Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G07524g5.251ON44544519940.0
SAKL0G11484g5.251ON45645619330.0
KAFR0H036305.251ON44844819280.0
TDEL0E037505.251ON47147119180.0
Kpol_1032.875.251ON46446419080.0
ACR050C5.251ON47545319070.0
CAGL0E06490g5.251ON47247219060.0
Skud_11.825.251ON46846819010.0
Ecym_82505.251ON45645618980.0
TPHA0B025505.251ON46346318960.0
ZYRO0A10560g5.251ON46846818950.0
YKL145W (RPT1)5.251ON46746718950.0
Smik_11.915.251ON46846818940.0
TBLA0C030405.251ON46846818840.0
Kwal_23.28495.251ON40940718780.0
Suva_11.805.251ON47147118810.0
NCAS0F023005.251ON47447418800.0
KNAG0H023005.251ON47747718740.0
KLLA0E13773g5.251ON47547518320.0
NDAI0C037805.251ON38538516690.0
Suva_7.2274.57ON4053097981e-102
KLLA0A04752g4.57ON4043097971e-102
Skud_7.2364.57ON4053097961e-102
Smik_7.2354.57ON4053097951e-102
YGL048C (RPT6)4.57ON4053097951e-102
Kwal_26.74744.57ON4053017861e-100
KLTH0D03806g4.57ON4053017861e-100
AGL043C4.57ON4053017811e-99
SAKL0H23672g4.57ON4083017811e-99
ZYRO0G22330g4.57ON4053187801e-99
CAGL0D06292g4.57ON4003117801e-99
Kpol_1041.424.57ON4033107792e-99
NCAS0A058804.57ON4073107793e-99
TBLA0B098804.57ON4013107741e-98
TDEL0E056604.57ON4063007741e-98
KNAG0D032004.57ON4003137731e-98
KAFR0F031004.57ON4053107732e-98
NDAI0D028504.57ON4053107732e-98
TPHA0F004404.57ON4033107713e-98
KLLA0C09592g8.708ON4343077143e-89
KLTH0D11990g8.708ON4333077126e-89
Skud_15.4258.708ON4373227092e-88
KNAG0G027208.708ON4443227074e-88
Kwal_26.89128.708ON4343077057e-88
YOR259C (RPT4)8.708ON4373227058e-88
SAKL0H05764g8.708ON4213077039e-88
AAL113W8.708ON4323077031e-87
NCAS0A101803.216ON4373067031e-87
Smik_15.4428.708ON4373227022e-87
Ecym_23658.708ON4273077012e-87
NCAS0B011508.708ON4263227003e-87
TDEL0A065308.708ON4353227013e-87
Suva_8.3088.708ON4373227004e-87
NDAI0E010208.708ON4433226989e-87
KAFR0A040108.708ON4243226979e-87
NDAI0A072903.216ON3762656921e-86
YDL007W (RPT2)3.216ON4372606962e-86
KAFR0F024403.216ON4362606952e-86
Kpol_1064.228.708ON4323206952e-86
CAGL0K08910g8.708ON4363226952e-86
Suva_4.2463.216ON4372606952e-86
Smik_4.2293.216ON4372606952e-86
KNAG0K015303.216ON4352606943e-86
TBLA0D012408.708ON4433206944e-86
TDEL0D040603.216ON4372736934e-86
ZYRO0A04224g3.216ON4372606935e-86
Kpol_1010.743.216ON4372606926e-86
Kwal_27.110323.216ON3763106868e-86
KLLA0E21209g5.428ON4323086919e-86
SAKL0C11440g3.216ON4363106919e-86
Ecym_55275.428ON4323086901e-85
TPHA0H017705.251ON4343086892e-85
NCAS0F033305.428ON4343086892e-85
SAKL0G02376g5.428ON4343086892e-85
CAGL0I04884g3.216ON4332606892e-85
TPHA0A042703.216ON4372606882e-85
Skud_4.2473.216ON4372606882e-85
TPHA0D014708.708ON4553206893e-85
Ecym_52863.216ON4372976874e-85
TBLA0F006903.216ON4342606855e-85
AEL011W3.216ON4372976858e-85
KLTH0F16214g5.428ON4343086841e-84
CAGL0A02750g5.428ON4293086831e-84
KNAG0C049605.428ON4233086821e-84
Kwal_55.214535.428ON4343086822e-84
Smik_15.2955.428ON4343086822e-84
YOR117W (RPT5)5.428ON4343086822e-84
Suva_8.1705.428ON4343086812e-84
KAFR0E038905.428ON4343086812e-84
ZYRO0F11946g8.708ON4443226813e-84
KLTH0G16698g3.216ON4553066824e-84
Kpol_1062.335.428ON4343086794e-84
Skud_15.2805.428ON4343086795e-84
AER254W5.428ON4603086808e-84
KLLA0F14707g3.216ON4342606779e-84
TDEL0E019705.428ON4343086771e-83
NDAI0B056205.428ON4823086801e-83
TBLA0A037405.428ON4343086752e-83
ZYRO0F09900g5.428ON4343086719e-83
Kpol_543.175.486ON4282786473e-79
NDAI0A042905.486ON4262936421e-78
ZYRO0D11528g5.486ON4532936442e-78
NCAS0A119805.486ON4262796402e-78
KLLA0C06534g5.486ON4282626402e-78
Smik_4.6685.486ON4282936395e-78
CAGL0K09526g5.486ON4312636386e-78
YDR394W (RPT3)5.486ON4282936386e-78
Ecym_45485.486ON4252626386e-78
Skud_4.6685.486ON4282796386e-78
TPHA0J028605.486ON4312636387e-78
TBLA0D018605.486ON4292796361e-77
KAFR0E035805.486ON4252796361e-77
AFR394W5.486ON4722596391e-77
Suva_2.5715.486ON4282936342e-77
SAKL0G03828g5.486ON4252626323e-77
KNAG0C045905.486ON4322966334e-77
TDEL0A035005.486ON4262796133e-74
KLTH0G02662g5.486ON4252626082e-73
TBLA0J006407.288ON8522315262e-58
TDEL0H015607.288ON8382315253e-58
NCAS0E035807.288ON6012315153e-58
TBLA0C048407.288ON8472315227e-58
KLLA0F05676g7.288ON8302315219e-58
SAKL0F09834g7.288ON8422315211e-57
NCAS0A137607.288ON8252315191e-57
KNAG0B029407.288ON8382315201e-57
KLTH0A05324g7.288ON8322315192e-57
NDAI0A030407.288ON8422315192e-57
NDAI0A022807.288ON8252315173e-57
Smik_4.1117.288ON8352315183e-57
Kwal_23.59967.288ON8312315174e-57
Kpol_1020.97.288ON8122315164e-57
Skud_4.1297.288ON8352315155e-57
KAFR0L011907.288ON8242315155e-57
YDL126C (CDC48)7.288ON8352315156e-57
Ecym_80377.288ON8362315156e-57
Suva_4.1197.288ON8362315156e-57
AFR158W7.288ON8322315156e-57
CAGL0J09350g7.288ON8302315156e-57
ZYRO0C09262g7.288ON8302315148e-57
Kpol_2000.157.288ON8232315121e-56
TPHA0A032607.288ON8262315112e-56
NCAS0E040505.34ON13292794923e-53
ZYRO0D07414g5.34ON14202694862e-52
Kwal_47.18848singletonOFF3021564534e-52
KAFR0D019005.34ON12612694834e-52
TPHA0L022105.34ON14002704801e-51
KLTH0B09130g5.34ON13332794791e-51
NDAI0B007805.34ON13482794791e-51
TDEL0G005905.34ON12942364792e-51
ZYRO0D15290g7.168ON7272644732e-51
Ecym_12587.168ON7472644732e-51
TBLA0C068505.34ON14262694782e-51
KNAG0L010607.168ON7132614713e-51
KLTH0F13904g7.168ON7392634723e-51
KLLA0A09823g5.34ON13192714773e-51
KNAG0K002805.34ON14082714773e-51
Kpol_513.195.34ON13772704773e-51
ABR139W5.34ON12702684747e-51
Ecym_47695.34ON13392694738e-51
AAR025C7.168ON7262644671e-50
KNAG0B061604.259ON7722624671e-50
Kpol_401.37.168ON7862644672e-50
Skud_13.2452.472ON8242574682e-50
SAKL0H01276g5.34ON13372364693e-50
Kwal_23.42535.34ON13292794684e-50
Smik_16.385.34ON13892344684e-50
Skud_7.6035.34ON13862344684e-50
Kwal_26.77492.472ON8142574645e-50
CAGL0G00528g5.34ON13172714685e-50
TBLA0I011902.472ON8352654645e-50
TDEL0A024802.472ON8162574645e-50
Klac_YGOB_Anc_7.168b7.168ON7792634628e-50
KLTH0D05412g2.472ON8132574621e-49
SAKL0F03894g7.168ON7422634601e-49
Ecym_74002.472ON8042574611e-49
Suva_13.2662.472ON8232574612e-49
Kpol_483.204.259ON7832614602e-49
NDAI0E035807.168ON7822644592e-49
NCAS0J015504.259ON7722424592e-49
YGR270W (YTA7)5.34ON13792344623e-49
Suva_7.5665.34ON13982364604e-49
KAFR0A007402.472ON7842574565e-49
KAFR0A058904.259ON7722824565e-49
YMR089C (YTA12)2.472ON8252574575e-49
Smik_13.2732.472ON8272574576e-49
CAGL0J01353g2.472ON8272554568e-49
NDAI0H022102.472ON8032574541e-48
NCAS0A078202.472ON7912654541e-48
CAGL0C02585g4.259ON7713124531e-48
NCAS0E020207.168ON7732644531e-48
TDEL0H027707.168ON7442644521e-48
SAKL0E03014g2.472ON8302574532e-48
Suva_5.1097.168ON7612594522e-48
TBLA0D044907.168ON7822944522e-48
Kpol_467.232.472ON8592574532e-48
TPHA0C015207.168ON7842644522e-48
YLR397C (AFG2)4.259ON7802644512e-48
SAKL0H02750g4.259ON7762944512e-48
TPHA0B007304.259ON7763114512e-48
KLLA0F13706g2.472ON8422574522e-48
KLLA0B03234g4.259ON8042454504e-48
ABL041W2.472ON8182564495e-48
CAGL0H09416g7.168ON7502644477e-48
TPHA0G031302.472ON7922664471e-47
KNAG0C033207.430ON7662544461e-47
KAFR0G028007.168ON7832644461e-47
Smik_5.1387.168ON7602594451e-47
Skud_5.1217.168ON7622594452e-47
NDAI0J023204.259ON7782424452e-47
KAFR0K020607.430ON7262544432e-47
NCAS0A146407.430ON7502544432e-47
ZYRO0F13024g7.430ON7402544414e-47
YER017C (AFG3)7.168ON7612594424e-47
KLLA0E06711g7.430ON7692544424e-47
Smik_12.4844.259ON7802664415e-47
Skud_12.4824.259ON7772714416e-47
ZYRO0G03212g2.472ON8302554417e-47
KNAG0E025502.472ON8452574417e-47
Suva_10.5144.259ON7802674409e-47
SAKL0F13376g7.430ON7412544372e-46
NDAI0A013907.430ON7122554362e-46
TDEL0C029307.430ON7402544362e-46
Ecym_71237.430ON7272554352e-46
CAGL0K05093g7.430ON7452544353e-46
NCAS0A029404.23ON8572884373e-46
Suva_16.3517.430ON7472544353e-46
YPR024W (YME1)7.430ON7472544353e-46
TDEL0E011104.259ON7782684363e-46
Ecym_62184.23ON8382574364e-46
SAKL0H25630g4.23ON8302574364e-46
Smik_16.2657.430ON7472544344e-46
YLL034C (RIX7)4.23ON8372594364e-46
Smik_12.224.23ON8372734354e-46
Skud_12.334.23ON8372574355e-46
Skud_16.3097.430ON7472544335e-46
Suva_10.384.23ON8372574348e-46
AGL274W7.430ON7322544328e-46
KLTH0C05742g7.430ON7442544319e-46
KLTH0D14586g4.259ON7742694311e-45
Kwal_23.41944.259ON7742774311e-45
ZYRO0G08008g4.23ON8262884311e-45
KLLA0E00837g4.23ON8142574312e-45
TBLA0F014707.430ON8022544302e-45
