPPFQS-KDVNTIYERIKCCDFT 300

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S   K LI  +LS +P +RP++ ++++ V
Sbjct: 301 FPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 133/276 (48%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A   ++ +  + +   L +E+   K ++ + ++V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMK-HPNIV 152

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            ++D     + V       ++L+E CS G L+D M  R    L E EV   T+ I   + 
Sbjct: 153 HFVDCFEDDTNV-------YILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    D   KV DFG +  V+    N +E  Y         T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANNRERKYTV-----CGT 252

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+    + DIW++GV +Y L     PF+   +  +++ R     + 
Sbjct: 253 PNYIAPEVLMGKHAGHSF--EVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYDRIKACQYG 309

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           +P     S   K LI+ +L  +P +RP+I +++++V
Sbjct: 310 YPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 125/260 (48%), Gaps = 38/260 (14%)

Query: 50   AKIACLKRVLVP-----DKPSLNVL---RAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDG 101
             ++  +K+V VP     D+ +L+VL   R+EV  +K L  + ++V Y+       G  + 
Sbjct: 1169 GEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDL-DHTNIVQYL-------GFENK 1220

Query: 102  SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
            +Y   L +EY +GG +   +  RL  +  E  +  +   + +G++ +H+ +  ++HRD+K
Sbjct: 1221 NYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHSKK--ILHRDMK 1276

Query: 162  IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGY 221
             +N+L+  D   K+ DF    G+ +   N     Y   D+    T  + APEM+D  +GY
Sbjct: 1277 ADNLLLDVDGICKISDF----GISKKSNNI----YSNSDMTMRGTVFWMAPEMVDTKQGY 1328

Query: 222  PINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSE 281
              + K DIW+LG  + ++     P+  +   A +    +F S P   +  + +IS    E
Sbjct: 1329 --SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKE 1386

Query: 282  --------NPTQRPNICQVL 293
                    NP +RP   ++L
Sbjct: 1387 FLDACFEINPEKRPTADELL 1406

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A   ++ +  + +   L +E+   K ++ + ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HPNIV 133

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            + D         +    V++L+E C  G L+D +  R Q  L E EV   T+ I   I 
Sbjct: 134 QFTD-------CFEDDTNVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---ANDRERKYTI-----CGT 233

Query: 207 AQYRAPEMID-LYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE++   + G+    + DIW++GV +Y L     PF+   E   ++ R     F 
Sbjct: 234 PNYIAPEVLTGKHTGHSF--EVDIWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDFS 290

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S   K LI  +LS +P +RP++ +++E V
Sbjct: 291 FPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 85/319 (26%), Positives = 136/319 (42%), Gaps = 66/319 (20%)

Query: 9   YQPGTELTVGSH-RARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLN 67
           ++ G  L  GS  R R+ K + SG  A I   +I P            KR +  ++  + 
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMQSGKLAAI---KIVP------------KRNVRHNQKQVT 105

Query: 68  VL----RAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNT 123
            L      E+  MKL+     +  Y         V +   E++L++EY  GG L D++  
Sbjct: 106 ALPYGIEREIIIMKLITHPNIMALY--------EVWENKSELYLVLEYVEGGELFDYLIA 157

Query: 124 RLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLIS-DDRTFKVCDFGSVC 182
           R   +L E E +     I QG++  H     + HRD+K EN+L+   ++T K+ DFG   
Sbjct: 158 R--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPENLLLDKKNKTVKIADFGMAA 213

Query: 183 GVIRPPKNPQEFNYVQHDILKNTTA--QYRAPEMI--DLYRGYPINEKSDIWALGVFLYK 238
                           + +L+ +     Y +PE++    Y G P    SD+W+ G+ L+ 
Sbjct: 214 L------------ETTNRLLETSCGSPHYASPEIVMGQKYHGSP----SDVWSCGIILFA 257

Query: 239 LCYYTTPFEKVGEAAIL----HSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLE 294
           L     PF       +L    H R+Q PS    S   K LIS +L  +P +R  + ++LE
Sbjct: 258 LLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKDLISKILVVDPEKRITVDKILE 315

Query: 295 EVSRIQ-------GTPCPL 306
               ++       G  CPL
Sbjct: 316 HPLLVKYDNPGKGGLACPL 334

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 96/214 (44%), Gaps = 61/214 (28%)

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D + ++  +RL   E  ++ + IT  +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 164 NVLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRA 211
           NVL+  +   K+ DFG            +VCG                      T  Y A
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLETVCG----------------------TTVYMA 200

Query: 212 PEMIDL--YRGYPINEKSDIWALGVFLYKLCYYTTPFEK----------VGEAAILHSRF 259
           PEMI    Y G+ +    DIW+LGV LY L     PF++          + +  ++  R 
Sbjct: 201 PEMIQHKPYDGFKV----DIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERI 256

Query: 260 QFPSYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
             P         ++LI  +LS++PT+RPN   +L
Sbjct: 257 TIP-------EAQNLIEQLLSKDPTERPNTSAIL 283

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 84.7 bits (208), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 144/333 (43%), Gaps = 61/333 (18%)

Query: 13  TELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIA-----CLKRVLVPDKPSLN 67
           T + V   R +I + L  GG + +Y  ++    L     I       LK+++ P   S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  VLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQN 127
               E++  K  + + +V+  IDS   +    +GS  +++++ Y S G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 R--LQEGEVLKITSDITQGIAAMH-------ALQP----------------------PL- 155
              + E E ++I   +T+G+  +H        + P                      PL 
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 156 --------------IHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDI 201
                          HRDI   N+L S +    + D GS         +  + + +Q  +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 LKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEK---VGEAAILHS- 257
             N T  Y APE+++L     ++ K DIW++G   Y L +  +PFE+   +  A+I ++ 
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 258 ---RFQFPSYPQYSDSLKHLISFMLSENPTQRP 287
              ++ FP   ++S++L ++I   +  +P QRP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +    ++ +   +A   +  +  + +   L +E+   K +  + ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            ++D     S V       ++L+E C  G L++ +  R    L E EV   T+ I   I 
Sbjct: 143 QFVDCFEDDSNV-------YILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG +  V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+    + DIW+LGV LY L     PF+   +   ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGHSF--EVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     SD  K LI  +LS +P +RP++ ++++ V
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +    ++ +   +A   +  +  + +   L +E+   K +  + ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID     S V       ++L+E C  G L++ +  R    L E EV   T+ I   I 
Sbjct: 143 QFIDCFEDDSNV-------YILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG +  V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+    + DIW+LGV LY L     PF+   +   ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGHSF--EVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     SD  K LI  +LS +P +RP++ ++++ V
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 89/317 (28%), Positives = 142/317 (44%), Gaps = 77/317 (24%)

Query: 1   MNQSLNDIYQPGT--ELT-VGSHRARIIKYLTSGGFAHIYTAEICPADLSSPA-KIACLK 56
           +  S N +Y   T  ELT VG+++  I+K +  G F  +Y A      L  P  +  CLK
Sbjct: 19  IGSSYNRLYSQFTSDELTEVGNYK--ILKQIGEGSFGKVYLA------LHRPTHRKVCLK 70

Query: 57  RVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGG 116
                DK   N++R      ++    Q    YI        V     +V++ +EYC G  
Sbjct: 71  ---TSDKNDPNIVR------EVFYHRQFDFPYITKLYE---VIVTESKVWMALEYCPGKE 118

Query: 117 LIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVC 176
           L D + +   +R+   E  ++ + I+  +   H++    +HRD+K+EN+L+  +   K+ 
Sbjct: 119 LYDHLLS--LHRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLT 174

Query: 177 DFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI--DLYRGYP 222
           DFG            +VCG                      T  Y APE+I    Y G+ 
Sbjct: 175 DFGFTRECMTKTTLETVCG----------------------TTVYMAPELIGRKTYDGFK 212

Query: 223 INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS-YPQYS-----DSLKHLIS 276
           I    D W+LGV LY L   + PF+   EA    ++++  +  P+Y      D  K LIS
Sbjct: 213 I----DTWSLGVILYTLITGSLPFDDDDEA---KTKWKIVNEEPKYDPKLIPDDAKDLIS 265

Query: 277 FMLSENPTQRPNICQVL 293
            +L++NP +RP++ QVL
Sbjct: 266 RLLAKNPGERPSLPQVL 282

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/322 (24%), Positives = 141/322 (43%), Gaps = 67/322 (20%)

Query: 15  LTVGSHRARIIKYLTSGGFAHIYTAEIC----PADLSSPA---KIACLKRVLVPDKPSLN 67
           +T+G     I K +  G FA ++ A +       DL+SP     I  + R  + +K  L 
Sbjct: 30  ITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPPLNFAIKIVSRSKLKNKKLLE 89

Query: 68  VLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQ- 126
            L  E+  +K +  + H+V  ID     +       + +L+MEYC+ G L   +  R + 
Sbjct: 90  NLEIEIAILKKI-NHPHIVKLIDCERTTT-------DFYLIMEYCALGDLTFLIKKRHEL 141

Query: 127 ---------------------NRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENV 165
                                N L    +L     +   +  + +    L+HRDIK +N+
Sbjct: 142 IKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRS--KNLVHRDIKPQNL 199

Query: 166 LI-------SDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ--------YR 210
           L+       +D + FK   F  +  +  P     +F + +   L NT+          Y 
Sbjct: 200 LLLTPLINYNDSKAFKKLGFIGIYEL--PILKIADFGFAR--FLPNTSMAETLCGSPLYM 255

Query: 211 APEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL------HSRFQFPSY 264
           APE+++ Y+ Y  N K+D+W++G  LY++CY T PF+      +       +++  FP+Y
Sbjct: 256 APEILN-YQKY--NAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNY 312

Query: 265 PQYSDSLKHLISFMLSENPTQR 286
            Q  + +K LIS +L+ +P +R
Sbjct: 313 IQIQNDMKILISKLLTFDPQRR 334

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 131/279 (46%), Gaps = 43/279 (15%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLN--------VLRAEVDAMKLLRGN 82
            G F  +Y   +C  ++++  ++  +K+V VP   S N         LR+EV  +K L  +
Sbjct: 1187 GSFGAVY---LC-LNVTT-GEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL-DH 1240

Query: 83   QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
             ++V Y+       G  + +    L +EY +GG +   +  R+  R  E  +  +T+ + 
Sbjct: 1241 LNIVQYL-------GFENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDESLIRHLTTQVL 1291

Query: 143  QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
            +G+A +H+    ++HRD+K +N+L+  D   K+ DF    G+ R  K+     Y   D+ 
Sbjct: 1292 KGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMT 1341

Query: 203  KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP 262
               T  + APEM+D  +GY  + K DIW+LG  + ++     P+  +   A +    +  
Sbjct: 1342 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1399

Query: 263  SYPQYSDSLKHLI-----SFM---LSENPTQRPNICQVL 293
            S P   +    LI     SF+      NP +RP   ++L
Sbjct: 1400 SAPPIPEDTLPLISQVGRSFLDACFEINPEERPTATELL 1438

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 132/289 (45%), Gaps = 36/289 (12%)

Query: 10  QPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVL 69
           Q  +E +V  H  ++I     G +  +Y A     D     ++  +K V+  +   LN +
Sbjct: 16  QRASEKSVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEVVYENDEELNDI 67

Query: 70  RAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRL 129
            AE+  +K L  N ++V Y        G    SYE+++L+EYC+ G L   + +R    L
Sbjct: 68  MAEISLLKNLNHN-NIVKY-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGL 118

Query: 130 QEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPK 189
            E E     +    G+  +H     +IHRDIK  N+L+S D T K+ DFG V  ++    
Sbjct: 119 SENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA 175

Query: 190 NPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKV 249
                      +    T  + APE++   RG   +  SDIW+LG  + ++     P+  +
Sbjct: 176 -----------LTLAGTLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNL 221

Query: 250 GEAAILHSRFQFPSYP--QYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
            +A I ++      YP   +S+ LK  +S    +N  +RP   Q+L+ V
Sbjct: 222 TDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +    ++ +   +A   +  +  + +   L +E+   K +  + ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID     S V       ++L+E C  G L++ +  R    L E EV   T+ I   I 
Sbjct: 143 QFIDCFEDDSNV-------YILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG +  V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+    + DIW+LGV LY L     PF+   +   ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGHSF--EVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     SD  K LI  +LS +P +RP++ ++++ V
Sbjct: 300 FPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 125/271 (46%), Gaps = 29/271 (10%)

Query: 28  LTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVS 87
           L  GGFA  +  +     +S   KI   K+ +  ++    +L +E+   + LR   H+V 
Sbjct: 99  LGEGGFARCFHIKD-DVGISFACKIVS-KKSIKTERTKFKLL-SEIQIHQNLRY-SHIVK 154

Query: 88  YIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAA 147
           ++D         +    V++L+E C  G L+D +  R    L E EV  +T+ +   I  
Sbjct: 155 FMDCF-------EDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGAINY 205

Query: 148 MHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA 207
           MH+    +IHRD+K+ NV    +   K+ DFG    +     N  E  Y         T 
Sbjct: 206 MHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG-----TP 254

Query: 208 QYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILH----SRFQFPS 263
            Y APE+I L +    + ++DIW+LG+ +Y +     PF+      I       +++FP 
Sbjct: 255 NYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYEFPP 313

Query: 264 YPQYSDSLKHLISFMLSENPTQRPNICQVLE 294
               ++ +K LI  +L  +P+QRP I  +L+
Sbjct: 314 DKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 103/205 (50%), Gaps = 30/205 (14%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY    +++++MEYC+GG L   +      ++ E  +  I  ++    A MH  +  +I
Sbjct: 83  GSYLNDTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALMHIHKDGVI 137

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA---QYRAPE 213
           HRDIK  NVLI++D   K+CDFG    +             Q  I + T A    + APE
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAAQL------------SQTKIRRQTMAGTPYWMAPE 185

Query: 214 MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVG--EAAILHSRFQFPSYP--QYSD 269
           +I    G   + K DIW+LG+  Y++     P+ +V    A  L ++ + P     Q+S 
Sbjct: 186 VI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSS 243

Query: 270 SLKHLISFMLSENPTQRPNICQVLE 294
           +LK +I+  L E+P +RP+   +L+
Sbjct: 244 ALKEIIALCLDEDPKERPSAEDLLK 268

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 131/277 (47%), Gaps = 33/277 (11%)

Query: 26  KYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHV 85
           ++L  GGFA  +  +     + +   +A   ++ +  + +   L +E+   K +  + ++
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-SHTNI 140

Query: 86  VSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGI 145
           V +ID         + +  V++L+E C  G L++ +  R    + E EV    + I  GI
Sbjct: 141 VQFID-------CFEDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNT 205
             MH+ +  +IHRD+K+ N+   +    K+ DFG     +      ++F           
Sbjct: 192 QYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG--LAAVLANDRERKFTIC-------G 240

Query: 206 TAQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----F 259
           T  Y APE ++  + G+  + + DIW++GV LY L     PF+   +   ++ R     F
Sbjct: 241 TPNYIAPEVLMGKHSGH--SYEVDIWSIGVMLYALLIGKPPFQ-AKDVNTIYERIKQRNF 297

Query: 260 QFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
            +P   + S   K+LI  +LS NP +RP+I ++++ V
Sbjct: 298 AYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 135/282 (47%), Gaps = 39/282 (13%)

Query: 19  SHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKL 78
           S   R +  +  G    +YTA     +L + A +A +K++ +  +P   ++  E+  MK 
Sbjct: 326 SRMYRNLIKIGQGASGGVYTA----YELGTNASVA-IKQMNLEKQPKKELIINEILVMK- 379

Query: 79  LRGNQH--VVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLK 136
             G++H  +V++IDS+  K        +++++MEY  GG L D +   +   L EG++  
Sbjct: 380 --GSKHSNIVNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGA 427

Query: 137 ITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNY 196
           +  +  +G+  +H+    +IHRDIK +N+L+S +   K+ DFG  C  I       E N 
Sbjct: 428 VCRETLKGLQFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQIN------EVNL 478

Query: 197 VQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAI 254
            +  ++   T  + APE++      P   K DIW+LG+ + ++     P+  E    A  
Sbjct: 479 KRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALY 533

Query: 255 LHSRFQFPSY---PQYSDSLKHLISFMLSENPTQRPNICQVL 293
           L +    P        SD+LK  + + L  +P  R N  ++L
Sbjct: 534 LIATNGTPKLKDPENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 142/301 (47%), Gaps = 38/301 (12%)

Query: 3   QSLNDIYQPGTELTVGSHRARIIKYLTS---GGFAHIYTAEICPADLSSPAKIACLKRVL 59
           + +  +Y   TE+      +++ K L     G    +YTA     ++ + A +A +K++ 
Sbjct: 645 KKIQQLYSKLTEICTDGDPSKLYKNLIKIGQGASGGVYTA----YEVGTNASVA-IKQMN 699

Query: 60  VPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLID 119
           +  +P   ++  E+  MK  + + ++V++IDS+  +        +++++MEY  GG L D
Sbjct: 700 LEKQPKKELIINEILVMKASK-HANIVNFIDSYLLRG-------DLWVVMEYMEGGSLTD 751

Query: 120 FMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFG 179
            +   +   L EG++  ++ +  +G+  +H+    +IHRDIK +NVL+S     K+ DFG
Sbjct: 752 VVTHCI---LTEGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNVLLSMSGEIKLTDFG 806

Query: 180 SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKL 239
             C  I       E N  +  ++   T  + APE++      P   K DIW+LG+ + ++
Sbjct: 807 -FCAQI------NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEM 854

Query: 240 CYYTTPF--EKVGEAAILHSRFQFPSYPQ---YSDSLKHLISFMLSENPTQRPNICQVLE 294
                P+  E    A  L +    P        SD LK  + + L  NP +R    Q+L 
Sbjct: 855 IEGEPPYLNETPLRALYLIATNGTPELKDADSLSDDLKSFLGWCLHVNPDERATASQLLS 914

Query: 295 E 295
           +
Sbjct: 915 D 915

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 100/205 (48%), Gaps = 31/205 (15%)

Query: 98  VHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIH 157
           V + + E++L++EY  GG L D++ ++   +L E E +     I  GI+  H+    + H
Sbjct: 203 VWENNNELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICH 258

Query: 158 RDIKIENVLISDD-RTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA--QYRAPEM 214
           RD+K EN+L+    R  K+ DFG                 V + +L+ +     Y +PE+
Sbjct: 259 RDLKPENLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEI 306

Query: 215 I--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL----HSRFQFPSYPQYS 268
           +    Y G P    SDIW+ G+ L+ L     PF       +L    + R+Q PSY   S
Sbjct: 307 VMGKCYNGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--IS 360

Query: 269 DSLKHLISFMLSENPTQRPNICQVL 293
              K+LIS +L  +P++R +  Q+L
Sbjct: 361 QEAKNLISRILVVDPSKRISTEQIL 385

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 90/333 (27%), Positives = 144/333 (43%), Gaps = 77/333 (23%)

Query: 13  TELTVGSHRARIIKYLTSGGFAHIYTAE-ICP---------ADLSSPAKIACLKRVLVP- 61
           T + VGS R  + K +  G FA ++ A  I P          D SS     C    +VP 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 62  ----DKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGL 117
               +K  L  L  E+  +K +  + H+V  ID           S + +L+MEYCS G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLID-------FERTSKDFYLIMEYCSLGDL 140

Query: 118 IDFMNTRLQ----------------------NRLQEGEVLKITSDITQGIAAMHALQPPL 155
              +  R Q                      N L +  +L     ++  +  + +    L
Sbjct: 141 TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN--L 198

Query: 156 IHRDIKIENVLIS-------DDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ 208
           +HRDIK +N+L+S       D ++F   D G V     P     +F + +   L NT+  
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFH--DLGFVGIYNLPILKIADFGFAR--FLPNTSMA 254

Query: 209 --------YRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ 260
                   Y APE+++ Y+ Y  N K+D+W++G  LY++CY   PF K      L+ + +
Sbjct: 255 ETLCGSPLYMAPEILN-YQKY--NAKADLWSVGTVLYEMCYGNPPF-KASNHLELYKKIK 310

Query: 261 -------FPSYPQYSDSLKHLISFMLSENPTQR 286
                  FP+Y +  ++LK LIS +L+ +P +R
Sbjct: 311 KANDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 128/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +        L +   +A L    +  + +   L +E+   K ++ +Q++V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMK-HQNIV 205

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID     + V       ++L+E C  G L++ +  R Q  L E EV   T+ I   I 
Sbjct: 206 QFIDCFEDDTNV-------YILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG     +      ++F           T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG--LAAVLANDRERKFTVC-------GT 305

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+  + + D+W++GV +Y L     PF+   +   ++ R     F 
Sbjct: 306 PNYIAPEVLMGKHSGH--SYEVDVWSIGVMVYALLVGKPPFQ-AKDVNTIYERIKCCDFI 362

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S   K L+  +LS +P +RP+I ++++ V
Sbjct: 363 FPKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 131/287 (45%), Gaps = 36/287 (12%)