CAGL0D02838g4.23ON8342574312e-45
ZYRO0B12606g4.259ON7772834283e-45
TBLA0A063804.259ON8082824284e-45
KNAG0E010404.23ON7852574266e-45
Kpol_1044.154.23ON8392574251e-44
TBLA0E014504.23ON8612614251e-44
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G07524g
         (445 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 ...   772   0.0  
SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 ...   749   0.0  
KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.2...   747   0.0  
TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.2...   743   0.0  
Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa] ...   739   0.0  
ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON} S...   739   0.0  
CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly...   738   0.0  
Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W...   736   0.0  
Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar t...   735   0.0  
TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.2...   734   0.0  
ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly...   734   0.0  
YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One o...   734   0.0  
Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W...   734   0.0  
TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.2...   730   0.0  
Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W (...   728   0.0  
Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W...   729   0.0  
NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {O...   728   0.0  
KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.2...   726   0.0  
KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]...   710   0.0  
NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {O...   647   0.0  
Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON...   311   e-102
KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {...   311   e-102
Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON...   311   e-102
Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON...   310   e-102
YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}  ...   310   e-102
Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {O...   307   e-100
KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {...   307   e-100
AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON} S...   305   1e-99
SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} high...   305   1e-99
ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]...   305   1e-99
CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly...   305   1e-99
Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON} (1108...   304   2e-99
NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa] ...   304   3e-99
TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4...   302   1e-98
TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa] ...   302   1e-98
KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {O...   302   1e-98
KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {O...   302   2e-98
NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57     302   2e-98
TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {O...   301   3e-98
KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly...   279   3e-89
KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {...   278   6e-89
Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {...   277   2e-88
KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {O...   276   4e-88
Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa] ...   276   7e-88
YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON} ...   276   8e-88
SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly...   275   9e-88
AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic ho...   275   1e-87
NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa] ...   275   1e-87
Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {...   275   2e-87
Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar t...   274   2e-87
NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708    274   3e-87
TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa] ...   274   3e-87
Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON...   274   4e-87
NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708    273   9e-87
KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {O...   273   9e-87
NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON} Anc_3...   271   1e-86
YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of...   272   2e-86
KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.2...   272   2e-86
Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {O...   272   2e-86
CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highl...   272   2e-86
Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W ...   272   2e-86
Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W ...   272   2e-86
KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {...   271   3e-86
TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.7...   271   4e-86
TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.2...   271   4e-86
ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly...   271   5e-86
Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa] ...   271   6e-86
Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007...   268   8e-86
KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]...   270   9e-86
SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736) ...   270   9e-86
Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar...   270   1e-85
TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.2...   270   2e-85
NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428    270   2e-85
SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly...   270   2e-85
CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly...   270   2e-85
TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.2...   269   2e-85
Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W ...   269   2e-85
TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {O...   270   3e-85
Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar t...   269   4e-85
TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.2...   268   5e-85
AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic ho...   268   8e-85
KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]...   268   1e-84
CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly...   267   1e-84
KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {O...   267   1e-84
Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {...   267   2e-84
Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117...   267   2e-84
YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One o...   267   2e-84
Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W ...   266   2e-84
KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.4...   266   2e-84
ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {...   266   3e-84
KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085) ...   267   4e-84
Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {O...   266   4e-84
Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117...   266   5e-84
AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic ...   266   8e-84
KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} high...   265   9e-84
TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {O...   265   1e-83
NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON} Anc_5...   266   1e-83
TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.4...   264   2e-83
ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly...   263   9e-83
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...   253   3e-79
NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {O...   251   1e-78
ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly...   252   2e-78
NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON} Anc_5...   251   2e-78
KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly...   251   2e-78
Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394...   250   5e-78
CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highl...   250   6e-78
YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One ...   250   6e-78
Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {O...   250   6e-78
Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394...   250   6e-78
TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5....   250   7e-78
TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {O...   249   1e-77
KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {O...   249   1e-77
AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic ...   250   1e-77
Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394...   248   2e-77
SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly...   248   3e-77
KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {O...   248   4e-77
TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.4...   240   3e-74
KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly...   238   2e-73
TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7....   207   2e-58
TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {O...   206   3e-58
NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288    202   3e-58
TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON} Anc_7...   205   7e-58
KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {...   205   9e-58
SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly...   205   1e-57
NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON}            204   1e-57
KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {O...   204   1e-57
KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly...   204   2e-57
NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {O...   204   2e-57
NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {O...   203   3e-57
Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON...   204   3e-57
Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL12...   203   4e-57
Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON...   203   4e-57
Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON...   202   5e-57
KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7....   202   5e-57
YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}  ...   202   6e-57
Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to ...   202   6e-57
Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON...   202   6e-57
AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic ho...   202   6e-57
CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa] ...   202   6e-57
ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly...   202   8e-57
Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {O...   201   1e-56
TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {O...   201   2e-56
NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34    194   3e-53
ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa] ...   191   2e-52
Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {O...   179   4e-52
KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {...   190   4e-52
TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5...   189   1e-51
KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} simil...   189   1e-51
NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {...   189   1e-51
TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {...   189   2e-51
ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]...   186   2e-51
Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar t...   186   2e-51
TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON} Anc_...   188   2e-51
KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {...   186   3e-51
KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]...   186   3e-51
KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} simil...   188   3e-51
KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {O...   188   3e-51
Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON} (53678.....   188   3e-51
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...   187   7e-51
Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {...   186   8e-51
AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON} S...   184   1e-50
KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa] ...   184   1e-50
Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON} co...   184   2e-50
Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {...   184   2e-50
SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa] ...   185   3e-50
Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {...   184   4e-50
Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON...   184   4e-50
Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR27...   184   4e-50
Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C...   183   5e-50
CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {O...   184   5e-50
TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {O...   183   5e-50
TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.4...   183   5e-50
Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2...   182   8e-50
KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} simila...   182   1e-49
SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} simila...   181   1e-49
Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}...   182   1e-49
Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {...   182   2e-49
Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}...   181   2e-49
NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168    181   2e-49
NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {...   181   2e-49
YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}  YTA7Pro...   182   3e-49
Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W...   181   4e-49
KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.4...   180   5e-49
KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON} Anc_4...   180   5e-49
YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON} ...   180   5e-49
Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {...   180   6e-49
CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} simil...   180   8e-49
NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {O...   179   1e-48
NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa] ...   179   1e-48
CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly...   179   1e-48
NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168    179   1e-48
TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.1...   178   1e-48
SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {...   179   2e-48
Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON...   178   2e-48
TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa] ...   178   2e-48
Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON} (50661..5...   179   2e-48
TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.1...   178   2e-48
YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON} ...   178   2e-48
SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly...   178   2e-48
TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.2...   178   2e-48
KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]...   178   2e-48
KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} simila...   177   4e-48
ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic ho...   177   5e-48
CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly...   176   7e-48
TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.4...   176   1e-47
KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {O...   176   1e-47
KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {O...   176   1e-47
Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON...   176   1e-47
Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON...   176   2e-47
NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {...   176   2e-47
KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7....   175   2e-47
NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON} Anc_7...   175   2e-47
ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} simi...   174   4e-47
YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}  ...   174   4e-47
KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {...   174   4e-47
Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {...   174   5e-47
Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {...   174   6e-47
ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} simila...   174   7e-47
KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.4...   174   7e-47
Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {...   174   9e-47
SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} high...   172   2e-46
NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {O...   172   2e-46
TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.4...   172   2e-46
Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}...   172   2e-46
CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highl...   172   3e-46
NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23     172   3e-46
Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024...   172   3e-46
YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}  YME1Catal...   172   3e-46
TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.2...   172   3e-46
Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}...   172   4e-46
SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} high...   172   4e-46
Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024...   171   4e-46
YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}  R...   172   4e-46
Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}...   172   4e-46
Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}...   172   5e-46
Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024...   171   5e-46
Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}...   171   8e-46
AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic ho...   171   8e-46
KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {...   170   9e-46
KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]...   170   1e-45
Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C...   170   1e-45
ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {...   170   1e-45
KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON...   170   2e-45
TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.4...   170   2e-45
CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {...   170   2e-45
ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]...   169   3e-45
TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON} Anc_4...   169   4e-45
KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {O...   168   6e-45
Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {O...   168   1e-44
TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {O...   168   1e-44
KAFR0L00260 Chr12 (44832..47216) [2385 bp, 794 aa] {ON} Anc_4.23...   167   1e-44
TPHA0E00660 Chr5 complement(125411..127759) [2349 bp, 782 aa] {O...   167   2e-44
TDEL0G01680 Chr7 (329761..332181) [2421 bp, 806 aa] {ON} Anc_4.2...   167   2e-44
NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {O...   167   2e-44
Kpol_1045.11 s1045 complement(28898..30985) [2088 bp, 695 aa] {O...   166   3e-44
TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4....   166   4e-44
KLTH0E06006g Chr5 complement(542954..545413) [2460 bp, 819 aa] {...   165   1e-43
NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON} Anc_7...   164   2e-43
Kwal_55.20644 s55 complement(502435..504876) [2442 bp, 813 aa] {...   162   7e-43
AFR188W Chr6 (778329..780812) [2484 bp, 827 aa] {ON} Syntenic ho...   162   7e-43
NCAS0E01270 Chr5 complement(243168..246005) [2838 bp, 945 aa] {O...   162   1e-42
CAGL0D02574g Chr4 (263063..266116) [3054 bp, 1017 aa] {ON} simil...   162   2e-42
Klac_YGOB_Anc_7.168 Chr2 (1011211..1012734) [1524 bp, 507 aa] {O...   157   3e-42
TBLA0I00550 Chr9 (96744..99863) [3120 bp, 1039 aa] {ON} Anc_3.9 ...   159   1e-41
NDAI0G01370 Chr7 (306715..309921) [3207 bp, 1068 aa] {ON} Anc_3.9     159   2e-41
Kwal_55.22137 s55 (1127242..1130358) [3117 bp, 1038 aa] {ON} YNL...   159   2e-41
KLLA0E02003g Chr5 complement(187814..190816) [3003 bp, 1000 aa] ...   159   2e-41
KAFR0A08620 Chr1 (1727701..1730850) [3150 bp, 1049 aa] {ON} Anc_...   155   3e-40
Smik_14.3 Chr14 complement(3964..7053) [3090 bp, 1029 aa] {ON} Y...   155   3e-40
Skud_14.12 Chr14 complement(12962..16126) [3165 bp, 1054 aa] {ON...   154   8e-40
KLTH0F19646g Chr6 (1592186..1595320) [3135 bp, 1044 aa] {ON} sim...   154   9e-40
Suva_14.12 Chr14 complement(14684..17773) [3090 bp, 1029 aa] {ON...   153   1e-39
TDEL0A00280 Chr1 complement(46558..49620) [3063 bp, 1020 aa] {ON...   153   2e-39
AER065C Chr5 complement(753980..756304) [2325 bp, 774 aa] {ON} S...   152   2e-39
YNL329C Chr14 complement(19541..22633) [3093 bp, 1030 aa] {ON}  ...   152   4e-39
KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3...   152   4e-39
Kpol_1014.31 s1014 (54948..58082) [3135 bp, 1044 aa] {ON} (54948...   152   6e-39
TPHA0P01580 Chr16 (324418..327516) [3099 bp, 1032 aa] {ON} Anc_3...   150   2e-38
AGR394W Chr7 (1452410..1455475) [3066 bp, 1021 aa] {ON} Syntenic...   149   3e-38
ZYRO0G04510g Chr7 complement(363004..366159) [3156 bp, 1051 aa] ...   148   7e-38
Ecym_3259 Chr3 (495875..498199) [2325 bp, 774 aa] {ON} similar t...   148   7e-38
SAKL0C13684g Chr3 (1204367..1207471) [3105 bp, 1034 aa] {ON} sim...   147   2e-37
ZYRO0C03476g Chr3 (274719..277805) [3087 bp, 1028 aa] {ON} simil...   147   2e-37
KLLA0B06094g Chr2 complement(541408..542490) [1083 bp, 360 aa] {...   138   4e-36
Ecym_3161 Chr3 complement(308085..311240) [3156 bp, 1051 aa] {ON...   141   2e-35
KLLA0B06523g Chr2 complement(579869..582862) [2994 bp, 997 aa] {...   140   3e-35
NCAS0A01990 Chr1 (381080..382165) [1086 bp, 361 aa] {ON}              133   2e-34
KNAG0F03850 Chr6 complement(729019..730323) [1305 bp, 434 aa] {O...   134   4e-34
Kpol_385.7 s385 (17541..18629) [1089 bp, 362 aa] {ON} (17541..18...   132   6e-34
SAKL0D12606g Chr4 (1044200..1047274) [3075 bp, 1024 aa] {ON} sim...   136   7e-34
CAGL0K03971g Chr11 (367761..368840) [1080 bp, 359 aa] {ON} highl...   131   1e-33
NDAI0D03930 Chr4 (928651..929715) [1065 bp, 354 aa] {ON}              129   3e-33
Ecym_8344 Chr8 (694173..695261) [1089 bp, 362 aa] {ON} similar t...   129   4e-33
CAGL0H09174g Chr8 complement(898883..901978) [3096 bp, 1031 aa] ...   134   5e-33
Skud_16.478 Chr16 complement(829027..830340) [1314 bp, 437 aa] {...   131   5e-33
Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa] ...   134   6e-33
YPR173C Chr16 complement(886524..887837) [1314 bp, 437 aa] {ON} ...   130   6e-33
SAKL0F15884g Chr6 complement(1285496..1286782) [1287 bp, 428 aa]...   130   7e-33
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....   133   8e-33
Smik_16.438 Chr16 complement(749208..750521) [1314 bp, 437 aa] {...   130   8e-33
TBLA0E00840 Chr5 (182594..183883) [1290 bp, 429 aa] {ON} Anc_7.5...   130   9e-33
NDAI0D01440 Chr4 (335388..338645) [3258 bp, 1085 aa] {ON} Anc_1....   133   9e-33
TPHA0I03200 Chr9 complement(706938..708236) [1299 bp, 432 aa] {O...   129   1e-32
Kwal_23.5338 s23 complement(1116675..1117961) [1287 bp, 428 aa] ...   129   2e-32
Suva_16.506 Chr16 complement(869082..870395) [1314 bp, 437 aa] {...   129   2e-32
TDEL0H00410 Chr8 (63535..64839) [1305 bp, 434 aa] {ON} Anc_7.530...   129   3e-32
KAFR0E00340 Chr5 complement(77112..80087) [2976 bp, 991 aa] {ON}...   132   3e-32
Kpol_1013.42 s1013 (96318..97610) [1293 bp, 430 aa] {ON} (96318....   129   3e-32
NCAS0A15130 Chr1 complement(2978192..2979496) [1305 bp, 434 aa] ...   129   3e-32
TDEL0F00540 Chr6 complement(90867..93965) [3099 bp, 1032 aa] {ON...   131   4e-32
KLTH0A00968g Chr1 (96149..97432) [1284 bp, 427 aa] {ON} highly s...   128   4e-32
TBLA0I02090 Chr9 complement(474394..477000) [2607 bp, 868 aa] {O...   131   4e-32
TPHA0F00980 Chr6 (222909..223991) [1083 bp, 360 aa] {ON} Anc_4.1...   127   5e-32
KAFR0B00410 Chr2 (88947..90221) [1275 bp, 424 aa] {ON} Anc_7.530...   128   5e-32
Suva_7.309 Chr7 (527237..528325) [1089 bp, 362 aa] {ON} YGR028W ...   126   5e-32
YKL197C Chr11 complement(70734..73865) [3132 bp, 1043 aa] {ON}  ...   131   6e-32
SAKL0B03894g Chr2 (345902..346978) [1077 bp, 358 aa] {ON} highly...   126   6e-32