Query: 10  QPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVL 69
           Q  +E +V  H  ++I     G +  +Y A     D     ++  +K ++      LN +
Sbjct: 16  QRASEKSVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEIVYESDEELNDI 67

Query: 70  RAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRL 129
            AE+  +K L  + ++V Y        G    SYE+++L+EYC+ G L   + +R    L
Sbjct: 68  MAEISLLKNL-NHDNIVKY-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGL 118

Query: 130 QEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPK 189
            E E     +    G+  +H     +IHRDIK  N+L+S D T K+ DFG V  ++    
Sbjct: 119 SENESKSYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA 175

Query: 190 NPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKV 249
                      +    T  + APE++   RG   +  SDIW+LG  + ++     P+  +
Sbjct: 176 -----------LTLAGTLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNL 221

Query: 250 GEAAILHSRFQFPSYP--QYSDSLKHLISFMLSENPTQRPNICQVLE 294
            +A I ++      YP   +S+SLK  +S    +N  +RP   Q+L+
Sbjct: 222 TDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLK 268

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 91/318 (28%), Positives = 143/318 (44%), Gaps = 79/318 (24%)

Query: 1   MNQSLNDIYQPGT--ELT-VGSHRARIIKYLTSGGFAHIYTAEICPADLSSPA-KIACLK 56
           +  S N +Y   T  ELT VG+++  I+K +  G F  +Y A      L  P  +  CLK
Sbjct: 19  IGSSYNRLYGQFTSDELTEVGNYK--ILKQIGEGSFGKVYLA------LHRPTHRKVCLK 70

Query: 57  RVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGG 116
                DK   N++R      ++    Q    YI        V     +V++ +EYC G  
Sbjct: 71  ---TSDKNDPNIVR------EVFYHRQFDFPYITKLYE---VIVTESKVWMALEYCPGKE 118

Query: 117 LIDFMNTRLQNRLQE-GEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKV 175
           L D + +  +  L E GE+    + I+  +   H++    +HRD+K+EN+L+  +   K+
Sbjct: 119 LYDHLLSLRRLSLLECGELF---AQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKL 173

Query: 176 CDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMID--LYRGY 221
            DFG            +VCG                      T  Y APE+I+   Y G+
Sbjct: 174 TDFGFTRECMTKTTLETVCG----------------------TTVYMAPELIERKTYDGF 211

Query: 222 PINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS-YPQYS-----DSLKHLI 275
            I    DIW+LGV LY L     PF+   E   + ++++  +  P+Y      D  K LI
Sbjct: 212 KI----DIWSLGVILYTLITGYLPFDDDDE---VKTKWKIVNEEPKYDSKFIPDDAKDLI 264

Query: 276 SFMLSENPTQRPNICQVL 293
           S +L++NP +RP++ QVL
Sbjct: 265 SRLLAKNPGERPSLPQVL 282

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 98/209 (46%), Gaps = 49/209 (23%)

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D + +   +R+   E +++ + I  G+   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRA 211
           N+L+      K+ DFG            ++CG                      T  Y A
Sbjct: 159 NILLDKSGDAKLTDFGFTRECMTKTTLETICG----------------------TTVYMA 196

Query: 212 PEMIDL--YRGYPINEKSDIWALGVFLYKLCYYTTPF----EKVGEAAILHSRFQFPSYP 265
           PE+I+   Y G+ I    DIW+LGV LY +   + PF    E   E  I+H   Q     
Sbjct: 197 PELIERKSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENI 252

Query: 266 QYSDSLKHLISFMLSENPTQRPNICQVLE 294
             +D+ K LI  +L++NP  RP + Q+L+
Sbjct: 253 VTADA-KDLILRLLAKNPNDRPTVEQILK 280

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 107/223 (47%), Gaps = 33/223 (14%)

Query: 98  VHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIH 157
           V +   E++L++EY  GG L D++ ++   +L E E +   + I QG++  H+    + H
Sbjct: 194 VWENKSELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICH 249

Query: 158 RDIKIENVLIS-DDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA--QYRAPEM 214
           RD+K EN+L+   ++  K+ DFG +  +  P K           +L+ +     Y +PE+
Sbjct: 250 RDLKPENLLLDKKNKVIKIADFG-MAALELPNK-----------LLETSCGSPHYASPEI 297

Query: 215 I--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL----HSRFQFPSYPQYS 268
           +    Y G P    SD+W+ G+ L+ L     PF       +L      RFQ P Y   +
Sbjct: 298 VMGKPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPY--LT 351

Query: 269 DSLKHLISFMLSENPTQRPNICQVLEE--VSRIQGTPCPLRNF 309
           +  K LI+ +L  NP +R  I ++L    + + +  P  +R  
Sbjct: 352 NDAKDLITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKL 394

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 132/286 (46%), Gaps = 34/286 (11%)

Query: 35  HIYTAEICPADLSSPAKIACL--KRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSH 92
           H YT E+C   + + A  A L  +++L P K   +VL  +    K +  ++  +      
Sbjct: 137 HRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLERQKKLEKEISRDKRTIREASLG 196

Query: 93  AAKSGVH--------DGSYEVFLLMEYCSGGGLIDFMNTRLQN-RLQEGEVLKITSDITQ 143
                 H          S   ++L EY SGG L+D++   +Q+  ++E +  K    I  
Sbjct: 197 QVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI---IQHGSIREHQARKFARGIAS 253

Query: 144 GIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILK 203
            +  +HA    ++HRD+KIEN++ISD    K+ DFG +  +    K    F         
Sbjct: 254 ALMYLHANN--IVHRDLKIENIMISDSSEIKIIDFG-LSNLYDSRKQLHTF--------- 301

Query: 204 NTTAQYRAPEMIDLYRGYP-INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ-- 260
             +  + APE++   + +P    + D+W+ GV L+ L     PF+    +++LH + +  
Sbjct: 302 CGSLYFAAPELL---KAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQG 357

Query: 261 FPSYPQY-SDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTPCP 305
              YPQ+ S  +  L+S ML  +P +R  + QV+E    ++G   P
Sbjct: 358 KVEYPQHLSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNAP 403

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 118/254 (46%), Gaps = 35/254 (13%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPS--------LNVLRAEVDAMKLLRGN 82
            G F  +Y A        +  ++  +K+V VP+  S        +  L++EV  +K L  +
Sbjct: 1047 GSFGAVYLALNV-----TTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 83   QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
             ++V Y+     K+G++       L +EY +GG +   +  R+  R  +  +  +T  + 
Sbjct: 1101 VNIVQYL-GFEEKNGIYS------LFLEYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVL 1151

Query: 143  QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
            +G+A +H+    ++HRD+K +N+L+ +D   K+ DF    G+ R   N     Y   D+ 
Sbjct: 1152 EGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNN----IYSNSDMT 1201

Query: 203  KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP 262
               T  + APEM+D   GY  + K DIW+LG  + ++     P+      A +    +  
Sbjct: 1202 MRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSK 1259

Query: 263  SYPQYSDSLKHLIS 276
            + P   D  K L+S
Sbjct: 1260 TAPPIPDDTKDLVS 1273

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 131/279 (46%), Gaps = 43/279 (15%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLN--------VLRAEVDAMKLLRGN 82
            G F  +Y   +C  ++++  ++  +K+V VP   S N         LR+EV  +K L  +
Sbjct: 1184 GSFGAVY---LC-LNVTT-GEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DH 1237

Query: 83   QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
             ++V Y+          D  Y +FL  EY +GG +   +  R+  R  E  +  +T+ + 
Sbjct: 1238 LNIVQYLGFENK-----DNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVL 1288

Query: 143  QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
            +G+A +H+    ++HRD+K +N+L+  D   K+ DF    G+ R  K+     Y   D+ 
Sbjct: 1289 KGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMT 1338

Query: 203  KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP 262
               T  + APEM+D  +GY  + K DIW+LG  + ++     P+  +   A +    +  
Sbjct: 1339 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1396

Query: 263  SYPQYSDSLKHLIS-----FM---LSENPTQRPNICQVL 293
            S P   +    LIS     F+      NP +RP   ++L
Sbjct: 1397 SAPPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELL 1435

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 132/286 (46%), Gaps = 34/286 (11%)

Query: 35  HIYTAEICPADLSSPAKIACL--KRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV-----S 87
           H YT E+C   + + A  A L  +++L P K   +VL  +    K +  ++  +      
Sbjct: 139 HRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLERQKKLEKEISRDKRTIREASLG 198

Query: 88  YIDSHAAKSGVHDG---SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQG 144
            I  H     + +    S   ++L EY SGG L+D++       ++E +  K    I   
Sbjct: 199 QILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASA 256

Query: 145 IAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKN 204
           +  +HA    ++HRD+KIEN++ISD    K+ DFG +  +    K    F          
Sbjct: 257 LIYLHANN--IVHRDLKIENIMISDSSEIKIIDFG-LSNIYDSRKQLHTF---------C 304

Query: 205 TTAQYRAPEMI--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ-- 260
            +  + APE++  + Y G  +    D+W+ GV L+ L     PF+    +++LH + +  
Sbjct: 305 GSLYFAAPELLKANPYTGPEV----DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQG 359

Query: 261 FPSYPQY-SDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTPCP 305
              YPQ+ S  +  L+S ML  +P +R  + QV+E    ++G   P
Sbjct: 360 KVEYPQHLSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNGP 405

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 100/210 (47%), Gaps = 53/210 (25%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           V++ +EYC G  L +++   ++ R+   E   + S I   +   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAP 212
           +L+      K+ DFG            +VCG                      T  Y AP
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGILETVCG----------------------TTVYMAP 196

Query: 213 EMIDL--YRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQF-PSYPQYSD 269
           E+I+   Y GY I    D W+LG+ LY + +   PF+   E   + ++++   + P Y D
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGAMPFD---EEDDIKTKYRIVNNEPFYDD 249

Query: 270 SL-----KHLISFMLSENPTQRPNICQVLE 294
           +      K LI  +L ++P+QRP++ QVL+
Sbjct: 250 NFIDANGKDLIMQLLQKDPSQRPSLTQVLQ 279

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 132/286 (46%), Gaps = 34/286 (11%)

Query: 35  HIYTAEICPADLSSPAKIACL--KRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV-----S 87
           H YT E+C   + + A  A L  +++L P K   +VL  +    K +  ++  +      
Sbjct: 150 HHYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLERQKKLEKEISRDKRTIREASLG 209

Query: 88  YIDSHAAKSGVHDG---SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQG 144
            I  H     + +    S   ++L EY SGG L+D++       ++E +  K    I   
Sbjct: 210 QILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASA 267

Query: 145 IAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKN 204
           +  +HA    ++HRD+KIEN++ISD    K+ DFG +  +    K    F          
Sbjct: 268 LMYLHANN--IVHRDLKIENIMISDSSEIKIIDFG-LSNLYDSRKQLHTF---------C 315

Query: 205 TTAQYRAPEMI--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ-- 260
            +  + APE++  + Y G  +    D+W+ GV L+ L     PF+    +++LH + +  
Sbjct: 316 GSLYFAAPELLKANPYTGPEV----DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQG 370

Query: 261 FPSYPQY-SDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTPCP 305
              YPQ+ S  +  L+S ML  +P +R  + QV+E    ++G   P
Sbjct: 371 KVEYPQHLSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFDGP 416

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 132/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A   ++ +  + +   L +E+   K +R + +VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMR-HFNVV 151

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID     + V       ++L+E C  G L++ +  R    + E EV    + I   I 
Sbjct: 152 QFIDCFEDDTNV-------YILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG +  V+    N +E  Y         T
Sbjct: 203 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 251

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+  + + DIW++GV +Y L     PF+   +  +++ R     F 
Sbjct: 252 PNYIAPEVLMGKHSGH--SYEVDIWSIGVMIYALLIGKPPFQS-KDVNMIYERIKNRDFA 308

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S+  K LI  +LS +P +RP+I ++++ V
Sbjct: 309 FPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 131/279 (46%), Gaps = 43/279 (15%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLN--------VLRAEVDAMKLLRGN 82
            G F  +Y   +C  ++++  ++  +K+V VP   S N         LR+EV  +K L  +
Sbjct: 1184 GSFGAVY---LC-LNVTT-GEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DH 1237

Query: 83   QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
             ++V Y+       G  + +    L +EY +GG +   +  R+  R  E  +  +T+ + 
Sbjct: 1238 LNIVQYL-------GFENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVL 1288

Query: 143  QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
            +G+A +H+    ++HRD+K +N+L+  D   K+ DF    G+ R  K+     Y   D+ 
Sbjct: 1289 KGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMT 1338

Query: 203  KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP 262
               T  + APEM+D  +GY  + K DIW+LG  + ++     P+  +   A +    +  
Sbjct: 1339 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1396

Query: 263  SYPQYSDSLKHLIS-----FM---LSENPTQRPNICQVL 293
            S P   +    LIS     F+      NP +RP   ++L
Sbjct: 1397 SAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 124/253 (49%), Gaps = 36/253 (14%)

Query: 52  IACLKRVLVPDKPSLNV-LRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLME 110
           I  ++R  VP      V +  E++A+K L  + ++V   +       V   S  + +++E
Sbjct: 77  IKLIRRDTVPKNSDKEVKIYREINALKHL-THPNIVRLEE-------VLQNSKYIGIVLE 128

Query: 111 YCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDD 170
           Y SGG    ++  +   RL+E    ++ + +  G+  MH+    L+HRD+K+EN+L+  +
Sbjct: 129 YASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LVHRDLKLENLLLDKN 184

Query: 171 RTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ--YRAPEMIDLYRGYPINEKSD 228
               + DFG V           EFN+ +++++K +     Y APE++   + Y    K+D
Sbjct: 185 ENLLITDFGFV----------NEFNH-KNELMKTSCGSPCYAAPELVVTTKPYEA-RKAD 232

Query: 229 IWALGVFLYKLCYYTTPFEKVGE-------AAILHSRFQFP-SYPQYSDSL-KHLISFML 279
           IW+ GV +Y +     P++   E       A + H   + P  +P+Y + + + L+  +L
Sbjct: 233 IWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYINPVPRDLLRRIL 292

Query: 280 SENPTQRPNICQV 292
             NP +R N+ QV
Sbjct: 293 VSNPKKRLNLRQV 305

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 97/206 (47%), Gaps = 31/206 (15%)

Query: 98  VHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIH 157
           V +   E++L++EY  GG L D++ ++   +L E E ++    I +G+   H+    + H
Sbjct: 228 VWENKNELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICH 283

Query: 158 RDIKIENVLISDDRTF-KVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA--QYRAPEM 214
           RD+K EN+L+   R   K+ DFG                 V + +LK +     Y +PE+
Sbjct: 284 RDLKPENLLLDKKRKLIKIADFGMAAL------------QVSNTLLKTSCGSPHYASPEI 331

Query: 215 I--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL----HSRFQFPSYPQYS 268
           +    Y G P    SD+W+ G+ L+ L     PF       +L    + R+Q P+Y   S
Sbjct: 332 VMGKTYNGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LS 385

Query: 269 DSLKHLISFMLSENPTQRPNICQVLE 294
              K LIS +L  NP  R    Q+LE
Sbjct: 386 KDAKDLISRILLVNPKARLTTEQILE 411

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 96/201 (47%), Gaps = 35/201 (17%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           V++ +EYC G  L D++   L+ R+   E  ++ + I   +   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLISDDRTFKVCDFGSV--CGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI--DLYRG 220
           +L+  +    + DFG    C               Q + +  TT  Y APE+I  + Y G
Sbjct: 159 ILLDKNGYAMLTDFGFTRECAT-----------KTQLETVCGTTV-YMAPELIKREAYDG 206

Query: 221 YPINEKSDIWALGVFLYKLCYYTTPFEKVGEA----AILHSR---FQFPSYPQYSDSLKH 273
           Y +    D W+LG+ LY + +   PF++         I+H         + PQ  D    
Sbjct: 207 YKV----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKD---- 258

Query: 274 LISFMLSENPTQRPNICQVLE 294
           LI  +L +N  QRPN+ +VL+
Sbjct: 259 LIVRLLDKNAAQRPNLNEVLQ 279

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 143/309 (46%), Gaps = 61/309 (19%)

Query: 1   MNQSLNDIYQPGT--ELT-VGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKR 57
           +  S N +Y   T  EL+ VG+++  I+K +  G F  +Y A   P       +   LK 
Sbjct: 15  IGNSYNKLYCQFTAEELSEVGNYK--IMKQIGEGSFGKVYLASHKPTH-----RKVVLK- 66

Query: 58  VLVPDKPSLNVLRA-----EVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYC 112
               DK   NV+R      + D + + R  + +V+                +V++ +EYC
Sbjct: 67  --TSDKNDPNVVREVFYHRQFDYLYITRLYEVIVT--------------ETKVWMALEYC 110

Query: 113 SGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRT 172
            G  L + +      R+   E  ++ + I   I   H+L    +HRD+K+EN+L+     
Sbjct: 111 PGKELYEHL--LALKRISLDECSRLFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGN 166

Query: 173 FKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL--YRGYPINEKSDIW 230
            K+ DFG     +         +  Q D +  TT  Y APE+ +   Y G+ I    DIW
Sbjct: 167 AKLTDFGFTRECV---------SKSQLDTICGTTV-YMAPELTERKSYDGFKI----DIW 212

Query: 231 ALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS-YPQYSDSL-----KHLISFMLSENPT 284
           ALGV LY +   + PF++  EA    ++++  +  P+ ++ L     K LI  +L+++P 
Sbjct: 213 ALGVILYTMINGSMPFDEDDEAK---TKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPN 269

Query: 285 QRPNICQVL 293
           +RP+I ++L
Sbjct: 270 ERPSIEKIL 278

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 120/259 (46%), Gaps = 41/259 (15%)

Query: 69  LRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNR 128
           +R E+  +  L+   ++  Y  S+   +       +++++MEYC+GG L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDT-------KLWVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPP 188
           ++E  +  I  +I   + ++H  +  +IHRDIK  N+LI+++ + K+CDFG         
Sbjct: 109 IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAA------ 160

Query: 189 KNPQEFNYVQHDILKNTTAQ----YRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTT 244
                   +   +LK  T      + APE+I    G   + K DIW+LG+  Y++     
Sbjct: 161 -------QLSQSMLKRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNP 211

Query: 245 PFEKVGEAAILHSRFQFPSYP------QYSDSLKHLISFMLSENPTQRPNICQVLEE--V 296
           P+  +   AI   +    S P      +YS  LK  I+  L E+P +RP   ++ +   +
Sbjct: 212 PYCHM--EAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERPYAEELFKSKLI 269

Query: 297 SRIQGTPCPLRNFYVTRAM 315
            + +GT   +    +TR +
Sbjct: 270 KQEKGTSTVILKELITRYL 288

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 131/279 (46%), Gaps = 43/279 (15%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLN--------VLRAEVDAMKLLRGN 82
            G F  +Y   +C  ++++  ++  +K+V VP   S N         LR+EV  +K L  +
Sbjct: 1190 GSFGAVY---LC-LNVTT-GEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DH 1243

Query: 83   QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
             ++V Y+       G  + +    L +EY +GG +   +  R+  R  E  +  +T+ + 
Sbjct: 1244 LNIVQYL-------GFENKNSIYSLFLEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVL 1294

Query: 143  QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
            +G+A +H+    ++HRD+K +N+L+  D   K+ DF    G+ R  K+     Y   D+ 
Sbjct: 1295 RGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMT 1344

Query: 203  KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP 262
               T  + APEM+D  +GY  + K DIW+LG  + ++     P+  +   A +    +  
Sbjct: 1345 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1402

Query: 263  SYPQYSDSLKHLI-----SFM---LSENPTQRPNICQVL 293
            S P   +    LI     SF+      +P +RP   ++L
Sbjct: 1403 SAPPIPEDTLPLITRVGRSFLDACFEIDPEKRPTATKLL 1441

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 131/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A   ++ +  + +   L +E+   K ++ + ++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HPNIV 137

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID     + V       ++L+E C  G L+D +  R    L E EV   T+ I   I 
Sbjct: 138 QFIDCFEDDTNV-------YILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH  +  +IHRD+K+ N+    +   K+ DFG +  V+    N +E  Y         T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 237

Query: 207 AQYRAPEMI-DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ----- 260
             Y APE++   + G+  + + DIW++GV +Y L     PF+   E  I++ R +     
Sbjct: 238 PNYIAPEVLAGKHSGH--SYEVDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDYI 294

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S  +  LI  +LS +P +RP++ ++++ V
Sbjct: 295 FPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 101/210 (48%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L + +   + +R+   E  K+ + I   +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLE 157

Query: 164 NVLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRA 211
           N+L+  +   K+ DFG            ++CG                      T  Y A
Sbjct: 158 NILLDKNGNAKLTDFGFTRECVSKSSLETICG----------------------TTVYMA 195

Query: 212 PEMI--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS-YPQYS 268
           PE+I    Y G+ I    DIW+LGV LY +   T PF++  E     ++++  + +P ++
Sbjct: 196 PELIQRQAYDGFKI----DIWSLGVILYTMINGTMPFDEDDETK---TKWKIVNDFPNFN 248

Query: 269 DSL-----KHLISFMLSENPTQRPNICQVL 293
           D+      K LI  +L++ P++RP + Q+L
Sbjct: 249 DNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 95/207 (45%), Gaps = 49/207 (23%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           V++++EYCSG  L + +    + RL   E  K+ S I   +   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 165 VLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAP 212
           VL+  +   K+ DFG            ++CG                      T  Y AP
Sbjct: 159 VLLDGNGHAKLTDFGFTREMATRSQLETICG----------------------TTVYMAP 196

Query: 213 EMID--LYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEA----AILHSRFQFPSYPQ 266
           E+I+   Y G+    K DIW+LG+ LY +     PF++  +      I++    F +   
Sbjct: 197 ELIERKCYDGF----KVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEW 251

Query: 267 YSDSLKHLISFMLSENPTQRPNICQVL 293
            SD    LI  ML +NP +R ++ QVL
Sbjct: 252 ISDDAIDLIQGMLRKNPNERISLAQVL 278

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 133/271 (49%), Gaps = 35/271 (12%)

Query: 31  GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYID 90
           G    +YTA     ++ + A +A +K++ +  +P   ++  E+  MK  + +Q++V++ID
Sbjct: 632 GASGGVYTA----YEVGTNASVA-IKQMNLEKQPKKELIINEILVMKGSK-HQNIVNFID 685

Query: 91  SHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHA 150
           S+  K        +++++MEY  GG L D +   +   L E ++  +  +  +G+  +H+
Sbjct: 686 SYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGLQFLHS 735

Query: 151 LQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYR 210
               +IHRDIK +N+L+S +   K+ DFG  C  I       E N  +  ++   T  + 
Sbjct: 736 KG--VIHRDIKSDNILLSMNGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYWM 784

Query: 211 APEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAILHSRFQFPSYPQ-- 266
           APE++      P   K DIW+LG+ + ++     P+  E    A  L +    P   +  
Sbjct: 785 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPE 841

Query: 267 -YSDSLKHLISFMLSENPTQRPNICQVLEEV 296
             S  LK  +++ L+ NP  R +  ++L +V
Sbjct: 842 VLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 95/197 (48%), Gaps = 26/197 (13%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +     N L E +V  I  ++T G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL-YRGYPI 223
           +L++++   K+ DFG V G IR       F           T  + APE++     GY  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTLKRDTF---------VGTPYWMAPEVVCCEVDGY-- 194

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS-------RFQFPSYPQYSDSLKHLIS 276
           NEK+DIW+LG+  Y+L     P  K     ++ +       + Q P    +SD+ K  ++
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKDFVA 250

Query: 277 FMLSENPTQRPNICQVL 293
             L + P  RP+   +L
Sbjct: 251 GCLVKTPADRPSAYNLL 267

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 128/311 (41%), Gaps = 66/311 (21%)

Query: 8   IYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLN 67
           +Y  G+E+  GSH               +Y          S  +I   K+V  P+K +  
Sbjct: 41  VYYRGSEINRGSHSV-------------VYKV------FDSEDRIFAGKKVHCPNKENKR 81

Query: 68  VLRAEVDAMKLL--RGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRL 125
            +  E++  K++    + H+V+  D  A + G       ++++++YCS   L   +  R 
Sbjct: 82  KIIKELEIYKVICRSHHNHIVALRD--AFQWGKESC---IYMILDYCSNNSLQSILQYR- 135

Query: 126 QNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVI 185
              L E E  ++   +  GI  +H     +IH D+K+ N+L  + +  K+CDFGS     
Sbjct: 136 -GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQLKICDFGSSFIAT 192

Query: 186 RPPKNPQEFNYVQHDILKNTTAQYRAPE------------MIDLYRGYPINEKSDIWALG 233
             P+ P E            T  Y APE            M  L   +PI    DIW++G
Sbjct: 193 SSPRGPGEI---------MGTPYYLAPETVYTHKNINKSGMAILLISFPI----DIWSMG 239

Query: 234 VFLYKLCYYTTPFEK-VGEA----------AILHSRFQFPSYPQYSDSLKHLISFMLSEN 282
           + LY L Y   PF K V E            I     +FP+        + LI  MLS+N
Sbjct: 240 IVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQLILKMLSQN 299

Query: 283 PTQRPNICQVL 293
           P +R  + +++
Sbjct: 300 PLERITLVEIV 310

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 118/230 (51%), Gaps = 41/230 (17%)

Query: 22  ARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRG 81
           A ++K +  GG A +YTA     +LS       +K++ +  +P   ++  E+  MK    
Sbjct: 614 ANLVK-IGRGGSALVYTAYEVGTNLS-----VAIKQINLEKQPRKQLILNEIIVMK---K 664

Query: 82  NQH--VVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITS 139
           +QH  +V++IDS+       DG  +++++MEY   G L D +   +   L+EG++  +  
Sbjct: 665 SQHPNIVNFIDSYLV-----DG--KLWVIMEYMEAGSLTDVVTRCI---LREGQIGAVCR 714

Query: 140 DITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQH 199
           ++ +G+  +H+    +IHRDIK +NVL+S D   K+ DFG  C          + N +  
Sbjct: 715 EVLKGLVFLHS--KGVIHRDIKSDNVLLSMDGDIKLTDFG-FCA---------QLNDIH- 761

Query: 200 DILKNT---TAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF 246
            + +NT   T  + APE+++     P   K DIW+LGV + ++     P+
Sbjct: 762 -LKRNTMVGTPYWMAPEIVEKKHYCP---KVDIWSLGVMIIEMIEGEPPY 807

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 127/273 (46%), Gaps = 41/273 (15%)

Query: 31  GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYID 90
           G    +YTA     D S       +K++ +  +P   ++  E+  MK  + + ++V++ID
Sbjct: 560 GASGGVYTAYEVGTDAS-----VAIKQMNLEKQPKKELIINEIIVMKDSK-HPNIVNFID 613

Query: 91  SHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHA 150
           S   K        +++++ME+  GG L D +   +   L EG++  +  +  +G+  +H+
Sbjct: 614 SFLLKG-------DLWVIMEFMEGGSLTDVVTHCI---LTEGQIGTVCRETLRGLQFLHS 663

Query: 151 LQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNT---TA 207
               +IHRDIK +N+L+S     K+ DFG  C  I            +H++ + T   T 
Sbjct: 664 NG--VIHRDIKSDNILLSMKGDIKLTDFG-FCAQIN-----------EHNLKRTTMVGTP 709

Query: 208 QYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAILHSRFQFPSYP 265
            + APE++      P   K DIW+LG+ + ++     P+  E    A  L +    P   
Sbjct: 710 YWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIESEPPYLNETPLRALYLIATNGTPKLK 766

Query: 266 Q---YSDSLKHLISFMLSENPTQRPNICQVLEE 295
           +    SD L   +S+ L  NP +R +   +LE+
Sbjct: 767 EPELLSDVLNDFLSWCLKVNPDERASASTLLED 799

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFK 174
            G ID  +   L+  + E E   I   +   I  +H+    ++HRDIK ENV++      K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  VCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEK-SDIWALG 233
            + DFGS   V   P           D+   T   Y APE++    G P + K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 234  VFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQV 292
            V LY + +   PF  + E  IL    +F      S+   +LI  +L++NP+QRP I +V
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 87/341 (25%), Positives = 155/341 (45%), Gaps = 50/341 (14%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A L    +  + +   L +E+   K ++ + ++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMK-HPNIV 150

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            + D     + V       ++L+E C  G +++ +  R +  L E EV      I   I 
Sbjct: 151 QFTDCFEDDTNV-------YILLEICPNGSVMELL--RQRKHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG +  V+    N +E  Y         T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-LAAVL---ANDKERKYTI-----CGT 250

Query: 207 AQYRAPEMID-LYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE++   + G+  + + DIW++GV LY L +   PF+   E   ++ R     F 
Sbjct: 251 PNYIAPEVLTGKHTGH--SYEVDIWSIGVMLYALLFGKPPFQ-AKEVETIYERIKCRDFI 307

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTPCPLRNFYVTRAMXXXXX 320
           FP+    S   K+LIS +L  NP  RP++ ++ + V          RN + +R +     
Sbjct: 308 FPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVW--------FRNTFPSR-LPSTIT 358

Query: 321 XXXPKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQT 361
              P   FDH      L  + ++IN+   M ++  L+S+QT
Sbjct: 359 KEIP--NFDH------LSFSESLINLKQCMLNSGLLKSSQT 391

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 135/300 (45%), Gaps = 48/300 (16%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPD--------KPSLNVLRAEVDAMKLLRGN 82
            G F  +Y +        +  ++  +K+V VP         K  +  L++EV  +K L  +
Sbjct: 1160 GSFGAVYLSLNI-----TTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-DH 1213

Query: 83   QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
             ++V Y+ S      +    Y +FL  EY +GG +   +  RL  R  E  +  + + + 
Sbjct: 1214 LNIVQYLGSE-----IRGNIYSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVL 1264

Query: 143  QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
             G+  +H+    ++HRD+K +N+L+ +D   K+ DF    G+ +  KN     Y   D+ 
Sbjct: 1265 SGLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKNI----YSNSDMT 1314

Query: 203  KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP 262
               T  + APEM+D  +GY  + K DIW+LG  + ++     P+  +   A +    +  
Sbjct: 1315 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1372

Query: 263  SYPQYSDSLKHLISF----MLSE----NPTQRPNICQVLEE-VSRIQGTPCPLRNFYVTR 313
            S P   D    LIS      LS+    +P +RP    +LE   S++     P  NF  TR
Sbjct: 1373 SAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLEHSFSKVD----PAFNFSRTR 1428

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 135/283 (47%), Gaps = 32/283 (11%)

Query: 24  IIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQ 83
           I++ +  G F  +Y A     +     K+  L+     D+P +++L  E+  +  LR   
Sbjct: 22  ILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDT---DEP-IDLLAQEIFFLSELRS-- 75

Query: 84  HVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQ 143
               YI ++     V      ++++MEYC GG   + +    +++L E +   I S++  
Sbjct: 76  ---PYITNYKTAFLV---DVSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLV 129

Query: 144 GIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILK 203
           G+  +H+ +   IHRDIK  N+L++D+   K+ DFG V G +   +    F         
Sbjct: 130 GLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF--------- 177

Query: 204 NTTAQYRAPEMIDL-YRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS--RFQ 260
             T  + APE+ID   +GY  NE +DIW+LG+ + +L     P +K      L +  +  
Sbjct: 178 VGTPFWMAPEVIDRNKKGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRD 235

Query: 261 FPSY-PQYSDSLKHLISFMLSENPTQRPNICQVLEE--VSRIQ 300
            P    ++S   K  ++  L ++P+QRP   ++L+   V R++
Sbjct: 236 PPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLKHRFVKRVR 278

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 132/272 (48%), Gaps = 39/272 (14%)

Query: 31  GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQH--VVSY 88
           G    +YTA     +L + A +A +K++ +  +P   ++  E+  MK   G++H  +V++
Sbjct: 664 GASGGVYTA----YELGTNASVA-IKQMNLEKQPKKELIINEIMVMK---GSKHRNIVNF 715

Query: 89  IDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAM 148
           IDS+  K        +++++MEY  GG L D +   +   L EG++  +  +   G+  +
Sbjct: 716 IDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAGLQFL 765

Query: 149 HALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ 208
           H+    +IHRDIK +N+L+S     K+ DFG  C  I       E N  +  ++   T  
Sbjct: 766 HSKG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPY 814

Query: 209 YRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAILHSRFQFPSYPQ 266
           + APE++      P   K DIW+LG+ + ++     P+  E    A  L +    P   +
Sbjct: 815 WMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKE 871

Query: 267 ---YSDSLKHLISFMLSENPTQRPNICQVLEE 295
                + L++ + + L+  P QR +  Q+L++
Sbjct: 872 PDNLGEELQNFLDWCLTVEPDQRASSSQLLKD 903

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 133/281 (47%), Gaps = 40/281 (14%)

Query: 22  ARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRG 81
           A ++K +  G    +YTA     ++S       +K++ +  +P   ++  E+  MK   G
Sbjct: 600 ANLVK-IGQGASGGVYTAYEIGTNVS-----VAIKQMNLEKQPKKELIINEILVMK---G 650

Query: 82  NQH--VVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITS 139
           ++H  +V++IDS+  K        +++++MEY  GG L D +   +   L EG++  +  
Sbjct: 651 SKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCR 700

Query: 140 DITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQH 199
           +   G+  +H+    ++HRDIK +N+L+S +   K+ DFG  C  I       E N  + 
Sbjct: 701 ETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI------NELNLKRT 751

Query: 200 DILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAILHS 257
            ++   T  + APE++      P   K DIW+LG+ + ++     P+  E    A  L +
Sbjct: 752 TMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIA 806

Query: 258 RFQFPSYPQ---YSDSLKHLISFMLSENPTQRPNICQVLEE 295
               P   +    S SLK  + + L   P +R +  ++L +
Sbjct: 807 TNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHD 847

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 131/284 (46%), Gaps = 45/284 (15%)

Query: 20  HRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLL 79
           H   ++K +  G    ++TA     D     ++  +K++ +  +P   ++  E+  MK  
Sbjct: 676 HYKDLVK-IGQGASGGVFTAH----DSRDENRLVAIKQMNLQKQPKKELIINEIIVMKGS 730

Query: 80  RGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITS 139
           R ++++V++IDS+  K        +++++MEY  GG L D +   +   L EG++  +  
Sbjct: 731 R-HENIVNFIDSYLMKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGTVCK 779

Query: 140 DITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQH 199
           +   G+A +H+    +IHRDIK +N+L+S +   K+ DFG  C  I         N V  
Sbjct: 780 ETLGGLAFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQI---------NEVH- 826

Query: 200 DILKNTTA----QYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL 255
             LK TT      + APE++      P   K DIW+LG+ + ++     P+        L
Sbjct: 827 --LKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRAL 881

Query: 256 HSRFQFPSYPQYSDS------LKHLISFMLSENPTQRPNICQVL 293
           +        PQ  D       LK  + + L+ NP +R    ++L
Sbjct: 882 Y-LIATNGTPQLKDPENLGEILKKFLDWCLTVNPEERATALELL 924

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 94/199 (47%), Gaps = 34/199 (17%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY     +++LMEYC+GG L   +      ++ E  +  I  ++   +  +H  +  +I
Sbjct: 87  GSYLKDTSLWILMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKCIH--KDNVI 141

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA---QYRAPE 213
           HRDIK  NVLI+++ + K+CDFG    V             Q  + + T A    + APE
Sbjct: 142 HRDIKAANVLITNEGSVKLCDFGVAAQV------------NQTSLRRQTMAGTPYWMAPE 189

Query: 214 MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYP------QY 267
           +I    G   + K DIW+LG+  Y++     P+  V   A+   +    S P       Y
Sbjct: 190 VI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCDV--EALRAMQLIIKSKPPRLEGRSY 245

Query: 268 SDSLKHLISFMLSENPTQR 286
           S SLK  I+  L E+P +R
Sbjct: 246 SSSLKEFIALCLDEDPKER 264

>Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON}
            similar to Ashbya gossypii ABR014W
          Length = 1122

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 131/272 (48%), Gaps = 39/272 (14%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQH--VVSY 88
            G    +YTA     ++ + A +A +K++ +  +P   ++  E+  MK   G++H  +V++
Sbjct: 845  GASGGVYTA----YEIGTNASVA-IKQMNLEKQPKKELIINEILVMK---GSKHKNIVNF 896

Query: 89   IDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAM 148
            IDS+  K        +++++MEY  GG L D +   +   L EG++  ++ +  +G+  +
Sbjct: 897  IDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIAAVSRETLRGLHFL 946

Query: 149  HALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ 208
            H+    +IHRDIK +N+L+S D   K+ DFG  C  I       E N  +  ++   T  
Sbjct: 947  HS--KGVIHRDIKSDNILLSMDGNIKLTDFG-FCAQI------NESNLKRTTMVG--TPY 995

Query: 209  YRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAILHSRFQFPSYPQ 266
            + APE++      P   K DIW+LG+ + ++     P+  E    A  L +    P    
Sbjct: 996  WMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKD 1052

Query: 267  ---YSDSLKHLISFMLSENPTQRPNICQVLEE 295
                S  LK  +++ L  NP  R    ++L +
Sbjct: 1053 AGSLSSVLKRFLNWCLHVNPENRATAVELLSD 1084

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 104/216 (48%), Gaps = 22/216 (10%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
           S   ++L EY SGG L+D++       L+E    K    I   +  +HA    ++HRD+K
Sbjct: 236 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLK 291

Query: 162 IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGY 221
           IEN++IS     K+ DFG +  +  P      F           +  + APE++   +  
Sbjct: 292 IENIMISTSGEIKIIDFG-LSNMFDPRTQLHTF---------CGSLYFAAPELL---KAS 338

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP--SYPQY-SDSLKHLISF 277
           P +  + D+W+ GV LY L     PF+    +++LH + +     YPQ+ S  +  L+S 
Sbjct: 339 PYVGPEVDVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPQHLSIEVISLLSK 397

Query: 278 MLSENPTQRPNICQVLEEVSRIQGTPCPLRNFYVTR 313
           ML  +P +R ++ QV+E    I+G   P  ++   R
Sbjct: 398 MLVVDPRKRASLKQVVEHHWMIRGYDFPAPSYVPNR 433

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 114/232 (49%), Gaps = 26/232 (11%)

Query: 66  LNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRL 125
           ++VL  E+  +  LR    V +Y      K+ V D S  ++++ME+C GG   D +    
Sbjct: 79  IDVLAQEIYFLSELRA-PFVTTYF-----KTFVEDVS--MWIVMEFCGGGSCADLLKHLP 130

Query: 126 QNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVI 185
           ++RL E +V  I  ++  G+  +H+ +   IHRDIK  N+L++DD   K+ DFG V G I
Sbjct: 131 EHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAANILLTDDGEVKLGDFG-VSGQI 187

Query: 186 RPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLY-RGYPINEKSDIWALGVFLYKLCYYTT 244
                   F           T  + APE+I     GY  NEK+DIW+LG+   +L     
Sbjct: 188 MATLKRTTF---------VGTPYWMAPEIIAKKDNGY--NEKADIWSLGITAIELLTGQP 236

Query: 245 PFEKVGEAAIL-HSRFQFPSYPQ--YSDSLKHLISFMLSENPTQRPNICQVL 293
           P+ K     +L +   + P   Q  ++ S +  I+  L ++P  RP+  ++L
Sbjct: 237 PYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIALCLIKDPDLRPSAAELL 288

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 104/210 (49%), Gaps = 24/210 (11%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
           S   ++L EY +GG L+D++       L+E    K    +   +  +HA    ++HRD+K
Sbjct: 204 SNHFYMLFEYVAGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLK 259

Query: 162 IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGY 221
           IEN++IS+    K+ DFG +  V    K    F           +  + APE++   + +
Sbjct: 260 IENIMISNSGEIKIIDFG-LSNVYDTRKQLHTF---------CGSLYFAAPELL---KAH 306

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP--SYPQY-SDSLKHLISF 277
           P    + D+W+ GV LY L     PF+    +++LH + +     YPQ+ S  +  L+S 
Sbjct: 307 PYTGPEVDVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKRGKVEYPQHLSIEVMSLLSK 365

Query: 278 MLSENPTQRPNICQVLEEVSRIQG--TPCP 305
           ML  +P++R ++ QV+E     +G  TP P
Sbjct: 366 MLVVDPSRRASLKQVVEHPWMTKGYDTPAP 395

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 97/196 (49%), Gaps = 22/196 (11%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
           S   ++L EY SGG L+D++       L+E    K    I   +  +H     ++HRD+K
Sbjct: 175 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLK 230

Query: 162 IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGY 221
           IEN++IS     K+ DFG +  +  P K    F           +  + APE++   + +
Sbjct: 231 IENIMISTSGEIKIIDFG-LSNMYDPKKQLHTF---------CGSLYFAAPELL---KAH 277

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ--FPSYPQY-SDSLKHLISF 277
           P I  + D+W+ GV LY L     PF+    A++LH + +     YPQ+ S  +  L+S 
Sbjct: 278 PYIGPEVDVWSFGVVLYVLVCGKVPFDD-ENASVLHEKIKQGKVEYPQHLSIEVISLLSK 336

Query: 278 MLSENPTQRPNICQVL 293
           ML  +P++R  + QV+
Sbjct: 337 MLVVDPSKRATLKQVV 352

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 133/281 (47%), Gaps = 40/281 (14%)

Query: 22  ARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRG 81
           A ++K +  G    +YTA     ++S       +K++ +  +P   ++  E+  MK   G
Sbjct: 623 ANLVK-IGQGASGGVYTAYEIGTNVS-----VAIKQMNLEKQPKKELIINEILVMK---G 673

Query: 82  NQH--VVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITS 139
           ++H  +V++IDS+  K        +++++MEY  GG L D +   +   L EG++  +  
Sbjct: 674 SRHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCR 723