NDAI0J00290 Chr10 complement(47691..49028) [1338 bp, 445 aa] {ON...   127   7e-32
CAGL0I06402g Chr9 (620231..621529) [1299 bp, 432 aa] {ON} highly...   127   9e-32
TBLA0B02000 Chr2 complement(463205..466300) [3096 bp, 1031 aa] {...   130   1e-31
KLTH0C02684g Chr3 complement(242904..245963) [3060 bp, 1019 aa] ...   130   1e-31
YPL074W Chr16 (415763..418027) [2265 bp, 754 aa] {ON}  YTA6Putat...   129   1e-31
Ecym_2804 Chr2 complement(1561704..1563005) [1302 bp, 433 aa] {O...   126   2e-31
KLLA0B10846g Chr2 complement(949338..950630) [1293 bp, 430 aa] {...   126   2e-31
YGR028W Chr7 (542203..543291) [1089 bp, 362 aa] {ON}  MSP1Mitoch...   125   2e-31
Skud_16.208 Chr16 (387144..389408) [2265 bp, 754 aa] {ON} YPL074...   129   2e-31
Suva_11.25 Chr11 complement(54969..58109) [3141 bp, 1046 aa] {ON...   129   2e-31
AFR371W Chr6 (1105757..1108837) [3081 bp, 1026 aa] {ON} Syntenic...   129   2e-31
Smik_11.25 Chr11 complement(55016..58147) [3132 bp, 1043 aa] {ON...   128   4e-31
Smik_16.162 Chr16 (298702..301230) [2529 bp, 842 aa] {ON} YPL074...   128   5e-31
Skud_11.21 Chr11 complement(54078..57206) [3129 bp, 1042 aa] {ON...   128   5e-31
Suva_16.238 Chr16 (426245..428506) [2262 bp, 753 aa] {ON} YPL074...   127   5e-31
Smik_6.97 Chr6 (172621..173709) [1089 bp, 362 aa] {ON} YGR028W (...   123   7e-31
Skud_7.320 Chr7 (540689..541897) [1209 bp, 402 aa] {ON} YGR028W ...   124   9e-31
KLLA0C14520g Chr3 complement(1269505..1271799) [2295 bp, 764 aa]...   127   9e-31
TBLA0G03290 Chr7 complement(873305..875593) [2289 bp, 762 aa] {O...   127   1e-30
AEL265W Chr5 (140797..142092) [1296 bp, 431 aa] {ON} Syntenic ho...   124   1e-30
CAGL0E04642g Chr5 complement(447934..450141) [2208 bp, 735 aa] {...   126   1e-30
SAKL0B06402g Chr2 complement(548471..550795) [2325 bp, 774 aa] {...   126   2e-30
ZYRO0D01210g Chr4 (93236..94519) [1284 bp, 427 aa] {ON} highly s...   123   2e-30
KNAG0G00290 Chr7 complement(45891..48884) [2994 bp, 997 aa] {ON}...   125   3e-30
ZYRO0A12342g Chr1 (979094..980185) [1092 bp, 363 aa] {ON} highly...   121   4e-30
Kpol_1052.6 s1052 (16325..18616) [2292 bp, 763 aa] {ON} (16325.....   125   4e-30
TPHA0O01090 Chr15 complement(208519..211680) [3162 bp, 1053 aa] ...   125   4e-30
KNAG0D03870 Chr4 (704252..705331) [1080 bp, 359 aa] {ON} Anc_4.1...   121   4e-30
Kpol_1056.21 s1056 complement(47832..51026) [3195 bp, 1064 aa] {...   125   5e-30
KLTH0G17930g Chr7 complement(1553688..1554764) [1077 bp, 358 aa]...   121   5e-30
Smik_2.213 Chr2 complement(380313..382589) [2277 bp, 758 aa] {ON...   124   6e-30
YBR080C Chr2 complement(398614..400890) [2277 bp, 758 aa] {ON}  ...   124   6e-30
TDEL0D02860 Chr4 complement(543697..544785) [1089 bp, 362 aa] {O...   120   7e-30
AER169C Chr5 complement(951174..953462) [2289 bp, 762 aa] {ON} S...   124   8e-30
TPHA0A03890 Chr1 (856900..859182) [2283 bp, 760 aa] {ON} Anc_3.3...   124   9e-30
Suva_4.320 Chr4 complement(565994..568270) [2277 bp, 758 aa] {ON...   124   1e-29
ABR036W Chr2 (464427..465509) [1083 bp, 360 aa] {ON} Syntenic ho...   120   1e-29
TDEL0D03210 Chr4 (598442..600721) [2280 bp, 759 aa] {ON} Anc_3.3...   124   1e-29
NDAI0A07600 Chr1 complement(1741778..1744060) [2283 bp, 760 aa] ...   123   2e-29
ZYRO0G12738g Chr7 complement(1012482..1014773) [2292 bp, 763 aa]...   123   2e-29
Skud_2.204 Chr2 complement(366362..368638) [2277 bp, 758 aa] {ON...   122   3e-29
CAGL0M01782g Chr13 (208704..210980) [2277 bp, 758 aa] {ON} highl...   122   3e-29
ZYRO0D03938g Chr4 (320521..322578) [2058 bp, 685 aa] {ON} simila...   121   6e-29
TDEL0B03040 Chr2 (541376..543619) [2244 bp, 747 aa] {ON} Anc_8.5...   121   8e-29
KAFR0C00290 Chr3 (54829..57111) [2283 bp, 760 aa] {ON} Anc_3.304...   121   1e-28
NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304    121   1e-28
KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {...   120   2e-28
Ecym_7426 Chr7 complement(873420..875714) [2295 bp, 764 aa] {ON}...   119   3e-28
NCAS0C02100 Chr3 (396101..398377) [2277 bp, 758 aa] {ON} Anc_8.542    119   3e-28
Kwal_14.1321 s14 (278328..279404) [1077 bp, 358 aa] {ON} YGR028W...   116   3e-28
KLTH0E14190g Chr5 complement(1255261..1257552) [2292 bp, 763 aa]...   119   3e-28
NDAI0E02810 Chr5 (595594..597864) [2271 bp, 756 aa] {ON} Anc_8.542    119   5e-28
Kwal_27.12376 s27 complement(1199810..1202056) [2247 bp, 749 aa]...   119   6e-28
Kwal_YGOB_27.12376 s27 complement(1199780..1202056) [2277 bp, 75...   119   6e-28
SAKL0H10032g Chr8 (858355..860484) [2130 bp, 709 aa] {ON} simila...   117   1e-27
CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {...   117   2e-27
KAFR0F03780 Chr6 (743830..744903) [1074 bp, 357 aa] {ON} Anc_4.1...   113   3e-27
Kpol_1048.61 s1048 (176743..179121) [2379 bp, 792 aa] {ON} (1767...   115   5e-27
Kpol_1018.113 s1018 (297316..298503,298553..298561,298604..29955...   114   1e-26
TBLA0B04610 Chr2 (1068676..1072083) [3408 bp, 1135 aa] {ON} Anc_...   115   1e-26
AEL244W Chr5 (178664..180736) [2073 bp, 690 aa] {ON} Syntenic ho...   112   6e-26
TPHA0I01900 Chr9 (427715..429883) [2169 bp, 722 aa] {ON} Anc_8.5...   112   9e-26
KAFR0E00920 Chr5 (196279..198699) [2421 bp, 806 aa] {ON} Anc_8.5...   111   2e-25
Ecym_7036 Chr7 complement(74300..76435) [2136 bp, 711 aa] {ON} s...   111   2e-25
Kwal_27.10646 s27 complement(433603..434793) [1191 bp, 397 aa] {...   108   2e-25
KAFR0L00730 Chr12 complement(137874..140522) [2649 bp, 882 aa] {...   109   7e-25
KLLA0E23409g Chr5 complement(2082115..2084106) [1992 bp, 663 aa]...   108   8e-25
KLTH0E12562g Chr5 complement(1114263..1116410) [2148 bp, 715 aa]...   108   1e-24
Kwal_YGOB_27.10642 s27 complement(432707..433537,433540..434793)...   108   1e-24
KNAG0A01960 Chr1 (155185..157449) [2265 bp, 754 aa] {ON} Anc_8.5...   108   2e-24
Kwal_27.12039 s27 complement(1059119..1061275) [2157 bp, 718 aa]...   107   2e-24
SAKL0F08008g Chr6 complement(612481..614844) [2364 bp, 787 aa] {...   106   8e-24
Kwal_55.21051 s55 complement(666773..667849) [1077 bp, 358 aa] {...   102   2e-23
ADL109W Chr4 (491872..494088) [2217 bp, 738 aa] {ON} Syntenic ho...   105   2e-23
Kwal_47.18123 s47 complement(697417..699792) [2376 bp, 791 aa] {...   105   2e-23
CAGL0J02728g Chr10 complement(269575..272382) [2808 bp, 935 aa] ...   104   3e-23
Smik_5.172 Chr5 complement(248542..251214) [2673 bp, 890 aa] {ON...   104   4e-23
KLLA0E04379g Chr5 complement(396027..398216) [2190 bp, 729 aa] {...   103   5e-23
KLTH0A03696g Chr1 complement(318721..321066) [2346 bp, 781 aa] {...   103   5e-23
ZYRO0D16346g Chr4 complement(1361550..1364075) [2526 bp, 841 aa]...   103   6e-23
Kpol_1070.24 s1070 (55367..58012) [2646 bp, 881 aa] {ON} (55367....   103   8e-23
KNAG0L01320 Chr12 complement(236592..239342) [2751 bp, 916 aa] {...   102   1e-22
YER047C Chr5 complement(243810..246503) [2694 bp, 897 aa] {ON}  ...   102   2e-22
TDEL0H02310 Chr8 (386966..389599) [2634 bp, 877 aa] {ON} Anc_7.2...   100   5e-22
NCAS0E01710 Chr5 (334984..337224) [2241 bp, 746 aa] {ON}              100   6e-22
TBLA0D04260 Chr4 (1051964..1054561) [2598 bp, 865 aa] {ON} Anc_7...   100   6e-22
Skud_5.157 Chr5 complement(241636..244311) [2676 bp, 891 aa] {ON...   100   1e-21
TPHA0C01280 Chr3 (291235..293799) [2565 bp, 854 aa] {ON} Anc_7.2...    99   2e-21
NDAI0G01900 Chr7 (427004..429964) [2961 bp, 986 aa] {ON} Anc_7.2...    99   3e-21
Suva_5.149 Chr5 complement(220370..223057) [2688 bp, 895 aa] {ON...    97   9e-21
Kwal_47.18846 s47 complement(997109..997450) [342 bp, 113 aa] {O...    64   5e-12
ACR200C Chr3 complement(700324..701658) [1335 bp, 444 aa] {ON} S...    61   2e-09
Kwal_55.21054 s55 complement(667988..668956) [969 bp, 323 aa] {O...    60   4e-09
NCAS0H02120 Chr8 complement(412484..413905) [1422 bp, 473 aa] {O...    57   5e-08
KLLA0E02487g Chr5 complement(227048..228388) [1341 bp, 446 aa] {...    57   6e-08
TDEL0D02530 Chr4 (488653..490011) [1359 bp, 452 aa] {ON} Anc_5.4...    56   7e-08
TBLA0A02720 Chr1 (660311..661660) [1350 bp, 449 aa] {ON} Anc_5.4...    56   1e-07
KLTH0F15730g Chr6 (1282421..1283773) [1353 bp, 450 aa] {ON} high...    55   2e-07
ZYRO0G01716g Chr7 complement(131297..132646) [1350 bp, 449 aa] {...    54   3e-07