Query: 140 DITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQH 199
           +   G+  +H+    ++HRDIK +N+L+S +   K+ DFG  C  I       E N  + 
Sbjct: 724 ETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI------NELNLKRT 774

Query: 200 DILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAILHS 257
            ++   T  + APE++      P   K DIW+LG+ + ++     P+  E    A  L +
Sbjct: 775 TMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIA 829

Query: 258 RFQFPSYPQ---YSDSLKHLISFMLSENPTQRPNICQVLEE 295
               P   +    S SLK  + + L   P +R +  ++L +
Sbjct: 830 TNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHD 870

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 94/199 (47%), Gaps = 34/199 (17%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY     ++++MEYC+GG L   +      ++ E  +  I  ++   +  +H  +  +I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIH--KDNVI 141

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ---YRAPE 213
           HRDIK  NVLI+++   K+CDFG    V             Q  + + T A    + APE
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQV------------NQTSLRRQTMAGTPYWMAPE 189

Query: 214 MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYP------QY 267
           +I    G   + K DIW+LG+  Y++     P+ +V   A+   +    S P       Y
Sbjct: 190 VI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCEV--EALRAMQLIIKSKPPRLEGRSY 245

Query: 268 SDSLKHLISFMLSENPTQR 286
           S SLK  I+  L E+P +R
Sbjct: 246 SPSLKEFIALCLDEDPKER 264

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 103/221 (46%), Gaps = 34/221 (15%)

Query: 85  VVSYIDSHAAKSG---VHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDI 141
           V+  + SHA   G   V +   E++L++EY  GG L D++ +R   RL E E +     I
Sbjct: 168 VIMKLISHANVLGLYEVWENKSELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQI 225

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLIS-DDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHD 200
            QG++  HA    + HRD+K EN+L+   + T K+ DFG                 V + 
Sbjct: 226 IQGVSYCHAFN--ICHRDLKPENLLLDKKNSTIKIADFGMAAL------------EVSNK 271

Query: 201 ILKNTTA--QYRAPEMI--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL- 255
           +L+ +     Y +PE++    Y G P    SD+W+ G+ L+ L     PF       +L 
Sbjct: 272 LLQTSCGSPHYASPEIVMGKQYHGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLL 327

Query: 256 ---HSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
                ++Q P     S   + LI+ +L+ NP +R    ++L
Sbjct: 328 KVQSGKYQMPQ--NLSKEAQDLIAKILTVNPAKRLTTEEIL 366

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 127/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +        + +   +A   ++ +  + +   L +E+   K ++ + ++V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HVNIV 155

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID     + V       ++L+E C  G L+D +  R    L E EV   T+ I   I 
Sbjct: 156 QFIDCFEDDTNV-------YILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG    +     N +E  Y         T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATL----ANDRERKYTV-----CGT 255

Query: 207 AQYRAPE-MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE ++  + G+  + + DIW++GV +Y L     PF+   +   ++ R     F 
Sbjct: 256 PNYIAPEVLMGKHSGH--SYEVDIWSIGVMIYALIIGRPPFQS-KDVNTIYERIKCRDFS 312

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S   K LI  +LS +P +RP++ ++++ +
Sbjct: 313 FPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 129/286 (45%), Gaps = 34/286 (11%)

Query: 35  HIYTAEICPADLSSPAKIACL--KRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV-----S 87
           H YT E+C   + + A  A L  ++ L P K    +L  +    K +  ++  +      
Sbjct: 97  HRYTKEVCAIKIVNRATNAFLHKEQSLPPPKKEEEILERQKKLEKEISRDKRTIREASLG 156

Query: 88  YIDSHAAKSGVHDG---SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQG 144
            I  H     + +    S   ++L EY SGG L+D++       L+E    K T  I   
Sbjct: 157 QILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASA 214

Query: 145 IAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKN 204
           +  +HA    ++HRD+KIEN++IS     K+ DFG +  +    K    F          
Sbjct: 215 LQYLHANN--IVHRDLKIENIMISTSGEIKIIDFG-LSNLFDKSKQLHTF---------C 262

Query: 205 TTAQYRAPEMIDL--YRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP 262
            +  + APE++    Y G  +    D+W+ GV LY L     PF+    +++LH + +  
Sbjct: 263 GSLYFAAPELLKASPYTGPEV----DVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQG 317

Query: 263 --SYPQY-SDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTPCP 305
              YPQ+ S  +  L+S ML  +P +R ++ QV+E    ++G   P
Sbjct: 318 KVEYPQHLSIEVISLLSKMLVVDPHRRASLKQVVEHHWMVRGYDGP 363

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 110/237 (46%), Gaps = 42/237 (17%)

Query: 69  LRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNR 128
           +  E+  MKLL  + +V+S  D       V + +  ++L++EY   G L + +  R    
Sbjct: 66  IEREIVVMKLL-SHPNVLSLYD-------VWETNNNLYLILEYAEKGELFNLLVDR--GP 115

Query: 129 LQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPP 188
           L E E +K    I   I+  HAL   ++HRD+K EN+L+ +D   K+ DFG         
Sbjct: 116 LPEKEAVKCFRQIIIAISYCHALG--IVHRDLKPENLLLDNDYNIKIADFGMAA------ 167

Query: 189 KNPQEFNYVQHD--ILKNTTA--QYRAPEMIDL--YRGYPINEKSDIWALGVFLYKLCYY 242
                   +Q D  +L+ +     Y APE++    YRG+     SD+W+ GV L+ L   
Sbjct: 168 --------LQTDARLLETSCGSPHYAAPEIVSGLPYRGFA----SDVWSCGVILFALLTG 215

Query: 243 TTPF-EKVGEAAIL-----HSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
             PF E  G    L       +F+ P   + S   ++LIS +L  +PTQR     +L
Sbjct: 216 RLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQNLISRILVVDPTQRMKTRDIL 272

>ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL007C (STE20)
          Length = 971

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 114/224 (50%), Gaps = 30/224 (13%)

Query: 23  RIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGN 82
           R +  +  G    +YTA     ++ + A +A +K++ +  +P   ++  E+  MK  R N
Sbjct: 684 RNLVKIGQGASGGVYTA----YEIGTNASVA-IKQMNLEKQPKKELIINEILVMKGSRHN 738

Query: 83  QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
            ++V++IDS+  K        +++++MEY  GG L D +   +   L EG++  ++ +  
Sbjct: 739 -NIVNFIDSYLLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIAAVSRETL 787

Query: 143 QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
           +G+  +H+    +IHRDIK +N+L+S D   K+ DFG  C  I       E N  +  ++
Sbjct: 788 RGLHFLHSKG--VIHRDIKSDNILLSMDGNIKLTDFG-FCAQI------NETNLKRTTMV 838

Query: 203 KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF 246
              T  + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 839 G--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 104/217 (47%), Gaps = 22/217 (10%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
           S   ++L EY SGG L+D++       L+E    K    +   +  +HA    ++HRD+K
Sbjct: 197 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLK 252

Query: 162 IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGY 221
           IEN++IS     K+ DFG +  V    K    F           +  + APE++   +  
Sbjct: 253 IENIMISTSGEIKIIDFG-LSNVFDTRKQLHTF---------CGSLYFAAPELL---KAN 299

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ--FPSYPQY-SDSLKHLISF 277
           P I  + DIW+ GV LY L     PF+    +++LH + +     YP + S  +  L+S 
Sbjct: 300 PYIGPEVDIWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPNHLSIEVISLLSK 358

Query: 278 MLSENPTQRPNICQVLEEVSRIQGTPCPLRNFYVTRA 314
           ML  +P +R N+ +V+E    I+G   P  ++   R+
Sbjct: 359 MLVVDPLKRANLTKVIEHPWMIRGYDFPPPSYLPKRS 395

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 129/275 (46%), Gaps = 29/275 (10%)

Query: 26  KYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHV 85
           ++L  GGFA  +  +     + +   +A   ++ +  + +   L +E+   K ++ +Q++
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMK-HQNI 201

Query: 86  VSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGI 145
           V ++D         +    V++L+  C  G L++ +  R    L E EV   T  I   I
Sbjct: 202 VQFVD-------CFEDHINVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAI 252

Query: 146 AAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNT 205
             MH+ +  +IHRD+K+ N+   ++   K+ DFG +  V+    N +E  Y         
Sbjct: 253 KYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG-LAAVL---ANDRERKYTVCG----- 301

Query: 206 TAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFE----KVGEAAILHSRFQF 261
           T  Y APE++ L +    + + DIW++GV ++ L     PF+        + I +S + F
Sbjct: 302 TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTF 360

Query: 262 PSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           P     S   K LI  +L  +P  RP+I +++E V
Sbjct: 361 PINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 95/194 (48%), Gaps = 24/194 (12%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY     ++++MEYC+GG L   +      ++ E  +  IT +I   +  +H  +  +I
Sbjct: 106 GSYLKDTSLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVITREILIALKYIH--KDNII 160

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMID 216
           HRDIK  NVLI+++ + K+CDFG    + +  K  Q             T  + APE+I 
Sbjct: 161 HRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKRRQTM---------AGTPYWMAPEVI- 210

Query: 217 LYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVG--EAAILHSRFQFPSYP--QYSDSLK 272
              G   + K DIW+LG+  Y++     P+ ++    A  L ++ + P      YS  LK
Sbjct: 211 -MEGVYYDTKVDIWSLGITTYEIATGNPPYCEIEALRAMQLITKSKPPRLEGRNYSPLLK 269

Query: 273 HLISFMLSENPTQR 286
             ++  L E+P +R
Sbjct: 270 EFVALCLDEDPKER 283

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 142/301 (47%), Gaps = 38/301 (12%)

Query: 3   QSLNDIYQPGTELTVGSHRARIIKYLTS---GGFAHIYTAEICPADLSSPAKIACLKRVL 59
           + +  +Y   TE+      +++ K L     G    +YTA     ++ + A +A +K++ 
Sbjct: 644 KKIQQLYAKLTEICTDGDPSKLYKSLIKIGQGASGGVYTA----YEVGTNASVA-IKQMN 698

Query: 60  VPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLID 119
           +  +P   ++  E+  MK  + + ++V++IDS+  +        +++++MEY  GG L D
Sbjct: 699 LEKQPKKELIINEILVMKASK-HANIVNFIDSYLLRG-------DLWVVMEYMEGGSLTD 750

Query: 120 FMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFG 179
            +   +   L EG++  ++ +  +G+  +H+    +IHRDIK +N+L+S     K+ DFG
Sbjct: 751 VVTHCI---LTEGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNILLSMTGEIKLTDFG 805

Query: 180 SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKL 239
             C  I       E N  +  ++   T  + APE++      P   K DIW+LG+ + ++
Sbjct: 806 -FCAQI------NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEM 853

Query: 240 CYYTTPF--EKVGEAAILHSRFQFPSYPQ---YSDSLKHLISFMLSENPTQRPNICQVLE 294
                P+  E    A  L +    P        SD LK  + + L  +P +R    ++L 
Sbjct: 854 IEGEPPYLNETPLRALYLIATNGTPELKDADSLSDDLKGFLGWCLHVDPDERATASELLS 913

Query: 295 E 295
           +
Sbjct: 914 D 914

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A   ++ +  + +   L +E+   K +R + ++V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMR-HTNIV 139

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            ++D     + V       ++L+E C  G L+D +  R    L E EV   T+ I   + 
Sbjct: 140 QFVDCFEDDTNV-------YILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+        KV DFG +  V+    N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFG-LAAVL---ANDRERKYTV-----CGT 239

Query: 207 AQYRAPEMID-LYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSR-----FQ 260
             Y APE++   + G+  + + DIW+ GV +Y L     PF+   E  I++ R     F 
Sbjct: 240 PNYIAPEVLTGKHTGH--SYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDFV 296

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S     LI  +LS +P +RP++ ++++ V
Sbjct: 297 FPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 107/213 (50%), Gaps = 22/213 (10%)

Query: 106 FLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENV 165
           ++  E+ SGG L+D++       L+E    K++  I   +  +HA    ++HRD+KIEN+
Sbjct: 167 YMFFEFISGGQLLDYIIQ--HGSLKENHARKVSRGILSALQYLHANN--IVHRDLKIENI 222

Query: 166 LISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYP-IN 224
           ++S     K+ DFG +  +  P K+ Q F           +  + APE++   + +P + 
Sbjct: 223 MLSKTGEIKLIDFG-LSNMYDPRKSLQTF---------CGSLYFAAPELL---KAHPYLG 269

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP--SYPQY-SDSLKHLISFMLSE 281
            + D+W+ GV LY L     PF+    +A LH + +    +YPQ+ S  +  L+S +L  
Sbjct: 270 PEVDVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSIDVISLLSKILVV 328

Query: 282 NPTQRPNICQVLEEVSRIQGTPCPLRNFYVTRA 314
           +P +R  + QV+     ++G   P +++   R 
Sbjct: 329 DPQKRATLQQVVNHQWMLKGYDFPPQSYLPRRV 361

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 110/234 (47%), Gaps = 28/234 (11%)

Query: 50   AKIACLKRVLVP-----DKPSLNVLRAEVDAMKLLRGNQHV--VSYIDSHAAKSGVHDGS 102
             ++  +K+V VP     D+ +L+VL A    +  L+   HV  V Y+       G  + +
Sbjct: 1169 GEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDLDHVNIVQYL-------GFENKN 1221

Query: 103  YEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKI 162
            +   L +EY +GG +   +  RL  R  E  +  +   + +G+A +H+    ++HRD+K 
Sbjct: 1222 HVYSLFLEYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVLRGLAYLHSKG--ILHRDMKA 1277

Query: 163  ENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYP 222
            +N+L+  D   K+ DF    G+ +   N     Y   D+    T  + APEM+D  +GY 
Sbjct: 1278 DNLLLDVDGICKISDF----GISKKSNNI----YSNSDMTMRGTVFWMAPEMVDTKQGY- 1328

Query: 223  INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLIS 276
             + K DIW+LG  + ++     P+      A +    +F S P   +  + L+S
Sbjct: 1329 -SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDTQKLLS 1381

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 138/298 (46%), Gaps = 43/298 (14%)

Query: 5   LNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKP 64
           LN+I   G   T     A ++K +  G    +YTA     ++S       +K++ +  +P
Sbjct: 607 LNEICSDGDPST---KYANLVK-IGQGASGGVYTAYEIGTNVS-----VAIKQMNLEKQP 657

Query: 65  SLNVLRAEVDAMKLLRGNQH--VVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMN 122
              ++  E+  MK   G++H  +V++IDS+  K        +++++MEY  GG L D + 
Sbjct: 658 KKELIINEILVMK---GSKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVT 707

Query: 123 TRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVC 182
             +   L EG++  +  +   G+  +H+    ++HRDIK +N+L+S +   K+ DFG  C
Sbjct: 708 HCI---LTEGQIGAVCRETLSGLEFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FC 761

Query: 183 GVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYY 242
             I       E N  +  ++   T  + APE++      P   K DIW+LG+ + ++   
Sbjct: 762 AQI------NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEG 810

Query: 243 TTPF--EKVGEAAILHSRFQFPSYPQ---YSDSLKHLISFMLSENPTQRPNICQVLEE 295
             P+  E    A  L +    P   +    S SLK  + + L   P  R +  ++L +
Sbjct: 811 EPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHD 868

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 96/197 (48%), Gaps = 30/197 (15%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY    +++++MEYC+GG L   +      ++ E  +  I  ++   +  +H  +  +I
Sbjct: 90  GSYLYDTKLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRELLVALLYIH--KDNVI 144

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA---QYRAPE 213
           HRDIK  NVLI++D   K+CDFG    +             Q ++ + T A    + APE
Sbjct: 145 HRDIKAANVLITNDGRVKLCDFGVAAQL------------TQSNVRRQTMAGTPYWMAPE 192

Query: 214 MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVG--EAAILHSRFQFPSYP--QYSD 269
           +I    G   + K DIW+LG+  Y++     P+  V    A  L ++ + P     QYS 
Sbjct: 193 VI--MEGVYYDTKVDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGRQYSP 250

Query: 270 SLKHLISFMLSENPTQR 286
            LK  I+  L E+P +R
Sbjct: 251 LLKEFIALCLDEDPKER 267

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 139/296 (46%), Gaps = 39/296 (13%)

Query: 5   LNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKP 64
           L +I  PG        + R +  +  G    +Y A     D  S   +A +K++ +  +P
Sbjct: 607 LTEICSPGDP----KSKYRDLIKIGQGASGGVYIAH----DTESEDSVA-IKQMNLEKQP 657

Query: 65  SLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTR 124
              ++  E+  M+  + + ++V++IDS+ AK        +++++MEY  GG L D +   
Sbjct: 658 KKELILNEILVMRESK-HSNIVNFIDSYLAKG-------DLWIVMEYMEGGSLTDVVTHC 709

Query: 125 LQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGV 184
           L   L EG++  +  +  +G+  +H+    ++HRDIK +N+L+S     K+ DFG  C  
Sbjct: 710 L---LSEGQIGAVCRETLKGLQFLHSKG--VLHRDIKSDNILLSLKGNIKLTDFG-FCAQ 763

Query: 185 IRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTT 244
           I       E N  +  ++   T  + APE++      P   K DIW+LG+ + ++     
Sbjct: 764 I------NENNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEP 812

Query: 245 PF--EKVGEAAILHSRFQFPSYPQ---YSDSLKHLISFMLSENPTQRPNICQVLEE 295
           P+  E    A  L +    P   +    SD+L   + + L  +P++R    ++L++
Sbjct: 813 PYLNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELLDD 868

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 121/260 (46%), Gaps = 38/260 (14%)

Query: 50   AKIACLKRVLVPDKPSLN--------VLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDG 101
             ++  +K+V VP   S N         LRAEV  +K L  + ++V Y+        V D 
Sbjct: 1205 GEMMAVKQVEVPRYGSQNEAIISTVEALRAEVSTLKDL-DHLNIVQYLGFE-----VKDS 1258

Query: 102  SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
             Y +FL  EY +GG +   +  R+  +  E  +  +T  + +G++ +H+    ++HRD+K
Sbjct: 1259 IYSLFL--EYVAGGSVGSLI--RMYGKFDEKLIKHLTIQVLRGLSYLHSRG--ILHRDMK 1312

Query: 162  IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGY 221
             +N+L+  D   K+ DF    G+ R  K+     Y   ++    T  + APEM+D  +GY
Sbjct: 1313 ADNLLLDQDGVCKISDF----GISRKSKDI----YSNSEMTMRGTVFWMAPEMVDTKQGY 1364

Query: 222  PINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLIS----- 276
              + K DIW+LG  + ++     P+  +   A +    +  S P   D    LIS     
Sbjct: 1365 --SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPDDTLPLISQSGRD 1422

Query: 277  FM---LSENPTQRPNICQVL 293
            F+      +P +RP   ++L
Sbjct: 1423 FLDQCFKIDPEERPTADKLL 1442

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 86/355 (24%), Positives = 143/355 (40%), Gaps = 79/355 (22%)

Query: 15  LTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVP--DKPSLNVLRAE 72
           L  G H A I + L  GGF+ +Y  +           +  LK++  P  +  S++    E
Sbjct: 22  LINGQHYA-IQRLLGEGGFSFVYLVQS-----RENNDLFALKKIHCPFGNIESVSEAMRE 75

Query: 73  VDAMKLLRGNQHVVSYIDSHAAKSGV---HDGSYEVFLLMEYCSGGGLID---------- 119
           V++ K  R       YI +H   S V    DGS  VF+L+ Y   G L+D          
Sbjct: 76  VNSYKKFRS-----PYI-THCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGT 129

Query: 120 -----------------------------------FMNTRLQNR----LQEGEVLKITSD 140
                                               +NT LQ R    +   E L++ +D
Sbjct: 130 TISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLND 189

Query: 141 ------ITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEF 194
                 ++   ++  A      H+DIK  N++ S D    +CD GS         +  + 
Sbjct: 190 SLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQL 249

Query: 195 NYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEA-- 252
              Q    ++ T  +R+PE++++     I+EK DIW+LG  LY +C+  +PFE+  +   
Sbjct: 250 VEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSG 309

Query: 253 -----AILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGT 302
                AI   +F  P    YS  L  +I   +  +  +RP+I ++L  +  +QG+
Sbjct: 310 ASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQGS 364

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVV 86
           +L  GGFA  +  +     + +   +A   ++ +  + +   L +E+   K +R + ++V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMR-HFNIV 139

Query: 87  SYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIA 146
            +ID     + V       ++L+E C  G L+D +  R    L E EV   T+ I   + 
Sbjct: 140 QFIDCFEDDTNV-------YILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 239

Query: 207 AQYRAPEMID-LYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ----- 260
             Y APE++   + G+  + + DIW+ GV +Y L     PF+   E  I++ R +     
Sbjct: 240 PNYIAPEVLTGKHTGH--SYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDYV 296

Query: 261 FPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296
           FP     S     LI  +LS +P +RP++ ++++ V
Sbjct: 297 FPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 138/284 (48%), Gaps = 34/284 (11%)

Query: 24  IIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPS-LNVLRAEVDAMKLLRGN 82
           I++ +  G F  +Y A     DL+S  +I  +K V + D    +++L  E+  +  LR  
Sbjct: 22  ILQCIGRGNFGDVYKAR----DLTS-NEIVAIKVVNLEDTDEPIDLLAQEIFFLSELRS- 75

Query: 83  QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
                YI ++     V      ++++MEYC GG   + +    ++++ E +   I S++ 
Sbjct: 76  ----PYITNYKTAFLV---DVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVL 128

Query: 143 QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
            G+  +H+ +   IHRDIK  N+L++D+   K+ DFG V G +   +    F        
Sbjct: 129 IGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF-------- 177

Query: 203 KNTTAQYRAPEMIDLYR-GYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS--RF 259
              T  + APE+ID  + GY  NE +DIW+LG+ + +L     P +K      L +  + 
Sbjct: 178 -VGTPFWMAPEVIDRNKQGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKR 234

Query: 260 QFPSY-PQYSDSLKHLISFMLSENPTQRPNICQVLEE--VSRIQ 300
             P    ++S   +  ++  L ++P+QRP   ++L+   V R++
Sbjct: 235 DPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLKHRFVKRVR 278

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 93/199 (46%), Gaps = 34/199 (17%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY     ++++MEYC+GG L   +      ++ E  +  I  ++   +  +H  +  +I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIH--KDNVI 141

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA---QYRAPE 213
           HRDIK  NVLI+++   K+CDFG    V             Q  + + T A    + APE
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQV------------NQTSLRRQTMAGTPYWMAPE 189

Query: 214 MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYP------QY 267
           +I    G   + K DIW+LG+  Y++     P+  V   A+   +    S P       Y
Sbjct: 190 VI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCDV--EALRAMQLIIKSKPPRLEGRSY 245

Query: 268 SDSLKHLISFMLSENPTQR 286
           S SLK  I+  L E+P +R
Sbjct: 246 SPSLKEFIALCLDEDPKER 264

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 100/219 (45%), Gaps = 44/219 (20%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
           S   ++L EY SGG L+D++       ++E +  K    I   +  +HA    ++HRD+K
Sbjct: 214 SNHFYMLFEYVSGGQLLDYIIQ--HGSIREHQAKKFARGIASALMYLHANN--IVHRDLK 269

Query: 162 IENVLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQY 209
           IEN++ISD    K+ DFG            + CG +          +   ++LK     Y
Sbjct: 270 IENIMISDSSEIKIIDFGLSNLYDSRKQLYTFCGSLY---------FAAPELLKANP--Y 318

Query: 210 RAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ--FPSYPQY 267
             PE+             D+W+ GV L+ L     PF+    +++LH + +     YPQ+
Sbjct: 319 TGPEV-------------DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQH 364

Query: 268 -SDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTPCP 305
            S  +  L+S ML  +P +R  + QV+E    ++G   P
Sbjct: 365 LSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFSGP 403

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 98/196 (50%), Gaps = 20/196 (10%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
           S   ++L EY SGG L+D++       L+E    K    I   +  +HA    ++HRD+K
Sbjct: 205 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIGSALQYLHANN--IVHRDLK 260

Query: 162 IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGY 221
           IEN++IS     K+ DFG +  V  P K    F           +  + APE++   R Y
Sbjct: 261 IENIMISTSGEIKIIDFG-LSNVYDPRKQLHTF---------CGSLYFAAPELLKA-RPY 309

Query: 222 PINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS--YPQY-SDSLKHLISFM 278
            +  + D+W+ GV LY L     PF+    +++LH + +  +  YP + S  +  L+S M
Sbjct: 310 -LGPEVDVWSFGVVLYVLVCGKVPFDD-EVSSVLHEKIKQGNVEYPNHLSIEVLSLLSKM 367

Query: 279 LSENPTQRPNICQVLE 294
           L  +P +R ++ QV+E
Sbjct: 368 LVVDPERRASLKQVIE 383

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 95/199 (47%), Gaps = 34/199 (17%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY     ++++MEYC+GG L   +   +   + E  +  I  ++   +  +H  +  +I
Sbjct: 108 GSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIH--KDNVI 162

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA---QYRAPE 213
           HRDIK  NVLI+++   K+CDFG             + N  Q  + + T A    + APE
Sbjct: 163 HRDIKAANVLITNEGKVKLCDFGVAA----------QLN--QTSLRRQTMAGTPYWMAPE 210

Query: 214 MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYP------QY 267
           +I    G   + K DIW+LG+  Y++     P+ ++   A+   +    S P      QY
Sbjct: 211 VI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEI--EALRAMQLITKSKPARLEGRQY 266

Query: 268 SDSLKHLISFMLSENPTQR 286
           S  LK  I+  L E+P +R
Sbjct: 267 SSGLKEFIALCLDEDPKER 285

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 128/270 (47%), Gaps = 35/270 (12%)

Query: 31  GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYID 90
           G    +YTA     D+++ A +A +K++    +P   ++  E+  MK  R ++++V++ID
Sbjct: 574 GASGGVYTA----TDVNTEASVA-IKKMNFEKQPKKELIVNEILVMKASR-HENIVNFID 627

Query: 91  SHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHA 150
           S+     +       +++MEY  GG L D +   +   L E ++  +T +   G+  +H+
Sbjct: 628 SYFLNGNL-------WVIMEYMKGGSLTDVVTHCI---LTEQQISTVTRETLNGLRFLHS 677

Query: 151 LQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYR 210
               +IHRDIK +NVL+S     K+ DFG  C  I       E N  +  ++   T  + 
Sbjct: 678 --KGVIHRDIKSDNVLLSLSGDIKLTDFG-FCAQI------NEINLKRTTMVG--TPYWM 726

Query: 211 APEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAILHSRFQFPSYPQ-- 266
           APE++      P   K DIW+LG+ + ++     P+  E    A  L +    P      
Sbjct: 727 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDPD 783

Query: 267 -YSDSLKHLISFMLSENPTQRPNICQVLEE 295
             S+ LK  + + L  +P +R +  ++L +
Sbjct: 784 SLSECLKAFLDWCLKVDPHERASATELLND 813

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 94/197 (47%), Gaps = 26/197 (13%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +     N L E +V  I   +T G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL-YRGYPI 223
           +L++++   K+ DFG V G IR       F           T  + APE++     GY  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTFKRDTF---------VGTPYWMAPEVVCCEVDGY-- 194

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS-------RFQFPSYPQYSDSLKHLIS 276
           NEK+DIW+LG+  Y+L     P  K     ++ +       + Q P    +S++ K  ++
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSEAAKEFVA 250

Query: 277 FMLSENPTQRPNICQVL 293
             L + P  RP+   +L
Sbjct: 251 GCLVKTPADRPSAYDLL 267

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 128/268 (47%), Gaps = 35/268 (13%)

Query: 31  GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYID 90
           G    +YTA     D +    +A +K++ +  +P   ++  E+  MK  + ++++V++ID
Sbjct: 659 GASGGVYTAH----DPTREGYVA-IKQMNLEKQPKKELIINEIIVMKESK-HENIVNFID 712

Query: 91  SHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHA 150
           S+  K        +++++MEY  GG L D +   L   L E +V  +  +   G+  +H+
Sbjct: 713 SYLLKG-------DLWVIMEYMEGGSLTDVVTHCL---LTEAQVGAVCRETLSGLQFLHS 762

Query: 151 LQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYR 210
               +IHRDIK +N+L+S     K+ DFG  C  I       E N  +  ++   T  + 
Sbjct: 763 KG--VIHRDIKSDNILLSMRGDIKLTDFG-FCAQI------NELNLKRTTMVG--TPYWM 811

Query: 211 APEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAILHSRFQFPSYPQ-- 266
           APE++      P   K DIW+LG+ + ++     P+  E    A  L +    PS  +  
Sbjct: 812 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPSLKEPE 868

Query: 267 -YSDSLKHLISFMLSENPTQRPNICQVL 293
             SD+L + + + L  NP +R +   +L
Sbjct: 869 ALSDALNNFLGWCLKVNPDERASAKDLL 896

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 132/291 (45%), Gaps = 44/291 (15%)

Query: 10  QPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVL 69
           Q  +E +V  H  ++I     G +  +Y A     D     ++  +K ++  +   LN +
Sbjct: 16  QRASEKSVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDI 67

Query: 70  RAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNR- 128
            AE+ ++     N ++V Y        G    SYE+++L+EYC+ G L      RL +R 
Sbjct: 68  MAEI-SLLKNLNNNNIVKY-------HGFIRKSYELYILLEYCANGSL-----RRLVSRS 114

Query: 129 ---LQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVI 185
              L E E     +    G+  +H     +IHRDIK  N+L+S D T K+ DFG V  ++
Sbjct: 115 PTGLSENESKTYVTQTLWGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV 171

Query: 186 RPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTP 245
                          +    T  + APE++   RG   +  SDIW+LG  + +L     P
Sbjct: 172 NSSA-----------LTLAGTLNWMAPEILG-NRG--ASTLSDIWSLGATVVELLTKNPP 217

Query: 246 FEKVGEAAILHSRFQFPSYP--QYSDSLKHLISFMLSENPTQRPNICQVLE 294
           +  + +A I ++      YP   +S+SLK  +S    +N  +RP   Q+L+
Sbjct: 218 YHNLTDANIYYAVENDTYYPPTAFSESLKDFLSKCFVKNMYKRPTADQLLK 268

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 97/207 (46%), Gaps = 37/207 (17%)

Query: 90   DSHAAKSGVH--DGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAA 147
            D +  ++ VH   GS ++F L+E              ++  + E E + I   I  GI  
Sbjct: 1032 DYYYIETAVHGTSGSIDLFDLIE--------------MKTDMTEHEAMLIFKQIASGIKN 1077

Query: 148  MHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA 207
            +H     ++HRDIK ENV++  +   K+ DFGS   V   P           D+   T  
Sbjct: 1078 LH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYVKSGP----------FDVFVGTI- 1124

Query: 208  QYRAPEMI--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYP 265
             Y APE++  + Y G P     DIWA+GV LY + Y   PF  + E  IL +  +  S  
Sbjct: 1125 DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYKENPFYNIDE--ILDADLRVNSSE 1178

Query: 266  QYSDSLKHLISFMLSENPTQRPNICQV 292
            + SD    LI  +L+ + ++RP+I ++
Sbjct: 1179 RISDDCIALIRKILNRSVSKRPSIDEI 1205

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 84/182 (46%), Gaps = 22/182 (12%)

Query: 116  GLIDFMN-TRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFK 174
            G ID  +    +  + E E   I   I  GI+ +H  +  ++HRDIK ENV++      K
Sbjct: 1094 GCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVK 1151

Query: 175  VCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI--DLYRGYPINEKSDIWAL 232
            + DFGS   V   P           D+   T   Y +PE++  + Y G P     DIWAL
Sbjct: 1152 LIDFGSAAYVKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QDIWAL 1196

Query: 233  GVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQV 292
            G+ LY + +   PF  + E  IL    +FP     S +   LI  +L+ +  +RP+I  +
Sbjct: 1197 GILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDI 1254

Query: 293  LE 294
             E
Sbjct: 1255 SE 1256

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 97/201 (48%), Gaps = 24/201 (11%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY    +++++MEYC+GG L   +      ++ E  +  I   +   +  +H  +  +I
Sbjct: 89  GSYLYDTKLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRKLLIALVYIH--KDNVI 143

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMID 216
           HRDIK  NVLI+++   K+CDFG    +          N+ +  +    T  + APE+I 
Sbjct: 144 HRDIKAANVLITNEGHVKLCDFGVAAQLT-------AANHKRQTMAG--TPYWMAPEVI- 193

Query: 217 LYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVG--EAAILHSRFQFPSYP--QYSDSLK 272
              G   N K+DIW+LG+  Y++     P+  V    A  L ++ + P      YS  LK
Sbjct: 194 -MEGVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLK 252

Query: 273 HLISFMLSENPTQRPNICQVL 293
             I+  L E+P +RP    +L
Sbjct: 253 EFIALCLDEDPEERPTAEDLL 273

>Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W
           (REAL)
          Length = 900

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 134/303 (44%), Gaps = 59/303 (19%)

Query: 26  KYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHV 85
           K +  G FA +Y   +  +D S    I  + R  + +K  L  L  E+  +K ++ + H+
Sbjct: 34  KEIGKGSFATVYRGHLT-SDKSQHIAIKEVSRAKLKNKKLLENLEIEIAILKKIK-HPHI 91

Query: 86  VSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLK--------- 136
           V  ID           S + +L+MEYC+ G L  F+  R +  ++   +LK         
Sbjct: 92  VGLIDCERT-------STDFYLIMEYCALGDLT-FLLKRRKELMENHPLLKTVFEKYPPP 143

Query: 137 -----------ITSDITQGIAAMHALQPP-LIHRDIKIENVLIS-------DDRTFKVCD 177
                      + S + Q  +A+  L+   L+HRDIK +N+L+S       D +TF    
Sbjct: 144 SENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKTFHELG 203

Query: 178 FGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ--------YRAPEMIDLYRGYPINEKSDI 229
           F  +  +  P     +F + +   L NT+          Y APE+++ Y+ Y  N K+D+
Sbjct: 204 FVGIYNL--PILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-YQKY--NAKADL 256

Query: 230 WALGVFLYKLCYYTTPFEKVGEAAIL------HSRFQFPSYPQYSDSLKHLISFMLSENP 283
           W++G  ++++C  T PF       +       +    FPSY      LK LI  +L+ +P
Sbjct: 257 WSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDP 316

Query: 284 TQR 286
            +R
Sbjct: 317 AKR 319

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 125/300 (41%), Gaps = 61/300 (20%)

Query: 9   YQPGTELTVGSH-RARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLN 67
           ++ G  L  GS  R R+ K + +G  + I   +I P       +I  L   +        
Sbjct: 73  WKLGKTLGKGSSGRVRLAKNMETGKLSAI---KIVPKKFVKSNQIKQLPYGI-------- 121

Query: 68  VLRAEVDAMKLLRGNQHVVSYIDSHAAKSG---VHDGSYEVFLLMEYCSGGGLIDFMNTR 124
               E+  MKL+           SH    G   V +   E++L++EY  GG L D++ ++
Sbjct: 122 --EREIIIMKLI-----------SHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSK 168

Query: 125 LQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLIS-DDRTFKVCDFGSVCG 183
              +L E E +     I Q +A  H     + HRD+K EN+L+    R+ K+ DFG    
Sbjct: 169 --GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPENLLLDKKKRSIKIADFGMAA- 223

Query: 184 VIRPPKNPQEFNYVQHDILKNTTA---QYRAPEMI--DLYRGYPINEKSDIWALGVFLYK 238
                           D L  T+     Y +PE++    Y G P    SD+W+ G+ L+ 
Sbjct: 224 ------------LETSDKLLETSCGSPHYASPEIVLGRKYHGSP----SDVWSCGIILFA 267

Query: 239 LCYYTTPFEKVGEAAIL----HSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLE 294
           L     PF       +L      ++Q P +   S   K LIS +L  +P +R  I Q+L+
Sbjct: 268 LLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKDLISRILVVDPNRRITIDQILQ 325

>Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/314 (25%), Positives = 140/314 (44%), Gaps = 61/314 (19%)

Query: 15  LTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVD 74
           ++ G++ A   K +  G FA +Y   +  +D S    I  + R  + +K  L  L  E+ 
Sbjct: 19  ISAGNYTAE--KEIGKGSFATVYRGHLI-SDKSQHIAIKEVSRAKLKNKKLLENLEIEIA 75

Query: 75  AMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEV 134
            +K ++ + H+V  ID           S + +L+MEYC+ G L  F+  R +  ++   +
Sbjct: 76  ILKKIK-HPHIVGLIDCERT-------STDFYLIMEYCALGDLT-FLLKRRKELMENHPL 126

Query: 135 LK--------------------ITSDITQGIAAMHALQPP-LIHRDIKIENVLIS----- 168
           L+                    + S + Q  +A+  L+   L+HRDIK +N+L+S     
Sbjct: 127 LRTVFEKYPPPSESHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIG 186

Query: 169 --DDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ--------YRAPEMIDLY 218
             D +TF    F  +  +  P     +F + +   L NT+          Y APE+++ Y
Sbjct: 187 YHDSKTFHELGFVGIYNL--PILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-Y 241

Query: 219 RGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL------HSRFQFPSYPQYSDSLK 272
           + Y  N K+D+W++G  ++++C  T PF       +       +    FPSY      LK
Sbjct: 242 QKY--NAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDAITFPSYCNIEPELK 299

Query: 273 HLISFMLSENPTQR 286
            LI  +L+ +P +R
Sbjct: 300 KLICSLLTFDPAKR 313

>YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protein
           ser/thr kinase required for vesicle formation in
           autophagy and the cytoplasm-to-vacuole targeting (Cvt)
           pathway; structurally required for phagophore assembly
           site formation; during autophagy forms a complex with
           Atg13p and Atg17p
          Length = 897

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 134/303 (44%), Gaps = 59/303 (19%)

Query: 26  KYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHV 85
           K +  G FA +Y   +  +D S    I  + R  + +K  L  L  E+  +K ++ + H+
Sbjct: 28  KEIGKGSFATVYRGHLT-SDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKKIK-HPHI 85

Query: 86  VSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLK--------- 136
           V  ID           S + +L+MEYC+ G L  F+  R +  ++   +L+         
Sbjct: 86  VGLIDCERT-------STDFYLIMEYCALGDLT-FLLKRRKELMENHPLLRTVFEKYPPP 137

Query: 137 -----------ITSDITQGIAAMHALQPP-LIHRDIKIENVLIS-------DDRTFKVCD 177
                      + S + Q  +A+  L+   L+HRDIK +N+L+S       D ++F    
Sbjct: 138 SENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELG 197

Query: 178 FGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ--------YRAPEMIDLYRGYPINEKSDI 229
           F  +  +  P     +F + +   L NT+          Y APE+++ Y+ Y  N K+D+
Sbjct: 198 FVGIYNL--PILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-YQKY--NAKADL 250

Query: 230 WALGVFLYKLCYYTTPFEKVGEAAIL------HSRFQFPSYPQYSDSLKHLISFMLSENP 283
           W++G  ++++C  T PF       +       +    FPSY      LK LI  +L+ +P
Sbjct: 251 WSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDP 310

Query: 284 TQR 286
            QR
Sbjct: 311 AQR 313

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 115/241 (47%), Gaps = 29/241 (12%)

Query: 69  LRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNR 128
           ++ E+  + LLR   ++  Y  S+           +++++MEYC+GG + + +      R
Sbjct: 49  IQNEIKFLSLLRYAPNITYYYHSYLINR-------KIWIIMEYCNGGSVRNLIKI---GR 98

Query: 129 LQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPP 188
             E  +  I  ++   +  +H     +IHRDIK  N+LI+ +   K+CDFG    +    
Sbjct: 99  FNEIYISVILRELLYALEYIH--HDNIIHRDIKAANILINQNGGIKLCDFGIAAKL---- 152

Query: 189 KNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEK 248
               EF+  +   +   T  + APE+I     Y  + K+DIW++G+  Y++     P+ +
Sbjct: 153 ----EFSKPKRQTMAG-TPYWMAPEVIIESSLY--DTKADIWSVGITAYEITTGNPPYCE 205

Query: 249 --VGEAAILHSRFQFPSYP--QYSDSLKHLISFMLSENPTQRPNICQVLEE--VSRIQGT 302
               +A  L ++ + P      YS SLK  I+  L E+P++R    ++LE   +   Q T
Sbjct: 206 YDATKAMQLITKLKPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLLETEFIKEYQET 265

Query: 303 P 303
           P
Sbjct: 266 P 266

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 126/277 (45%), Gaps = 30/277 (10%)

Query: 24  IIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQ 83
            ++ L  G ++ ++ A      L + A   C K+ ++ ++  +  +  E D + LL G  
Sbjct: 12  FLEKLGQGSYSTVFRAVERANGLRNYAIKVCSKKHIIRER-KVKYVTVEKDLLNLLAGGG 70

Query: 84  H--VVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDI 141
           H  VV    +       HD +  ++ ++E+ SGG L+  +  R   RL E    +I S +
Sbjct: 71  HPGVVRLFCTF------HD-TDNLYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQL 121

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDI 201
              +  MHA    +IHRD+K ENVL+S +    + DFG+ C        P   +     +
Sbjct: 122 VDTVDYMHAKG--VIHRDLKPENVLLSQEGRIVITDFGAACCASEGGSAPGAADRAASFV 179

Query: 202 LKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF------EKVGEAAIL 255
               TA+Y +PE++ L+        SD+WALG  +Y+L     PF      +   +   L
Sbjct: 180 ---GTAEYVSPELL-LHSQCSFG--SDVWALGCIIYQLTQGAPPFRGDTELQSFEKIVAL 233

Query: 256 HSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQV 292
             R+ + + P     +  L+  +L  +P QRP+  Q+
Sbjct: 234 DYRWVYAAPPL----IVALVQSILVLDPLQRPSAKQL 266

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 136/297 (45%), Gaps = 45/297 (15%)