KNAG0B04170 Chr2 (793281..794642) [1362 bp, 453 aa] {ON} Anc_5.4...    54   3e-07
KAFR0D05090 Chr4 complement(1001713..1003098) [1386 bp, 461 aa] ...    54   5e-07
Ecym_4643 Chr4 (1254526..1255857) [1332 bp, 443 aa] {ON} similar...    54   5e-07
TPHA0E01660 Chr5 (337199..338557) [1359 bp, 452 aa] {ON} Anc_5.4...    54   5e-07
Kwal_55.21381 s55 (809652..811004) [1353 bp, 450 aa] {ON} YDR375...    52   1e-06
SAKL0G02816g Chr7 complement(231094..232560) [1467 bp, 488 aa] {...    52   2e-06
NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 a...    52   2e-06
Kpol_1062.18 s1062 (44220..45560) [1341 bp, 446 aa] {ON} (44220....    52   2e-06
Skud_4.645 Chr4 complement(1148035..1149405) [1371 bp, 456 aa] {...    51   3e-06
YDR375C Chr4 complement(1225166..1226536) [1371 bp, 456 aa] {ON}...    51   3e-06
Smik_4.643 Chr4 complement(1145612..1147033) [1422 bp, 473 aa] {...    51   4e-06
Suva_2.548 Chr2 complement(975787..977157) [1371 bp, 456 aa] {ON...    51   4e-06
CAGL0A02992g Chr1 complement(308689..310062) [1374 bp, 457 aa] {...    51   4e-06
NDAI0C01530 Chr3 (325097..326557) [1461 bp, 486 aa] {ON} Anc_5.4...    50   5e-06
KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]...    50   6e-06
Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]...    48   3e-05
Sklu_YGOB_09658g Chr8 (828107..829591,829654..829791) [1623 bp, ...    45   2e-04
SAKL0H09658g Chr8 (828107..829639) [1533 bp, 510 aa] {OFF} simil...    45   2e-04
KLTH0B08052g Chr2 complement(652928..654538) [1611 bp, 536 aa] {...    45   3e-04
KLLA0E23783g Chr5 complement(2115721..2115885,2115988..2117484) ...    44   8e-04
KAFR0E00840 Chr5 (176559..178121,178220..178348) [1692 bp, 563 a...    44   9e-04
KNAG0A01880 Chr1 (135396..137078) [1683 bp, 560 aa] {ON} Anc_8.5...    44   9e-04
AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {...    43   0.002
Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 b...    42   0.002
CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} simi...    41   0.006
NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 a...    41   0.006
Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,...    41   0.006
KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.2...    40   0.009
Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W ...    40   0.010
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    40   0.014
Kwal_23.4480 s23 (737809..739470) [1662 bp, 553 aa] {ON} YNL218W...    40   0.014
TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 a...    40   0.015
ABL183W Chr2 (63196..64839) [1644 bp, 547 aa] {ON} Syntenic homo...    40   0.015
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    40   0.015
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    40   0.015
Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa...    39   0.017
TBLA0H03710 Chr8 complement(902121..903824) [1704 bp, 567 aa] {O...    39   0.028
TBLA0G00290 Chr7 (53122..55110) [1989 bp, 662 aa] {ON} Anc_2.26 ...    37   0.11 
TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 a...    36   0.17 
SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]...    36   0.17 
YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {...    36   0.20 
TDEL0A00690 Chr1 (116066..117724) [1659 bp, 552 aa] {ON} Anc_2.2...    36   0.23 
CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa] ...    36   0.24 
Smik_2.369 Chr2 complement(659801..661306) [1506 bp, 501 aa] {ON...    36   0.24 
NCAS0G01450 Chr7 (262021..263730) [1710 bp, 569 aa] {ON} Anc_2.2...    36   0.25 
Skud_2.358 Chr2 complement(642328..643905) [1578 bp, 525 aa] {ON...    35   0.27 
Ecym_6466 Chr6 complement(901576..903330) [1755 bp, 584 aa] {ON}...    35   0.27 
CAGL0K06919g Chr11 complement(675277..676926) [1650 bp, 549 aa] ...    35   0.27 
YBR227C Chr2 complement(673572..675134) [1563 bp, 520 aa] {ON}  ...    35   0.30 
YMR078C Chr13 complement(422503..424728) [2226 bp, 741 aa] {ON} ...    35   0.35 
KLLA0D19360g Chr4 complement(1629360..1631039) [1680 bp, 559 aa]...    35   0.39 
NDAI0F03710 Chr6 complement(882364..884193) [1830 bp, 609 aa] {O...    35   0.40 
KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa] {...    35   0.46 
Kpol_1014.42 s1014 complement(81164..82876) [1713 bp, 570 aa] {O...    35   0.50 
Kwal_56.24172 s56 complement(887183..890167) [2985 bp, 994 aa] {...    35   0.51 
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    35   0.53 
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    34   0.63 
Suva_4.482 Chr4 complement(843869..845419) [1551 bp, 516 aa] {ON...    34   0.64 
KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa] ...    34   0.67 
KLLA0B01892g Chr2 (162844..165855) [3012 bp, 1003 aa] {ON} weakl...    34   0.69 
TDEL0G03460 Chr7 (638931..640466) [1536 bp, 511 aa] {ON} Anc_6.1...    34   0.78 
NCAS0H01380 Chr8 (263394..264977) [1584 bp, 527 aa] {ON} Anc_6.1...    34   0.80 
ACR102W Chr3 (535740..538262) [2523 bp, 840 aa] {ON} Syntenic ho...    34   0.84 
TPHA0P01680 Chr16 complement(350606..352414) [1809 bp, 602 aa] {...    33   1.1  
TPHA0F03230 Chr6 (704126..706663) [2538 bp, 845 aa] {ON} Anc_8.6...    33   1.5  
TDEL0E05510 Chr5 complement(1010410..1013400) [2991 bp, 996 aa] ...    33   1.6  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    33   1.7  
ZYRO0F15136g Chr6 complement(1238898..1240598) [1701 bp, 566 aa]...    33   1.8  
SAKL0E02486g Chr5 complement(196218..198395) [2178 bp, 725 aa] {...    33   1.8  
ZYRO0F06446g Chr6 (533651..536176) [2526 bp, 841 aa] {ON} simila...    33   1.8  
Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON} (1513...    33   2.0  
ZYRO0E07458g Chr5 complement(572497..575538) [3042 bp, 1013 aa] ...    33   2.0  
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    33   2.1  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    32   2.4  
KLLA0F09691g Chr6 complement(892208..893725) [1518 bp, 505 aa] {...    32   2.4  
Kwal_55.19939 s55 complement(185588..187921) [2334 bp, 777 aa] {...    33   2.5  
Suva_14.124 Chr14 (232456..234216) [1761 bp, 586 aa] {ON} YNL218...    32   2.6  
Ecym_2174 Chr2 (338477..341560) [3084 bp, 1027 aa] {ON} similar ...    32   3.1  
AFR013C Chr6 complement(458057..461230) [3174 bp, 1057 aa] {ON} ...    32   3.5  
YNL218W Chr14 (238238..240001) [1764 bp, 587 aa] {ON}  MGS1Prote...    32   3.6  
ZYRO0G03806g Chr7 (304402..306522) [2121 bp, 706 aa] {ON} simila...    32   3.7  
Skud_14.118 Chr14 (226974..228740) [1767 bp, 588 aa] {ON} YNL218...    32   3.9  
SAKL0A03806g Chr1 (353414..356539) [3126 bp, 1041 aa] {ON} weakl...    32   3.9  
Kpol_363.12 s363 complement(18968..20512) [1545 bp, 514 aa] {ON}...    32   3.9  
KAFR0G00690 Chr7 (171473..183784) [12312 bp, 4103 aa] {ON} Anc_1...    32   4.1  
ZYRO0E01826g Chr5 (134806..136320) [1515 bp, 504 aa] {ON} simila...    32   4.4  
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    32   4.5  
NCAS0F00820 Chr6 complement(166312..168531) [2220 bp, 739 aa] {O...    32   4.5  
AFL121W Chr6 (209373..211949) [2577 bp, 858 aa] {ON} Non-synteni...    32   4.6  
Ecym_6343 Chr6 complement(660862..664419) [3558 bp, 1185 aa] {ON...    32   5.1  
KLTH0H03542g Chr8 (320024..322993) [2970 bp, 989 aa] {ON} weakly...    32   5.1  
KAFR0F01270 Chr6 (243255..246236) [2982 bp, 993 aa] {ON}               32   5.3  
ZYRO0C04884g Chr3 (383579..385573) [1995 bp, 664 aa] {ON} simila...    31   6.9  
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    31   7.0  
Suva_16.71 Chr16 (112264..113682) [1419 bp, 472 aa] {ON} YPL235W...    31   7.1  
YPL235W Chr16 (103232..104647) [1416 bp, 471 aa] {ON}  RVB2ATP-d...    31   7.3  
Smik_6.440 Chr6 complement(719661..721076) [1416 bp, 471 aa] {ON...    31   7.4  
Kwal_26.7842 s26 (536044..538146) [2103 bp, 700 aa] {ON} YMR078C...    31   7.4  
Skud_16.43 Chr16 (76826..78241) [1416 bp, 471 aa] {ON} YPL235W (...    31   7.6  
Ecym_2154 Chr2 (289010..290413) [1404 bp, 467 aa] {ON} similar t...    31   7.8  
TBLA0A02230 Chr1 complement(537595..539022) [1428 bp, 475 aa] {O...    31   7.8  
KAFR0H01930 Chr8 (360162..361544) [1383 bp, 460 aa] {ON} Anc_8.3...    30   9.5  

>KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 445

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/445 (86%), Positives = 386/445 (86%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXNVPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXIEAR 60
           MPPKEDW                NVPLTEGDIQVLKTYGAAPYA            IEAR
Sbjct: 1   MPPKEDWEKFKAPAEEEKQEEKPNVPLTEGDIQVLKTYGAAPYADKLKETEKDLKDIEAR 60

Query: 61  IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXXXXXX 120
           IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK               
Sbjct: 61  IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKPEASDESPADEDEED 120

Query: 121 XKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE 180
            KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE
Sbjct: 121 SKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE 180

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA
Sbjct: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
           VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI           
Sbjct: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIDAVGGARFDDG 300

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL
Sbjct: 301 AGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
           EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD
Sbjct: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420

Query: 421 FLQAVEKVINGYKKFSSTSRYMQYN 445
           FLQAVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 FLQAVEKVINGYKKFSSTSRYMQYN 445

>SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 456

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/456 (82%), Positives = 384/456 (84%), Gaps = 11/456 (2%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXNV-PLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXIEA 59
           MPPKE+W                 V PL+EGDIQVLKTYGAAPYA            IEA
Sbjct: 1   MPPKENWEKYTAPIEEEETEEEKKVVPLSEGDIQVLKTYGAAPYANKLKEIEKDLKDIEA 60

Query: 60  RIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXXXXX 119
           RIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK              
Sbjct: 61  RIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKGDSSSSSPEDTQSN 120

Query: 120 XX----------KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRI 169
                       KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRI
Sbjct: 121 SSPNSEEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRI 180

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFA LGIDPPKGILLYGP
Sbjct: 181 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFATLGIDPPKGILLYGP 240

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+KACIIFFDE+
Sbjct: 241 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 300

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                          NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI
Sbjct: 301 DAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 360

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI
Sbjct: 361 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 420

Query: 410 RARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           RARRKVATEKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 RARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 456

>KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.251
           YKL145W
          Length = 448

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/448 (83%), Positives = 382/448 (85%), Gaps = 3/448 (0%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN---VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXI 57
           MPPK+DW                     PLTEGDIQVLKTYGAAPYA            I
Sbjct: 1   MPPKQDWEKYKTPIDEESSKEKKEEQIAPLTEGDIQVLKTYGAAPYADKLKVTEEDLKKI 60

Query: 58  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXXX 117
           EARIKEKAGVKESDTGLAPSH+WD+MGDRQRLSEEHPLQVARCTKIIK            
Sbjct: 61  EARIKEKAGVKESDTGLAPSHMWDVMGDRQRLSEEHPLQVARCTKIIKSSSEEGAEGNED 120

Query: 118 XXXXKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMT 177
               KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDP+VTMMT
Sbjct: 121 EDDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPTVTMMT 180

Query: 178 VEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLC 237
           VEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLC
Sbjct: 181 VEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLC 240

Query: 238 ARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
           ARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+KACIIFFDEI        
Sbjct: 241 ARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGGARF 300

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                  NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL
Sbjct: 301 DDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 360

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAT 417
           PDLEGRANIFRIHSK+MSVER IRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAT
Sbjct: 361 PDLEGRANIFRIHSKAMSVERNIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAT 420

Query: 418 EKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           EKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 421 EKDFLKAVDKVINGYKKFSSTSRYMQYN 448

>TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.251
           YKL145W
          Length = 471

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/471 (80%), Positives = 384/471 (81%), Gaps = 26/471 (5%)

Query: 1   MPPKEDWXXXXX--XXXXXXXXXXXNVPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXIE 58
           MPPKEDW                  N PLTEGDIQVLKTYGAAPYA            IE
Sbjct: 1   MPPKEDWEKYKAPAEEDKEKSNDEKNTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60

Query: 59  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXX--- 115
            RIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+             
Sbjct: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120

Query: 116 ---------------------XXXXXXKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGV 154
                                      KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180

Query: 155 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFA 214
           DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPERFA
Sbjct: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240

Query: 215 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 274
           ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300

Query: 275 MARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 334
           MART+KACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 301 MARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 360

Query: 335 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTG 394
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTG
Sbjct: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420

Query: 395 AELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           AELRSVCTEAGMFAIRARRKVATEKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471

>Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa]
           {ON} complement(185143..186537) [1395 nt, 465 aa]
          Length = 464

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/464 (80%), Positives = 381/464 (82%), Gaps = 19/464 (4%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN----VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXX 56
           MPPKEDW                      PLTE DIQVLKTYGAAPYA            
Sbjct: 1   MPPKEDWEKYKAPLEGKENEDVSKDEKITPLTESDIQVLKTYGAAPYASKLKETEKDLKD 60

Query: 57  IEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXX------- 109
           IE RIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 61  IELRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSSTEGENDN 120

Query: 110 --------XXXXXXXXXXXXKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI 161
                               KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI
Sbjct: 121 GNGENGESASANDADDDEEAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI 180

Query: 162 ELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPP 221
           ELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKEQI+KLREVVELPLLSPERFA LGIDPP
Sbjct: 181 ELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKEQIEKLREVVELPLLSPERFATLGIDPP 240

Query: 222 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKA 281
           KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+KA
Sbjct: 241 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 300

Query: 282 CIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 341
           CIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP
Sbjct: 301 CIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 360

Query: 342 ALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVC 401
           ALLRPGRIDRKVEFSLPDLEGRANIFRIH+K+MSVERGIRWELISRLCPNSTGAELRSVC
Sbjct: 361 ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKAMSVERGIRWELISRLCPNSTGAELRSVC 420

Query: 402 TEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           TEAGMFAIRARRKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 421 TEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 464

>ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL145W
           (RPT1)
          Length = 475

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/453 (81%), Positives = 381/453 (84%), Gaps = 8/453 (1%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN---VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXI 57
           MPPKEDW                +    PL+EGDIQVLKTYGAAPYA            I
Sbjct: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82

Query: 58  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXXX 117
           E RIKEKAGVKESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+            
Sbjct: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSGA 142