Query: 22  ARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRG 81
           A ++K +  G    +YTA     ++S       +K++ +  +P   ++  E+  MK   G
Sbjct: 662 ASLVK-IGQGASGGVYTAYEIGTNVS-----VAIKQMNLEKQPKKELIINEILVMK---G 712

Query: 82  NQH--VVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITS 139
           ++H  +V++IDS+  K        +++++MEY  GG L D +   +   L EG++  +  
Sbjct: 713 SKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCR 762

Query: 140 DITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQH 199
           +   G+  +H+    ++HRDIK +N+L+S +   K+ DFG  C  I       E N  + 
Sbjct: 763 ETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI------NELNLKRT 813

Query: 200 DILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGEAAILHS 257
            ++   T  + APE++      P   K DIW+LG+ + ++     P+  E    A  L +
Sbjct: 814 TMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIA 868

Query: 258 RFQFPSYPQ---YSDSLKHLISFMLSENPTQRPNICQVLE-----EVSRIQGTPCPL 306
               P   +    S  LK  + + L   P +R +   +L      E++    T  PL
Sbjct: 869 TNGTPKLKEPENLSSYLKKFLDWCLCVEPEERASATDLLHDEYITEIAEANSTLAPL 925

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 106/221 (47%), Gaps = 40/221 (18%)

Query: 31  GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYID 90
           G    +YTA    ++     ++  +K++ +  +P   ++  E+  MK  R N +VV++I+
Sbjct: 526 GASGGVYTANQVKSN-----ELVAIKQMDLEKQPKKELILNEIIVMKESRHN-NVVNFIN 579

Query: 91  SHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHA 150
           +H +K  +       +++MEY  GG L D +   L   L EG++  +  +  +G+  +H+
Sbjct: 580 AHLSKGNL-------WIVMEYMEGGSLTDVVTHCL---LSEGQIGAVCRETLEGLKFLHS 629

Query: 151 LQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ-- 208
               +IHRDIK +NVL+S     K+ DFG  C  I             +DI  N T    
Sbjct: 630 --KGVIHRDIKSDNVLLSMKGDIKLTDFG-FCAQI-------------NDIDLNRTTMVG 673

Query: 209 ---YRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF 246
              + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 674 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 711

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 95/196 (48%), Gaps = 22/196 (11%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
           S   ++L EY SGG L+D++       L+E    K    I   +  +H     ++HRD+K
Sbjct: 213 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLK 268

Query: 162 IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGY 221
           IEN++IS     ++ DFG +  +  P K    F           +  + APE++   + +
Sbjct: 269 IENIMISSSGEIRIIDFG-LSNLYDPKKQLHTF---------CGSLYFAAPELL---KAH 315

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP--SYPQY-SDSLKHLISF 277
           P    + DIW+ GV LY L     PF+    A++LH + +     YPQ+ S  +  L+S 
Sbjct: 316 PYTGPEVDIWSFGVVLYVLVCGKVPFDD-ENASVLHEKIKQGKVEYPQHLSIDVISLLSK 374

Query: 278 MLSENPTQRPNICQVL 293
           ML  +P +R  + QV+
Sbjct: 375 MLVVDPLKRATLKQVV 390

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 113/237 (47%), Gaps = 30/237 (12%)

Query: 65   SLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTR 124
            +++ LR EV  +K L  + ++V Y+    AK+G+    Y +FL  EY +GG +   +  R
Sbjct: 1186 TVDALRLEVSTLKDL-DHLNIVQYL-GFEAKNGI----YSLFL--EYVAGGSVGSLI--R 1235

Query: 125  LQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGV 184
            +  R  +  +  +T  + QG++ +H+    ++HRD+K +N+L+  D   K+ DF    G+
Sbjct: 1236 MYGRFDDILIRHLTIQVLQGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GI 1289

Query: 185  IRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTT 244
             R   +     Y   ++    T  + APEM+D  +GY  + K DIW+LG  + ++     
Sbjct: 1290 SRKSNDI----YSNSEMTMKGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKR 1343

Query: 245  PFEKVGEAAILHSRFQFPS--------YPQYSDSLKHLISFMLSENPTQRPNICQVL 293
            P+      A +    Q  S         P  S++ K  +      +P +RP   ++L
Sbjct: 1344 PWSNFEVVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 97/202 (48%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY     ++++MEYC GG L   +      ++ E  +  I  +I   +  +H  +  +I
Sbjct: 99  GSYLKNTSLWIIMEYCGGGSLRSLLR---PGKIDEKYIGVIMREILIALKYIH--KDNVI 153

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMID 216
           HRDIK  NVLI++D + K+CDFG    + +     Q             T  + APE+I 
Sbjct: 154 HRDIKAANVLINNDGSIKLCDFGVAAQLNQTKSRRQTM---------AGTPYWMAPEVI- 203

Query: 217 LYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVG--EAAILHSRFQFPSYP--QYSDSLK 272
              G   + K+DIW+ G+  Y++     P+  V    A  L ++ + P      YS  +K
Sbjct: 204 -MEGVYYDTKADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIK 262

Query: 273 HLISFMLSENPTQRPNICQVLE 294
             I+  L E+P++RP   ++L+
Sbjct: 263 EFIATCLDEDPSERPTADELLK 284

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 123/278 (44%), Gaps = 49/278 (17%)

Query: 28  LTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNV---LRAEVDAMKLLRGNQH 84
           L  G F  +Y     P+ L     I  LK +   +  + NV    + E+D        Q+
Sbjct: 124 LGKGKFGKVYCVRHKPSGL-----ICALKVMNKMEIVNFNVQKQFKREIDI-------QY 171

Query: 85  VVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITS----- 139
            +++ +     +  HD S  V+L+MEY  GG L   +        + G +  IT+     
Sbjct: 172 HLNHKNLTKLYAFFHD-SKNVYLVMEYLIGGELYKLLK-------KNGPMNDITASNYVY 223

Query: 140 DITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQH 199
            +T  +  MH  +  +IHRD+K EN+LI  +   K+ DFG     I  P N +       
Sbjct: 224 QMTDALNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC-- 276

Query: 200 DILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAA----IL 255
                 T  Y +PE+I   R Y  +E  D+WALG+  Y+L     PFE+  +      I 
Sbjct: 277 -----GTIDYLSPELIS-SREY--DENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIA 328

Query: 256 HSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
            S  +FP  P  S   + LI+ +L   P++R N+ QV+
Sbjct: 329 KSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 111/238 (46%), Gaps = 30/238 (12%)

Query: 65   SLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTR 124
            ++  +++EV  +K L  + ++V Y+     K  ++       L +EY +GG +   +  R
Sbjct: 1181 TVEAMKSEVSTLKDL-DHLNIVQYL-GFEMKHNIYS------LFLEYVAGGSVGSLI--R 1230

Query: 125  LQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGV 184
            +  R  +  +  +T+ + +G++ +H+    ++HRD+K +N+L+  D   K+ DFG     
Sbjct: 1231 MYGRFDDKLIRHLTNQVLEGLSYLHSQG--ILHRDMKADNLLLDQDGICKISDFGI---- 1284

Query: 185  IRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTT 244
                    E  Y   ++    T  + APEM+D  +GY  N K DIW+LG  + ++     
Sbjct: 1285 ----SKKSEDIYSNSEMTMRGTVFWMAPEMVDTKQGY--NAKVDIWSLGCVVLEMFAGKR 1338

Query: 245  PFEKVGEAAILHSRFQFPSYPQYSDSLKHLIS-----FM---LSENPTQRPNICQVLE 294
            P+        ++   Q  S P   +  K LIS     F+      +P +RP   Q+LE
Sbjct: 1339 PWSNFEVVTAMYKIGQSKSAPPIPEDTKDLISPTAKNFLNQCFHIDPKERPTAGQLLE 1396

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 96/197 (48%), Gaps = 24/197 (12%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
           S   ++L EY SGG L+D++       L+E    K    I   +  +H     ++HRD+K
Sbjct: 5   SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHMNN--IVHRDLK 60

Query: 162 IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL--YR 219
           IEN++IS     K+ DFG +  +  P K    F           +  + APE++    Y 
Sbjct: 61  IENIMISTSGEIKIIDFG-LSNMYNPKKQLHTF---------CGSLYFAAPELLKACPYT 110

Query: 220 GYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ--FPSYPQY-SDSLKHLIS 276
           G  +    D+W+ GV L+ L     PF+    +++LH + +     YPQ+ S  +  L+S
Sbjct: 111 GPEV----DVWSFGVVLFVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISLLS 165

Query: 277 FMLSENPTQRPNICQVL 293
            ML  +PT+R ++ QV+
Sbjct: 166 KMLVVDPTKRASLKQVV 182

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 96/203 (47%), Gaps = 23/203 (11%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           V+LLMEY   G L   +  R      +    +    I   +  +H  Q  +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPIN 224
           +LI  +   K+ DFG    +I P         V+   L  T   Y +PEMI   R    +
Sbjct: 220 ILIGFNNVIKLTDFG--WSIINPRG-------VKRKTLCGTI-DYLSPEMI---RSREYD 266

Query: 225 EKSDIWALGVFLYKLCYYTTPFE----KVGEAAILHSRFQFPSYPQYSDSLKHLISFMLS 280
           +K D+WALGV  Y+L   + PFE    ++    IL +  +FP     S  +K LIS +L 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKLLK 324

Query: 281 ENPTQRPNICQVLEEVSRIQGTP 303
            NP++R ++  V++    I+  P
Sbjct: 325 YNPSERISMRDVMKHPWIIRNKP 347

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 93/192 (48%), Gaps = 14/192 (7%)

Query: 105 VFLLMEYCSGGGLIDFMNT-RLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
           ++ L+EY   G   DF++  +    L +   +  ++ I   I  +H  Q  +IHRDIK E
Sbjct: 237 LYFLLEYAPNG---DFLSVIKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHRDIKPE 291

Query: 164 NVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI-DLYRGYP 222
           N+L+  D   K+ DFG+   ++   +  Q +N ++       TA+Y +PE++ D Y  Y 
Sbjct: 292 NILLDKDMKVKLTDFGT-AKLVEKDETTQTYNLLERSKSFVGTAEYVSPELLNDNYVDY- 349

Query: 223 INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS--RFQFPSYPQYSDSLKHLISFMLS 280
              K DIWA G  L+++     PF+   E        + Q+     +   ++ LI  +L 
Sbjct: 350 ---KCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLIKQILV 406

Query: 281 ENPTQRPNICQV 292
           +NP QR +  QV
Sbjct: 407 KNPEQRLDTLQV 418

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 106/232 (45%), Gaps = 46/232 (19%)

Query: 98  VHDGSYEVFLLMEYCSGGGLIDFMNTRLQN-RLQEGEVLKITSDITQGIAAMHALQPPLI 156
           +H  S   ++L EY SGG L+D++   +Q+  L+E      T  I   +  +H+    ++
Sbjct: 168 MHTLSNHFYMLFEYVSGGQLLDYI---IQHGSLKESRARTFTRQICSALKYLHSHN--IV 222

Query: 157 HRDIKIENVLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKN 204
           HRD+KIEN++IS D   K+ DFG            + CG +          +   ++LK 
Sbjct: 223 HRDLKIENIMISKDGNIKLIDFGLSNLYDKCNKLKTYCGSLY---------FAAPELLKA 273

Query: 205 TTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPS- 263
           T   Y  PE+             D+W+ GV LY L     PF+    + +LH + +    
Sbjct: 274 TP--YIGPEI-------------DVWSFGVVLYVLVCGKVPFDDEN-SNVLHEKIKQGKV 317

Query: 264 -YPQY-SDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTPCPLRNFYVTR 313
            YPQ+ S  +  L+S ML  +P +R  + QV+     ++    P +++   R
Sbjct: 318 FYPQFLSIEVISLLSKMLVVDPFKRATLDQVMNHHWMVRDCDGPPKSYIPDR 369

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 92/199 (46%), Gaps = 34/199 (17%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY     ++++ME+C+GG L   +      ++ E  +  I  ++   +  +H     +I
Sbjct: 87  GSYLKDTSLWIIMEHCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIHKDN--VI 141

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ---YRAPE 213
           HRDIK  NVLI+++   K+CDFG    V             Q  + + T A    + APE
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQV------------NQTSLRRQTMAGTPYWMAPE 189

Query: 214 MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYP------QY 267
           +I    G   + K DIW+LG+  Y++     P+  V   A+   +    S P       Y
Sbjct: 190 VI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCDV--EALRAMQLIIKSKPPRLEDRSY 245

Query: 268 SDSLKHLISFMLSENPTQR 286
           S SLK  I+  L E+P +R
Sbjct: 246 STSLKEFIALCLDEDPKER 264

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/312 (25%), Positives = 132/312 (42%), Gaps = 61/312 (19%)

Query: 26  KYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHV 85
           K +  G FA +Y       D +    +  + +  + +K  L  L  E+  +K L  ++H+
Sbjct: 136 KEIGKGSFAVVYRG-YSNEDPNFKLAVKSVPKSKLKNKKILENLEIEISILKKL-NHKHI 193

Query: 86  VSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQ------------------- 126
           V+ ID    K+       +  L+MEYCS G L   +  R +                   
Sbjct: 194 VNLIDCQRNKN-------DFLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPN 246

Query: 127 ---NRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLIS-------DDRTFKVC 176
              N L    VL     +   +  + +    LIHRDIK +N+L+S       D +TFK  
Sbjct: 247 PDCNGLNIAFVLNYLQQLASALKFLRSRN--LIHRDIKPQNLLLSTPYTDYHDQQTFK-- 302

Query: 177 DFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ--------YRAPEMIDLYRGYPINEKSD 228
             G +     P     +F + +   L NT+          Y APE+++ Y+ Y  N K+D
Sbjct: 303 KLGYIGISCLPILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-YQKY--NAKAD 357

Query: 229 IWALGVFLYKLCYYTTPFEKVGEAAIL------HSRFQFPSYPQYSDSLKHLISFMLSEN 282
           +W++G  LY++ Y   PF+      +L      +    FPSY +  D +K LIS +L  +
Sbjct: 358 LWSVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKFD 417

Query: 283 PTQRPNICQVLE 294
           P +R +  +  E
Sbjct: 418 PIKRMSFQEFFE 429

>Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 134/303 (44%), Gaps = 59/303 (19%)

Query: 26  KYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHV 85
           K +  G FA +Y   +  +D S    I  + R  + +K  L  L  E+  +K ++ + H+
Sbjct: 28  KEIGKGSFATVYRGHLT-SDKSQHIAIKEVSRTKLKNKKLLENLEIEIAILKKIK-HPHI 85

Query: 86  VSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLK--------- 136
           V  ID           S + +L+MEYC+ G L  F+  R +  ++   +L+         
Sbjct: 86  VGLIDCERT-------STDFYLIMEYCALGDLT-FLLKRRKELMENHPLLRTVFEKYPPP 137

Query: 137 -----------ITSDITQGIAAMHALQPP-LIHRDIKIENVLIS-------DDRTFKVCD 177
                      + S + Q  +A+  L+   L+HRDIK +N+L+S       D +TF    
Sbjct: 138 SESHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKTFHELG 197

Query: 178 FGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ--------YRAPEMIDLYRGYPINEKSDI 229
           F  +  +  P     +F + +   L NT+          Y APE+++ Y+ Y  N K+D+
Sbjct: 198 FVGIYNL--PILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-YQKY--NAKADL 250

Query: 230 WALGVFLYKLCYYTTPFEKVGEAAIL------HSRFQFPSYPQYSDSLKHLISFMLSENP 283
           W++G  ++++C  T PF       +       +    FPSY      LK LI  +L+ +P
Sbjct: 251 WSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDP 310

Query: 284 TQR 286
            +R
Sbjct: 311 VKR 313

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 91/195 (46%), Gaps = 15/195 (7%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++ L+EY S G L+  +  +      E   +  T+ I   I  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 165 VLISDDRTFKVCDFGSV----CGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI-DLYR 219
           +L++ D   K+ DFG+            ++   FN ++       TA+Y +PE++ D Y 
Sbjct: 390 ILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY- 448

Query: 220 GYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS--RFQFPSYPQYSDSLKHLISF 277
               + + DIWA G  L++L     PF+   E        + Q+     +   L+ LI  
Sbjct: 449 ---TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIKK 505

Query: 278 MLSENPTQRPNICQV 292
           +L +NP  R  I Q+
Sbjct: 506 ILIKNPNNRLTIHQI 520

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 103/203 (50%), Gaps = 37/203 (18%)

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D++   +  R+   E  ++ + I   +   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISDDRTFKVCDFGSV--CGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI--DLYR 219
           N+L+      K+ DFG    C      KN       Q + +  TT  Y APE++  D Y 
Sbjct: 158 NILLDMQGNAKLADFGFTRECAT----KN-------QLETICGTTV-YMAPELLRRDTYD 205

Query: 220 GYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP---SYPQYSDSLKH--- 273
           G+ I    DIW+LGV LY L   + PF++  E     +R ++      P Y++ + +   
Sbjct: 206 GFKI----DIWSLGVILYTLINGSMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANS 256

Query: 274 --LISFMLSENPTQRPNICQVLE 294
             LI  +L ++P +RP++ ++L+
Sbjct: 257 IELIKSLLIKDPKKRPSMTEILK 279

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 114/234 (48%), Gaps = 37/234 (15%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKP--------SLNVLRAEVDAMKLLRGN 82
            G F  +Y   +C  +L++  ++  +K+V VP           ++  LR+EV  +K L  +
Sbjct: 1284 GSFGAVY---LC-LNLTT-GEMMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKDL-DH 1337

Query: 83   QHVVSYIDSHAAKSGVHDGSYEVF-LLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDI 141
             ++V Y+          +  ++++ L +EY  GG +   +  RL  R  E  +  +T  +
Sbjct: 1338 LNIVQYLG--------FENDHDIYSLFLEYVGGGSVGSLI--RLYGRFDEALIRFLTVQV 1387

Query: 142  TQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDI 201
             +G+A +H+    ++HRD+K +N+L+  D   K+ DF    G+ R  K+     Y   D+
Sbjct: 1388 LEGLAYLHSKG--ILHRDMKADNLLLDLDGVCKISDF----GISRKSKDI----YSNSDM 1437

Query: 202  LKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL 255
                T  + APEM+D  +GY  + K DIW+LG  + ++     P+  +   A +
Sbjct: 1438 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAM 1489

>Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W
           (REAL)
          Length = 719

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 91/196 (46%), Gaps = 20/196 (10%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++L MEYC GG     + TR    + E +     S++   +  +H L    I+RD+K EN
Sbjct: 396 LYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLG--FIYRDLKPEN 453

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNP--QEFNYVQHDILKN--------TTAQYRAPEM 214
           +L+       + DF      I   KNP  ++  Y+   I  +         T +Y APE+
Sbjct: 454 ILLHQSGHVMLSDFDLSIQAI-GSKNPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEV 512

Query: 215 IDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGE----AAILHSRFQFPSYPQYSDS 270
           I   RG       D W LG+ +Y++ +  TPF+ V      + IL    +FP   + S +
Sbjct: 513 I---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGVNSNETFSNILAKDAKFPHGKEVSKN 569

Query: 271 LKHLISFMLSENPTQR 286
            K LI  +L++N T+R
Sbjct: 570 CKDLIKKLLNKNETKR 585

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 110/224 (49%), Gaps = 35/224 (15%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPS--------LNVLRAEVDAMKLLRGN 82
            G F  +Y   +C  ++++  ++  +K+V VP   S        +  LR+EV  +K L  +
Sbjct: 1223 GSFGAVY---LC-LNVTT-GEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDL-DH 1276

Query: 83   QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
             ++V Y+          D  Y +FL  EY +GG +   +  R+  R  E  +  + + + 
Sbjct: 1277 LNIVQYLGFENK-----DNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVL 1327

Query: 143  QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
            +G+A +H+    ++HRD+K +N+L+  D   K+ DF    G+ R  K+     Y   D+ 
Sbjct: 1328 RGLAYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSKDI----YSNSDMT 1377

Query: 203  KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF 246
               T  + APEM+D  +GY  + K DIW+LG  + ++     P+
Sbjct: 1378 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1419

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 95/196 (48%), Gaps = 22/196 (11%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
           S   ++L EY SGG L+D++       L+E    K    I   +  +H     ++HRD+K
Sbjct: 152 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHLNN--IVHRDLK 207

Query: 162 IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGY 221
           IEN++IS     ++ DFG +  +  P K    F           +  + APE++   + +
Sbjct: 208 IENIMISSSGEIRIIDFG-LSNMYDPKKQLHTF---------CGSLYFAAPELL---KAH 254

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP--SYPQY-SDSLKHLISF 277
           P    + DIW+ GV LY L     PF+    A++LH + +     YPQ+ S  +  L+S 
Sbjct: 255 PYTGPEVDIWSFGVVLYVLVCGKVPFDD-ENASVLHEKIKQGKVEYPQHLSIDVISLLSK 313

Query: 278 MLSENPTQRPNICQVL 293
           ML  +P +R  + QV+
Sbjct: 314 MLVVDPYKRATLKQVV 329

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 94/193 (48%), Gaps = 18/193 (9%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +     N L E +V  I   +T G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL-YRGYPI 223
           +L++++   K+ DFG V G +R       F           T  + APE++     GY  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLRSTMKRDTF---------VGTPYWMAPEVVCCEVDGY-- 189

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS--RFQFPSYP-QYSDSLKHLISFMLS 280
           NEK+DIW+LG+  Y+L     P  K     ++ +  + + P     +SD+ K  ++  L 
Sbjct: 190 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAGCLV 249

Query: 281 ENPTQRPNICQVL 293
           + P  RP+   +L
Sbjct: 250 KVPADRPSAYDLL 262

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 119/237 (50%), Gaps = 33/237 (13%)

Query: 13  TELTVGSHRARIIKYLTS---GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVL 69
           TE+      +++ K L     G    +YTA     +L + A +A +K++ +  +P   ++
Sbjct: 686 TEICTTGDPSKLYKNLIKIGQGASGGVYTA----YELGTNASVA-IKQMNLEKQPKKELI 740

Query: 70  RAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRL 129
             E+  MK  + N ++V++IDS+  +        +++++MEY  GG L D +   +   L
Sbjct: 741 VNEILVMKGSKHN-NIVNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---L 789

Query: 130 QEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPK 189
            EG++  ++ +  +G+  +H+    +IHRDIK +N+L+S +   K+ DFG  C  I    
Sbjct: 790 TEGQIGAVSRETLKGLQFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQIN--- 843

Query: 190 NPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF 246
              E N  +  ++   T  + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 844 ---EVNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 110/237 (46%), Gaps = 40/237 (16%)

Query: 69  LRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNR 128
           +  E+  MKLLR + +V+S  D       V + +  +++++EY   G L + +  +    
Sbjct: 81  IEREIIIMKLLR-HANVLSLYD-------VWETNSNLYMILEYAEKGELFNLLVEK--GP 130

Query: 129 LQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPP 188
           L E E ++    I  GI+  HAL   ++HRD+K EN+L+      K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA------ 182

Query: 189 KNPQEFNYVQHDILKNTTA---QYRAPEMID--LYRGYPINEKSDIWALGVFLYKLCYYT 243
                      D L  T+     Y APE++    Y G+    +SD+W+ GV L+ L    
Sbjct: 183 -------LETEDKLLETSCGSPHYAAPEIVSGIPYHGF----ESDVWSCGVILFALLTGR 231

Query: 244 TPF-EKVGEA-----AILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLE 294
            PF E+ G        +   +F+ P   + S   + LIS +L+ +PT+R    ++L+
Sbjct: 232 LPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 94/193 (48%), Gaps = 18/193 (9%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +     N L E +V  I   +T G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL-YRGYPI 223
           +L++++   K+ DFG V G IR       F           T  + APE++     GY  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIRSTMKRDTF---------VGTPYWMAPEVVCCEVDGY-- 189

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS--RFQFPSYP-QYSDSLKHLISFMLS 280
           NEK+DIW+LG+  Y+L     P  K     ++ +  + + P     +S++ K  ++  L 
Sbjct: 190 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAGCLV 249

Query: 281 ENPTQRPNICQVL 293
           + P  RP+   +L
Sbjct: 250 KAPADRPSAYDLL 262

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 85/308 (27%), Positives = 134/308 (43%), Gaps = 54/308 (17%)

Query: 9   YQPGTELTVGSH-RARIIKYLTSGGFAHIYTAEICPADL-------SSPAKIACLKRVLV 60
           ++ G  L  GS  R R+ K + +G  A I   +I P +         SPAK         
Sbjct: 73  WKLGKTLGKGSSGRVRLAKNMKTGQLAAI---KIVPKNFHSKKKRQDSPAKSLSSS---- 125

Query: 61  PDKPSL---NVLRAEVDAMKLLRGNQHVVSYIDSHAAKSG---VHDGSYEVFLLMEYCSG 114
           PDKP     N      ++  + R  + V+  + SH    G   V +   E++L++EY  G
Sbjct: 126 PDKPYTTHSNETNPSNNSYGIER--EIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDG 183

Query: 115 GGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLIS-DDRTF 173
           G L D++ +R   +L E E +     I QG+A  HA    + HRD+K EN+L+   ++  
Sbjct: 184 GELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPENLLLDKKNKII 239

Query: 174 KVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTA---QYRAPEMI--DLYRGYPINEKSD 228
           K+ DFG     +              D L +T+     Y +PE++    Y G P    +D
Sbjct: 240 KIADFGMAALEVS-------------DKLLSTSCGSPHYASPEIVMGKSYHGSP----TD 282

Query: 229 IWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSD---SLKHLISFMLSENPTQ 285
           +W+ G+ L+ L     PF       +L  + Q   Y   SD     K LIS +L  +P +
Sbjct: 283 VWSCGIILFALLTGHLPFNHDNIKKLLL-KVQSGVYHMPSDLSPDAKDLISKILVVDPDK 341

Query: 286 RPNICQVL 293
           R    ++L
Sbjct: 342 RLTTTEIL 349

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 118/263 (44%), Gaps = 40/263 (15%)

Query: 45  DLSSPAKIACLKRVLVPDKPSLNV-LRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSY 103
           D+     I  ++R  +P      V +  E++A+K L  N   +  ++       V   S 
Sbjct: 67  DVPKQVAIKLIRRDTIPKNSEKEVKIYREINALKHL--NHPNIVRLEE------VLQNSK 118

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
            + +++EY SGG    ++  +   RL+E    ++ + +  G+  MH+    L+HRD+K+E
Sbjct: 119 YIGIVLEYASGGEFYKYIQKK--RRLKESAACRLFAQLISGVYYMHSKG--LVHRDLKLE 174

Query: 164 NVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ--YRAPEMIDLYRGY 221
           N+L+  +    + DFG V   +  P+N         +++K +     Y APE++   R Y
Sbjct: 175 NLLLDKNENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPELVVTARPY 223

Query: 222 PINEKSDIWALGVFLYKLCYYTTPFEKVGEAA-----------ILHSRFQFPSYPQYSDS 270
               K+DIW+ GV +Y +     P++   E             I  +  +FP Y   +  
Sbjct: 224 EA-RKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDY--IAPV 280

Query: 271 LKHLISFMLSENPTQRPNICQVL 293
            + L+  +L  +P +R  I Q L
Sbjct: 281 PRDLLRAILVADPKKRITIAQTL 303

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 91/194 (46%), Gaps = 20/194 (10%)

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
           +++++MEYC+GG L   +      ++ E  +  I  ++   +  +H  +  +IHRDIK  
Sbjct: 94  KLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRNLLVALLYIH--KDNVIHRDIKAA 148

Query: 164 NVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPI 223
           NVLI++    K+CDFG    +       Q             T  + APE+I    G   
Sbjct: 149 NVLITNGGHVKLCDFGVAAQLTTANHKRQTM---------AGTPYWMAPEVI--MEGVYY 197

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVG--EAAILHSRFQFPSYP--QYSDSLKHLISFML 279
           N K+DIW+LG+  Y++     P+  V    A  L ++ + P      YS  LK  I+  L
Sbjct: 198 NTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCL 257

Query: 280 SENPTQRPNICQVL 293
            E+P  RP   ++L
Sbjct: 258 DEDPEARPTAEELL 271

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 107/230 (46%), Gaps = 36/230 (15%)

Query: 101 GSY----EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLI 156
           GSY     ++++MEYC+GG L   +      ++ E  +  I  ++   +  +H  +  +I
Sbjct: 80  GSYLRGTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKVIH--KDNVI 134

Query: 157 HRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQ---YRAPE 213
           HRDIK  NVLI+++   K+CDFG             + N  Q  + + T A    + APE
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFGVAA----------QLN--QTSLRRQTMAGTPYWMAPE 182

Query: 214 MIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYP------QY 267
           +I    G   + K DIW+LG+  Y++     P+  V   A+   +    S P       Y
Sbjct: 183 VI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDV--EALRAMQLIIKSKPPRLEERNY 238

Query: 268 SDSLKHLISFMLSENPTQRPNICQVLEE--VSRIQGTPCPLRNFYVTRAM 315
           +  LK  I+  L E+P +R +  ++L+   +   + TP  +    ++R +
Sbjct: 239 TPQLKEFIALCLDEDPQERLSAEELLKTKFIKTHKATPTTILKELISRYL 288

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 111/244 (45%), Gaps = 38/244 (15%)

Query: 69  LRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHD-GSYEVFLLMEYCSGGGLIDFMNTRLQN 127
           +R E++ MK    +++VV   D       ++D  S +V+L++EYCS G +      +L+ 
Sbjct: 101 IREEIEIMKRCH-HENVVKLYDI------LNDPESTKVYLVLEYCSRGPVKWCPENQLEI 153

Query: 128 RLQEGEVL------KITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSV 181
           +     +L      KI SD+  G+  +H+    + HRDIK  N+LIS +   K+ DFG  
Sbjct: 154 KAVGPSILTFEQARKIVSDVVSGLEYLHS--QGITHRDIKPSNLLISSNGAVKISDFGVS 211

Query: 182 CGVIRPPKNPQEFNYVQHDILKNTTA---QYRAPEMIDLYRGYPINEKSDIWALGVFLYK 238
                   N Q     Q  I K+ T     + APE+      Y  +   DIW+LGV LY 
Sbjct: 212 ILTTTGSTNIQS---SQEQISKSKTLGTPAFFAPELCTADGDYRCSSAIDIWSLGVTLYC 268

Query: 239 LCYYTTPFEKVGEAA----ILHSRFQFPSYPQYS------------DSLKHLISFMLSEN 282
           + + T PF           I+     FPSY Q S            +  K +++ +L +N
Sbjct: 269 MLFGTLPFNANSALELFDNIISKPLSFPSYEQVSKRGHPNLAREEYNDAKDILNRLLKKN 328

Query: 283 PTQR 286
           P++R
Sbjct: 329 PSER 332

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 95/197 (48%), Gaps = 24/197 (12%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
           S   ++L EY SGG L+D++       L+E    K    I   +  +H     ++HRD+K
Sbjct: 280 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHLNN--IVHRDLK 335

Query: 162 IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL--YR 219
           IEN++IS     K+ DFG +  +  P K    F           +  + APE++    Y 
Sbjct: 336 IENIMISTSGEIKIIDFG-LSNMFNPKKQLHTF---------CGSLYFAAPELLKACPYT 385

Query: 220 GYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ--FPSYPQY-SDSLKHLIS 276
           G  +    D+W+ GV LY L     PF+    +++LH + +     YPQ+ S  +  L+S
Sbjct: 386 GPEV----DVWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISLLS 440

Query: 277 FMLSENPTQRPNICQVL 293
            ML  +P++R  + QV+
Sbjct: 441 KMLVVDPSKRATLKQVV 457

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 88/198 (44%), Gaps = 21/198 (10%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           V+L MEYC GG     + TR    + E +     S++T  +  +H L    I+RD+K EN
Sbjct: 509 VYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLLG--FIYRDLKPEN 566

Query: 165 VLISDDRTFKVCDFG---SVCGVIRPPKN-PQEFNYVQHDILKN--------TTAQYRAP 212
           +L+       + DF          +P K    + + V   +            T +Y AP
Sbjct: 567 ILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMVDTKVFSEGFRTNSFVGTEEYIAP 626

Query: 213 EMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPF--EKVGE--AAILHSRFQFPSYPQYS 268
           E+I   RG       D W LG+ +Y++ +  TPF  E   E    IL +   FP + + S
Sbjct: 627 EVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFKGENTNETFCNILKNEVTFPEHHEIS 683

Query: 269 DSLKHLISFMLSENPTQR 286
              K LI  +LS+N ++R
Sbjct: 684 RHCKDLIRKLLSKNESKR 701

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 112/233 (48%), Gaps = 35/233 (15%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPS--------LNVLRAEVDAMKLLRGN 82
            G F  +Y   +C  ++++  ++  +K+V VP   S        +  LR+EV  +K L  +
Sbjct: 1105 GSFGAVY---LC-LNVTT-GEMMAVKQVEVPKYSSQDENIISTVEALRSEVSTLKDL-DH 1158

Query: 83   QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
             ++V Y+          D  Y +FL  EY +GG +   +  R+  R  E  +  +T  + 
Sbjct: 1159 LNIVQYLGFEN-----KDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEAMIRHLTIQVL 1209

Query: 143  QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
            +G++ +H+    ++HRD+K +N+L+  D   K+ DF    G+ R   +     Y   D+ 
Sbjct: 1210 RGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSNDI----YSNSDMT 1259

Query: 203  KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL 255
               T  + APEM+D  +GY  + K DIW+LG  + ++     P+  +   A +
Sbjct: 1260 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAM 1310

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 89/196 (45%), Gaps = 21/196 (10%)

Query: 100  DGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRD 159
            D  Y    L  +   G +  F    L+  + E E   I   I  GI  +H     ++HRD
Sbjct: 872  DDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRD 929

Query: 160  IKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI--DL 217
            IK ENV++  +   K+ DFGS          P E  +V        T  Y APE++  + 
Sbjct: 930  IKDENVIVDSNGFVKLIDFGSAA---YTKTGPFEV-FVG-------TIDYAAPEILGGNP 978

Query: 218  YRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISF 277
            Y+G P     DIWALGV LY L Y   PF  V E  IL  + +F      +     LI +
Sbjct: 979  YKGKP----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRW 1032

Query: 278  MLSENPTQRPNICQVL 293
            +L+++   RP+I +++
Sbjct: 1033 ILTKSVNDRPSIDEIV 1048

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 105/229 (45%), Gaps = 48/229 (20%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQN-RLQEGEVLKITSDITQGIAAMHALQPPLIHRDI 160
           S   ++L EY SGG L+D++   +Q+  L+E    K    I   +  +H+    ++HRD+
Sbjct: 279 SNHFYMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALQYLHSNN--IVHRDL 333

Query: 161 KIENVLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQ 208
           KIEN++IS     K+ DFG            + CG +                       
Sbjct: 334 KIENIMISTSGEIKIIDFGLSNLYDTTRQLHTFCGSL----------------------Y 371

Query: 209 YRAPEMIDLYRGYP-INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ--FPSYP 265
           + APE++   + +P    + D+W+ GV LY L     PF+    +++LH + +     YP
Sbjct: 372 FAAPELL---KAHPYTGPEVDVWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVDYP 427

Query: 266 QY-SDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTPCPLRNFYVTR 313
           Q+ S  +  L+S ML  +P +R  + QV+E    ++G   P  ++   R
Sbjct: 428 QHLSIEVISLLSKMLVVDPKKRATLRQVVEHHWMVRGYDNPSSSYLPNR 476

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 102/224 (45%), Gaps = 37/224 (16%)

Query: 85  VVSYIDSHAAKSGVHD---GSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDI 141
           V+  + SH    G++D    +  ++L++EY   G L + +  R    L E E +K    I
Sbjct: 79  VIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQI 136

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHD- 200
              ++  HAL   ++HRD+K EN+L+  D   KV DFG                 +Q D 
Sbjct: 137 IIAVSYCHALG--IVHRDLKPENLLLDSDYNIKVADFGMAA--------------LQTDA 180

Query: 201 -ILKNTTA--QYRAPEMIDL--YRGYPINEKSDIWALGVFLYKLCYYTTPF-EKVGEAAI 254
            +L+ +     Y APE++    Y G+     SD+W+ GV L+ L     PF E+ G    
Sbjct: 181 ALLETSCGSPHYAAPEIVSGLPYEGFS----SDVWSCGVILFALLTGRLPFDEENGNIRT 236

Query: 255 L-----HSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
           L       +F+ P   + S   + LIS +L  +P QR  I  +L
Sbjct: 237 LLLKVQRGQFEMPDDTEISKDAQDLISKILVVDPAQRIKIRDIL 280

>Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 104/221 (47%), Gaps = 28/221 (12%)

Query: 24  IIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRA--EVDAMKLLRG 81
           II++L  G +  + + +      + PAKIA  K   + +K  L + RA  E+  M   +G
Sbjct: 40  IIQFLGKGAYGTVCSVKF--KGQNPPAKIAVKKISNIFNKEIL-LKRAIRELKFMNFFKG 96

Query: 82  NQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDI 141
           ++++V+ ID     S  +DG Y    L++Y     L   +++ +Q  L E  +      I
Sbjct: 97  HKNIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQI 150

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGV------IRPPKNPQEFN 195
             G+  +H+    +IHRD+K  N+L + +   K+CDFG   G+        P   P   N
Sbjct: 151 LCGLKYIHSAD--VIHRDLKPGNILCTLNGCLKICDFGLARGIHAEFFQCNPSVQPHITN 208

Query: 196 YVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFL 236
           YV        T  YRAPE+  L    P N+  DIWA+G  L
Sbjct: 209 YV-------ATRWYRAPEL--LLSNQPYNKSIDIWAVGCIL 240

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 87/184 (47%), Gaps = 22/184 (11%)

Query: 116  GLIDFMN-TRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFK 174
            G ID  +   L+  + E E   I   +  GI  +H  +  ++HRDIK ENV++      K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 175  VCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI--DLYRGYPINEKSDIWAL 232
            + DFGS   V   P           D+   T   Y APE++  + Y G P     DIWA+
Sbjct: 1127 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAV 1171

Query: 233  GVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQV 292
            G+ LY + +   PF  + E  I+    +F    + S+   +LI  +L++N  +RP I  +
Sbjct: 1172 GILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDI 1229

Query: 293  LEEV 296
             ++V
Sbjct: 1230 YDDV 1233

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 97/209 (46%), Gaps = 51/209 (24%)

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
           +V++  EYC G  L D +   LQ R+     +++ + I   +   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRA 211
           N+L+  +   K+ DFG            ++CG                      T  Y A
Sbjct: 159 NILLDKNGNAKLTDFGFTRECMTKTSLETICG----------------------TTVYMA 196

Query: 212 PEMI--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSD 269
           PE+I  + Y G+ I    DIW+LGV LY +   + PF++  E             P ++D
Sbjct: 197 PELIKRESYDGFKI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMN--EMPVFND 250

Query: 270 SL-----KHLISFMLSENPTQRPNICQVL 293
           ++     K L+  +LS++P +RP++ ++L
Sbjct: 251 TILSEDAKDLLIKLLSKDPNERPSMQEIL 279

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 122/251 (48%), Gaps = 34/251 (13%)

Query: 53  ACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQH--VVSYIDSHAAKSGVHDGSYEVFLLME 110
             +K++ +  +P   ++  E+  MK   G++H  +V++IDS+     + DG  +++++ME
Sbjct: 637 VAIKQMNLEKQPKKELIINEILVMK---GSRHPNIVNFIDSY-----LLDG--DLWVIME 686

Query: 111 YCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDD 170
           Y  GG L D +   +   L EG++  +  +   G+  +H+    ++HRDIK +N+L+S  
Sbjct: 687 YMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLQFLHSKG--VLHRDIKSDNILLSIS 741

Query: 171 RTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIW 230
              K+ DFG  C  I       E N  +  ++   T  + APE++      P   K DIW
Sbjct: 742 GDIKLTDFG-FCAQI------NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIW 789

Query: 231 ALGVFLYKLCYYTTPF--EKVGEAAILHSRFQFPSYPQ---YSDSLKHLISFMLSENPTQ 285
           +LG+ + ++     P+  E    A  L +    P   +    S  L++ + + L  +P Q
Sbjct: 790 SLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKEPENLSAVLRNFLDWCLKVDPEQ 849

Query: 286 RPNICQVLEEV 296
           R +   +L +V
Sbjct: 850 RASATDLLNDV 860

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 95/200 (47%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D++  +   R+   E  K+ + I   +   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGNELYDYLLQK--QRIPLDETSKLFAQIVGAVFYAHSLQ--CVHRDLKLE 157

Query: 164 NVLISDDRTFKVCDFGSV--CGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI--DLYR 219
           N+L+       + DFG    C               Q + +  TT  Y APE+I  + Y 
Sbjct: 158 NILLDKQGYAMLTDFGFTRECAT-----------KTQLETICGTTV-YMAPELIKRESYD 205

Query: 220 GYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSL-----KHL 274
           GY    K D W+LG+ LY + +   PF++  E   L         P   D+      K L
Sbjct: 206 GY----KVDTWSLGIILYTMLHGFMPFDE--EDPTLTGLKIMNEMPPIVDAYTNVHAKDL 259

Query: 275 ISFMLSENPTQRPNICQVLE 294
           I  +L + P++RP++ +VLE
Sbjct: 260 ILKLLRKTPSERPSLNKVLE 279

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 127/282 (45%), Gaps = 43/282 (15%)

Query: 31   GGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLN--------VLRAEVDAMKLLRGN 82
            G F  +Y +        +  ++  +K+V VP+  S N         LR+EV  +K L  +
Sbjct: 1347 GSFGSVYLSLNV-----TTGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTLLKDL-DH 1400

Query: 83   QHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDIT 142
             ++V Y+       G    +    L +EY +GG +   +  R+  R  E  +   T+ I 
Sbjct: 1401 INIVQYL-------GFEKKNNIYSLFLEYVAGGSIGSLI--RMYGRFDESLIRHSTTQIL 1451

Query: 143  QGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDIL 202
             G++ +H+    ++HRD+K +N+L+  +   K+ DF    G+ R  K+     Y   ++ 
Sbjct: 1452 AGLSYLHS--KGILHRDMKADNILLDGEGICKISDF----GISRKSKDI----YSNSEMT 1501

Query: 203  KNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFP 262
               T  + APEM+D  +GY  + K DIW+LG  + ++     P+  +   A +    Q  
Sbjct: 1502 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIILEMFAGKRPWSNLEVVAAMFKIGQSK 1559

Query: 263  SYPQYSDSLKHLIS-----FM---LSENPTQRPNICQVLEEV 296
            S P   +    LIS     F+      +P +RP   Q+L+ +
Sbjct: 1560 SAPPIPEDTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHL 1601

>Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON}
           similar to Ashbya gossypii ADR167W
          Length = 896

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 91/201 (45%), Gaps = 27/201 (13%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++L MEYC GG     + TR    + E +     S++T  +  +H +    I+RD+K EN
Sbjct: 555 LYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASEVTAALEYLHLMG--FIYRDLKPEN 612

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNT-------------TAQYRA 211
           +L+       + DF  +    + P+NPQ     Q  ++                T +Y A
Sbjct: 613 ILLHQSGHIMLSDF-DLSVQAKGPRNPQVKGNAQSSLVDTKICSDGFRTNSFVGTEEYIA 671

Query: 212 PEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGE------AAILHSRFQFPSYP 265
           PE+I   RG       D W LG+  Y++ +  TPF+  GE      + IL     FP+  
Sbjct: 672 PEVI---RGNGHTASVDWWTLGILTYEMLFGFTPFK--GENTNQTFSNILKVEATFPNNN 726

Query: 266 QYSDSLKHLISFMLSENPTQR 286
           + S + K LI  +L ++ T+R
Sbjct: 727 EISRTCKDLIKKLLIKSETKR 747

>Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {ON}
           complement(67104..68684) [1581 nt, 527 aa]
          Length = 526

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 84/318 (26%), Positives = 140/318 (44%), Gaps = 51/318 (16%)

Query: 6   NDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPS 65
           NDI + G EL   +H    I  +T G         +    L S +KI  LK        +
Sbjct: 217 NDIDEIGEELWNHTHFKDEI--VTLGLLGEGAGGSVAKCKLKSGSKIFALK--------T 266

Query: 66  LNVLRAEVDAMK-LLRGNQHVVSYIDSHAAK---SGVHDGSYEVFLLMEYCSGGGL---- 117
           +N L  + +  K + R  Q   S+   +  +       + +  +F+ MEY  G  L    
Sbjct: 267 INTLNTDPEYQKQIFRELQFNKSFKSDYIVRYYGMFTDESNSSIFIAMEYMGGRSLDAIY 326

Query: 118 IDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCD 177
           ++ +N  L  R+ E  + KI   + +G++ +H  +  +IHRDIK +N+L+++    K+CD
Sbjct: 327 LNLLN--LGGRIGEKVLGKIAESVLRGLSYLHERK--VIHRDIKPQNILLNEKGQVKLCD 382

Query: 178 FGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLY 237
           FG V G        +  N +        T+ Y APE I   +G P +   D+W+LG+ L 
Sbjct: 383 FG-VSG--------EAVNSLATTF--TGTSFYMAPERI---QGQPYSVTCDVWSLGLTLL 428

Query: 238 KLCYYTTPFEKVGEAA----------ILHSRFQFPSYPQ----YSDSLKHLISFMLSENP 283
           ++     PF      A          IL    Q    P+    +S S K  I + L ++P
Sbjct: 429 EVAQAKFPFGSDKMTATIAPIELLMLILTFSPQLKDEPELNIVWSKSFKSFIEYCLKKDP 488

Query: 284 TQRPNICQVLEEVSRIQG 301
           ++RP+  Q+++    IQG
Sbjct: 489 SERPSPRQMIQH-PWIQG 505

>CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} similar
           to uniprot|P08458 Saccharomyces cerevisiae YDR523c SPS1
           ser/thr protein kinase
          Length = 521

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 127/279 (45%), Gaps = 30/279 (10%)

Query: 19  SHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKL 78
           S R  I   +  G F  +Y A+    +     K+  L+      +  + +L  E+  +  
Sbjct: 2   SKRFVIENCIGRGNFGDVYKAKDTWLNEVVAVKVVNLEN----SEEEVELLAQEIFFLAE 57

Query: 79  LRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKIT 138
           L+ + +V +YI      + V D S  +++ MEYC GG + D +     + L E +   IT
Sbjct: 58  LK-SPYVTNYI-----ATVVEDVS--MWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFIT 109

Query: 139 SDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQ 198
            +I +G++ +H+ +   IHRDIK  N+L++D+   K+ DFG V G +        F    
Sbjct: 110 REILKGLSYLHSQRK--IHRDIKAANILLTDEGKVKLSDFG-VSGKLLSSFRRDTF---- 162

Query: 199 HDILKNTTAQYRAPEMIDL-YRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAI--- 254
                  T  + APE++     GY  +E++DIW+LG+ + ++   + P  K     +   
Sbjct: 163 -----VGTPYWMAPEIVAHDSEGY--DERADIWSLGITVIEMLRGSPPLSKYDPMKVIAN 215

Query: 255 LHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVL 293
           L  R     +  +SD  KH ++  L +    RP    +L
Sbjct: 216 LPKRKPPKLHGDFSDDAKHFVALCLIKESAIRPTAADLL 254

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 91/195 (46%), Gaps = 17/195 (8%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  M  +    L E      ++ I  GI  +H+    +IHRDIK EN
Sbjct: 256 LYFLLEYAPNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHS--KGIIHRDIKPEN 311

Query: 165 VLISDDRTFKVCDFGSVCGVIRPPKNPQ----EFNYVQHDILKNTTAQYRAPEMI-DLYR 219
           +L+  D   K+ DFG+    I  PKN      EFN +        TA+Y +PE++ D Y 
Sbjct: 312 ILLDKDMKVKITDFGT--AKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY- 368

Query: 220 GYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHS--RFQFPSYPQYSDSLKHLISF 277
              ++ + DIWA G  ++++     PF+   E        + Q+     +   ++ L+  
Sbjct: 369 ---VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVVVRDLVKR 425

Query: 278 MLSENPTQRPNICQV 292
           +L + P QR  I Q+
Sbjct: 426 ILLKVPEQRLTIPQI 440

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 99/209 (47%), Gaps = 49/209 (23%)

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L + +  RL  R+   E  ++ + I+  +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHL-LRLH-RIPVDECSRLFAQISGAMYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRA 211
           N+L+      K+ DFG            ++CG                      T  Y A
Sbjct: 158 NILLDKVGNAKLTDFGFTRECASKNILETICG----------------------TTVYMA 195

Query: 212 PEMI--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFE----KVGEAAILHSRFQFPSYP 265
           PE+I  + Y G+ I    D+W+LGV LY L     PF+    K  E  I++    F S  
Sbjct: 196 PELIKRERYDGFKI----DVWSLGVILYTLLNGFMPFDEEQQKNTEWKIVNEMPSFDSTL 251

Query: 266 QYSDSLKHLISFMLSENPTQRPNICQVLE 294
              D++  L+S +L+++P  RP++ +VLE
Sbjct: 252 LGPDAVD-LLSKLLAKDPIDRPSMKEVLE 279

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 88/197 (44%), Gaps = 33/197 (16%)

Query: 101  GSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDI 160
            GS ++F ++E+ S               + E E   I   I  GI  +H     ++HRDI
Sbjct: 1038 GSVDLFDIIEFKSN--------------MTEFEAKLIFKQIVSGIKHLH--DQGIVHRDI 1081

Query: 161  KIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRG 220
            K ENV++      K+ DFGS   V   P           D+   T   Y APE++    G
Sbjct: 1082 KDENVIVDSKGFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---G 1127

Query: 221  YPINEKS-DIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFML 279
             P   KS DIWA+G+ LY L Y   PF  + E  IL    +F      S   K LI+ +L
Sbjct: 1128 NPYEGKSQDIWAIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKIL 1185

Query: 280  SENPTQRPNICQVLEEV 296
            +    +RP I ++ ++V
Sbjct: 1186 NRCVRKRPTIDEICQDV 1202

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 106/214 (49%), Gaps = 30/214 (14%)

Query: 50   AKIACLKRVLVP-----DKPSLNV---LRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDG 101
             ++  +K+V VP     D+ +++V   LR+EV  +K L  + ++V Y+       G  + 
Sbjct: 1197 GEMMAVKQVEVPKFGSQDEATISVVEALRSEVSTLKNL-DHLNIVQYL-------GFENK 1248

Query: 102  SYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIK 161
            +    L +EY +GG +   +  RL  R  E  +  +T  + +G++ +H+    ++HRD+K
Sbjct: 1249 NSIYSLFLEYVAGGSVGSLI--RLYGRFDESLIRFLTVQVLRGLSYLHSRG--ILHRDMK 1304

Query: 162  IENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGY 221
             +N+L+  D   K+ DF    G+ R   +     Y   D+    T  + APEM+D  +GY
Sbjct: 1305 ADNLLLDLDGVCKISDF----GISRKSNDI----YCNSDMTMRGTVFWMAPEMVDTKQGY 1356

Query: 222  PINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL 255
              + K DIW+LG  + ++     P+  +   A +
Sbjct: 1357 --SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAM 1388

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 75.5 bits (184), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 114/276 (41%), Gaps = 39/276 (14%)

Query: 24  IIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNV---LRAEVDAMKLLR 80
           I K L  G F  +Y    C   + S   +  LK +   D    N+    R EV+    LR
Sbjct: 111 IGKVLGKGKFGRVY----CVRHIES-GFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLR 165

Query: 81  GNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSD 140
                  Y   H  K         V+LLMEY   G L   +  R  +   +         
Sbjct: 166 HPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGR--SHFNDVVASYYVYQ 215

Query: 141 ITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHD 200
           +   +  MH  +  ++HRDIK EN++I  + T K+ DFG    VI P  + ++       
Sbjct: 216 MADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG--WSVITPKGSKRK------- 264

Query: 201 ILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAA----ILH 256
                T  Y +PE+I   R    NEK D+WALGV  Y+L   + PFE+  +      IL 
Sbjct: 265 -TLCGTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILK 320

Query: 257 SRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQV 292
               FP +       +HLIS +L  +P  R  + +V
Sbjct: 321 RNLIFPDH--VDTEARHLISRLLEYDPGDRIPLKEV 354

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 140/314 (44%), Gaps = 57/314 (18%)

Query: 9   YQPGTELTVGSH-RARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLN 67
           ++ G  L  GS  R R+ K + +G  A I   +I P      A + C     VP+  S +
Sbjct: 81  WKLGKTLGKGSSGRVRLAKNMETGQLAAI---KIVPK---KKAFVHCSNNGTVPNSYSSS 134

Query: 68  VLRAEVDAMKLLRGNQH---------------VVSYIDSHA---AKSGVHDGSYEVFLLM 109
           ++ + V +  +    +H               V+  + SH    A   V +   E++L++
Sbjct: 135 MVTSNVSSPSIA-SREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVL 193

Query: 110 EYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLIS- 168
           EY  GG L D++ ++   +L E E +     I +G++  H+    + HRD+K EN+L+  
Sbjct: 194 EYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPENLLLDK 249

Query: 169 DDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNT--TAQYRAPEMI--DLYRGYPIN 224
            +R  K+ DFG +  +  P K           +LK +  +  Y +PE++    Y G P  
Sbjct: 250 KNRRIKIADFG-MAALELPNK-----------LLKTSCGSPHYASPEIVMGRPYHGGP-- 295

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKVGEAAIL----HSRFQFPSYPQYSDSLKHLISFMLS 280
             SD+W+ G+ L+ L     PF       +L      ++Q PS    S   + LIS +L 
Sbjct: 296 --SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPS--NLSSEARDLISKILV 351

Query: 281 ENPTQRPNICQVLE 294
            +P +R    ++L+
Sbjct: 352 IDPEKRITTQEILK 365

>NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {ON}
           Anc_6.262 YPL236C
          Length = 367

 Score = 75.5 bits (184), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 126/302 (41%), Gaps = 57/302 (18%)

Query: 55  LKRVLVP--DKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYC 112
           LKR+  P  D  S++    E+   K   GN H++S +D    +   +DGS ++ +L  + 
Sbjct: 64  LKRIYCPFGDIESVSAAMNEISYYKKFAGNSHIISCLDYQLHQK--YDGSKQIDVLFPFY 121

Query: 113 SGGGLIDFMN-------TRLQNRLQEGEVLKITSDITQGIAAMH---------------- 149
             G + D +N       T L   + E + +KI   + +G+  +H                
Sbjct: 122 HYGSVQDDINRHLLSSSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIM 181

Query: 150 --ALQPPLIHRDIKIEN--------------------VLISDDRTFKVCDFGSVCGVIRP 187
             +   PL+  D+ +E                     +L+S+     + D  S       
Sbjct: 182 SYSENAPLLLNDLPMELSKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNIT 241

Query: 188 PKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFE 247
                + N  Q  I ++ T Q+ APE++ L  G  I  K DIW+LG  LY + +  +PFE
Sbjct: 242 ISTEIQLNRFQQWIEEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFE 301

Query: 248 K-------VGEAAILHSRFQFP-SYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299
           +       V +  I   ++  P +   YS  +  +++  L  +P++RP++  +L  +  I
Sbjct: 302 REEQLNGGVVKYCIKMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNLQEI 361

Query: 300 QG 301
           QG
Sbjct: 362 QG 363

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 100/200 (50%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCSGGGLIDFMNTRLQ-NRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKI 162
           +V++ +EYC G  L D +   LQ  R+   E +++ S I   +   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 163 ENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDL--YRG 220
           EN+L+  D   K+ DFG     +           V  + +  TT  Y APE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDFGFTRECMEK---------VNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 YPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ-FPSYPQYSDSL-----KHL 274
           + I    DIW+LGV LY +   + PF++  EA    ++++     P+Y+        + L
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDEAK---TKWKIINEEPEYNSKFMTAEGEDL 268

Query: 275 ISFMLSENPTQRPNICQVLE 294
           +  +L ++   RP++ ++L+
Sbjct: 269 VRKLLQKDSNLRPSVREILQ 288

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 93/215 (43%), Gaps = 47/215 (21%)

Query: 105 VFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIEN 164
           V+LLMEY   G L  + + R+     +       + +   +  MH     ++HRDIK EN
Sbjct: 213 VYLLMEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMHDRN--VLHRDIKPEN 268

Query: 165 VLISDDRTFKVCDFG------------SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAP 212
           +LI    T K+ DFG            ++CG                      T  Y +P
Sbjct: 269 ILIGFQNTLKLTDFGWSVISTTGAKRKTLCG----------------------TLDYLSP 306

Query: 213 EMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAA----ILHSRFQFPSYPQYS 268
           E++  YR Y  +EK D+WALGV  Y+L   T PFE+  +      I+    +FP   Q S
Sbjct: 307 ELVK-YREY--DEKVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFPD--QMS 361

Query: 269 DSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTP 303
              + LI  +L  +P+ R ++  VL     ++  P
Sbjct: 362 IDARDLIGRLLENDPSTRISLKDVLSHPWIVKNKP 396

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 107/222 (48%), Gaps = 34/222 (15%)

Query: 85  VVSYIDSHA---AKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDI 141
           V+  + SHA   A   V +   E++L++EY  GG L D++ +R   +L E E +     I
Sbjct: 166 VIMKLISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQI 223

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLIS-DDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHD 200
            +G++  H+    + HRD+K EN+L+   ++  K+ DFG +  +  P K           
Sbjct: 224 VEGVSYCHSFN--ICHRDLKPENLLLDKKNKKIKIADFG-MAALELPNK----------- 269

Query: 201 ILKNT--TAQYRAPEMI--DLYRGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAIL- 255
           +LK +  +  Y +PE++    Y G P    SD+W+ G+ L+ L     PF       +L 
Sbjct: 270 LLKTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLL 325

Query: 256 ---HSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLE 294
                ++Q P     S   ++LIS +L  +P +R    ++LE
Sbjct: 326 KVQSGKYQMPM--NLSLEARNLISKILVIDPEKRITTQEILE 365

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 122/271 (45%), Gaps = 48/271 (17%)

Query: 50   AKIACLKRVLVP-----DKPSLNVLRAEVDAMKLLRGNQH--VVSYIDSHAAKSGVHDGS 102
             ++  +K+V VP     D+ ++N   A +  +  L+   H  +V Y+       G  + +
Sbjct: 1147 GEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDHLNIVQYL-------GFENKN 1199

Query: 103  YEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKI 162
                L +EY +GG +   +  RL     E  +  +T+ + +G+A +H     ++HRD+K 
Sbjct: 1200 CIYSLFLEYVAGGSVGSLI--RLYGHFDEQLIRFLTTQVLEGLAYLHLRG--ILHRDMKA 1255

Query: 163  ENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYP 222
            +N+L+ +D   K+ DF    G+ R   N     Y   ++    T  + APEM+D  +GY 
Sbjct: 1256 DNLLLDNDGVCKISDF----GISRKSNNI----YSNSEMTMRGTVFWMAPEMVDTTQGY- 1306

Query: 223  INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQY-SDSLKHLIS----- 276
             + K DIW+LG  + ++     P+  +   A +    +  S P    D+L H+       
Sbjct: 1307 -SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPEDTLPHISQDGRAF 1365

Query: 277  ----FMLSENPTQRPN--------ICQVLEE 295
                FM+  +P +RP          CQV +E
Sbjct: 1366 LDDCFMI--DPEERPTADTLLSHPFCQVPKE 1394

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 99/197 (50%), Gaps = 24/197 (12%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQN-RLQEGEVLKITSDITQGIAAMHALQPPLIHRDI 160
           S   ++L EY SGG L+D++   +Q+  L+E    K T  I   +  +H     ++HRD+
Sbjct: 250 SNHFYMLFEYVSGGQLLDYI---IQHGSLREHHARKFTRGIASALQYLHGNN--IVHRDL 304

Query: 161 KIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRG 220
           KIEN++IS     K+ DFG +  +    K    F           +  + APE++   + 
Sbjct: 305 KIENIMISTSGDIKIIDFG-LSNLYDSKKQLNTF---------CGSLYFAAPELL---KA 351

Query: 221 YP-INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ--FPSYPQY-SDSLKHLIS 276
            P +  + DIW+ GV LY L     PF+    +++LH + +     YPQ+ S  +  L+S
Sbjct: 352 NPYVGPEVDIWSFGVVLYVLACGKVPFDD-ENSSVLHEKIKQGKVDYPQHLSIEVISLLS 410

Query: 277 FMLSENPTQRPNICQVL 293
            ML  +P +R ++ Q++
Sbjct: 411 KMLVVDPKKRASLQQIV 427

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 82/177 (46%), Gaps = 22/177 (12%)

Query: 116  GLIDFMN-TRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFK 174
            G ID  +   L+  + E E   +   IT G+  +H     ++HRDIK ENV++ +    K
Sbjct: 1157 GSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVK 1214

Query: 175  VCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMI--DLYRGYPINEKSDIWAL 232
            + DFGS   V R P           D+   T   Y APE++  D Y G P     DIWA+
Sbjct: 1215 LIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLEGDPYEGKP----QDIWAI 1259

Query: 233  GVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNI 289
            GV LY + Y   PF  V E  IL    +       S+    LI+ +L  + ++RP +
Sbjct: 1260 GVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTV 1314

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 102/209 (48%), Gaps = 24/209 (11%)

Query: 102 SYEVFLLMEYCSGGGLIDFMNTRLQN-RLQEGEVLKITSDITQGIAAMHALQPPLIHRDI 160
           S   ++L EY SGG L+D++   +Q+  L+E    K    I   +  +HA    ++HRD+
Sbjct: 258 SNHFYMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALEYIHANN--IVHRDL 312

Query: 161 KIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRG 220
           KIEN++IS     K+ DFG +  V    K    F           +  + APE++   + 
Sbjct: 313 KIENIMISTSGEIKIIDFG-LSNVFDRKKQLHTF---------CGSLYFAAPELL---KA 359

Query: 221 YP-INEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQ--FPSYPQY-SDSLKHLIS 276
           +P    + D+W+ GV LY L     PF+    +++LH + +     YP + S  +  L+S
Sbjct: 360 HPYTGPEVDVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPNHLSIEVISLLS 418

Query: 277 FMLSENPTQRPNICQVLEEVSRIQGTPCP 305
            ML  +P +R ++ QV+E     +G   P
Sbjct: 419 KMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,549,765
Number of extensions: 3222693
Number of successful extensions: 13520
Number of sequences better than 10.0: 1893
Number of HSP's gapped: 12030
Number of HSP's successfully gapped: 1931
Length of query: 790
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 672
Effective length of database: 39,950,811
Effective search space: 26846944992
Effective search space used: 26846944992
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)