Query: 118 XX-----XXKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 172
                    KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY IELPLPPRIDPS
Sbjct: 143 NTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPS 202

Query: 173 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 232
           VTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPERFA LGIDPPKGILLYGPPGT
Sbjct: 203 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGT 262

Query: 233 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXX 292
           GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+KACIIFFDE+   
Sbjct: 263 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVDAI 322

Query: 293 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 352
                       NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK
Sbjct: 323 GGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 382

Query: 353 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           VEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR+R
Sbjct: 383 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442

Query: 413 RKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           RKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 443 RKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475

>CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145w YTA3
          Length = 472

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/472 (79%), Positives = 382/472 (80%), Gaps = 27/472 (5%)

Query: 1   MPPKEDWXXXXX---XXXXXXXXXXXNVPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXI 57
           M PKEDW                   ++PLTEGDIQVLKTYGAAPYA            I
Sbjct: 1   MAPKEDWEKYKAPVESDDDNKLKDDKSIPLTEGDIQVLKTYGAAPYAAKLKETEKDLKEI 60

Query: 58  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXXX 117
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK            
Sbjct: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSSASNEVSDESA 120

Query: 118 XXXX------------------------KYIINLKQIAKFVVGLGERVSPTDIEEGMRVG 153
                                       KY+INLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 121 VNGANTTNSATTGSGNDGDAEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 180

Query: 154 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERF 213
           VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPERF
Sbjct: 181 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 240

Query: 214 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 273
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 241 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 300

Query: 274 EMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 333
           EMART+KACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 301 EMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 360

Query: 334 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNST 393
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER IRWELISRLCPNST
Sbjct: 361 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERNIRWELISRLCPNST 420

Query: 394 GAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           GAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 421 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 472

>Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/468 (79%), Positives = 384/468 (82%), Gaps = 23/468 (4%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN--VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXIE 58
           MPPKEDW                +  VPLTEGDIQVLK+YGAAPYA            IE
Sbjct: 1   MPPKEDWEKYKAPLDDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIE 60

Query: 59  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXXXX 118
           ARIKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK             
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGSGENDDSTTDNN 120

Query: 119 XXX---------------------KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 157
                                   KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 121 NDSVNGNSNSNQESADVDEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QI+KLREVVELPLLSPERFA LG
Sbjct: 181 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 240

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
           T+KACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 301 TKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 397
           TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420

Query: 398 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           RSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 421 RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar to
           Ashbya gossypii ACR050C
          Length = 456

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/456 (81%), Positives = 381/456 (83%), Gaps = 11/456 (2%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN---VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXI 57
           M PKEDW                +    PLTEGDIQVLKTYGAAPYA            I
Sbjct: 1   MSPKEDWEKYKPPVETEDEQKQADDKIKPLTEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 60

Query: 58  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXX--------XX 109
           E RIKEKAGVKESDTGLAPSHLWDI+GDRQ+LSE HPLQVARCTKIIK            
Sbjct: 61  EQRIKEKAGVKESDTGLAPSHLWDILGDRQKLSERHPLQVARCTKIIKSEPSRDSAGGSS 120

Query: 110 XXXXXXXXXXXXKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRI 169
                       KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY IELPLPPRI
Sbjct: 121 SATTVGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRI 180

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DPSVTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPERFAALGIDPPKGILLYGP
Sbjct: 181 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 240

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+KACIIFFDE+
Sbjct: 241 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 300

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                          NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI
Sbjct: 301 DAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 360

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI
Sbjct: 361 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 420

Query: 410 RARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           R+RRKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 421 RSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 456

>TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.251
           YKL145W
          Length = 463

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/463 (79%), Positives = 382/463 (82%), Gaps = 18/463 (3%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN--VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXIE 58
           M PKEDW                +  +PL+EGDIQVLK+YGAAPY             IE
Sbjct: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60

Query: 59  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXX---------- 108
            +IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK             
Sbjct: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSENGDESNSES 120

Query: 109 ------XXXXXXXXXXXXXKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE 162
                              KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE
Sbjct: 121 TEGNGTANTNTAADDNEEAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE 180

Query: 163 LPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPK 222
           LPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QI+KLREVVELPLLSPERFA LGIDPPK
Sbjct: 181 LPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPK 240

Query: 223 GILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKAC 282
           GILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+KAC
Sbjct: 241 GILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC 300

Query: 283 IIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPA 342
           IIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPA
Sbjct: 301 IIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPA 360

Query: 343 LLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCT 402
           LLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAELRSVCT
Sbjct: 361 LLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCT 420

Query: 403 EAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           EAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 421 EAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463

>ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145W RPT1 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 468

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/468 (79%), Positives = 382/468 (81%), Gaps = 23/468 (4%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXNV---PLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXI 57
           MPP+EDW                +    PL+EGDIQVLKTYGAAPYA            I
Sbjct: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60

Query: 58  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXXX 117
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK            
Sbjct: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120

Query: 118 XXXX--------------------KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 157
                                   KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 121 DGAAGPGATSENRDADDAEEDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QI+KLREVVELPLLSPERFA LG
Sbjct: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
           ++KACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 301 SKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 397
           TLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420

Query: 398 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for optimal CDC20 transcription;
           interacts with Rpn12p and Ubr1p; mutant has aneuploidy
           tolerance
          Length = 467

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/467 (80%), Positives = 384/467 (82%), Gaps = 22/467 (4%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN--VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXIE 58
           MPPKEDW                +  VPLTEGDIQVLK+YGAAPYA            IE
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIE 60

Query: 59  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXX--- 115
           ARIKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK             
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNN 120

Query: 116 -----------------XXXXXXKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 158
                                  KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK
Sbjct: 121 NSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 180

Query: 159 YHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGI 218
           Y+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QI+KLREVVELPLLSPERFA LGI
Sbjct: 181 YNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGI 240

Query: 219 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 278
           DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART
Sbjct: 241 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 300

Query: 279 RKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 338
           +KACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT
Sbjct: 301 KKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 360

Query: 339 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR 398
           LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR
Sbjct: 361 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR 420

Query: 399 SVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           SVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 421 SVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 467

>Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/468 (79%), Positives = 384/468 (82%), Gaps = 23/468 (4%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN--VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXIE 58
           MPPKEDW                +  VPLTEGDIQVLK+YGAAPYA            IE
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPNDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTESDLKDIE 60

Query: 59  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK------------- 105
           ARIKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK             
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDPTTDNN 120

Query: 106 --------XXXXXXXXXXXXXXXXKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 157
                                   KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 121 SNSGNENSNSNQQSADADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QI+KLREVVELPLLSPERFA LG
Sbjct: 181 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 240

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
           T+KACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 301 TKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 397
           TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420

Query: 398 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           RSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 421 RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.251
           YKL145W
          Length = 468

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/468 (78%), Positives = 378/468 (80%), Gaps = 23/468 (4%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXNV-PLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXIEA 59
           M PKEDW                 + PL+EGDIQVLKTYGAAP A            I  
Sbjct: 1   MAPKEDWDKYKAPIEDDKTTVDEKITPLSEGDIQVLKTYGAAPCAGKLKQTEKDLKEIRK 60

Query: 60  RIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXXXXX 119
           RIKEK GVKESDTGLAPSHLWDIMGDRQRLS EHPLQVARCTKIIK              
Sbjct: 61  RIKEKGGVKESDTGLAPSHLWDIMGDRQRLSSEHPLQVARCTKIIKANSDLENSNSMDNN 120

Query: 120 XX----------------------KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 157
                                   KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 121 STNNTPLDDTNHNNNIDEDNDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QI+KLREVVELPLLSPERFA LG
Sbjct: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 240

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
           T+KACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 301 TKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 397
           TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420

Query: 398 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           RSVCTEAGMFAIRARRKVA+EKDFLQAVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 RSVCTEAGMFAIRARRKVASEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W
           (RPT1) - putative ATPase, 26S protease subunit component
           [contig 246] FULL
          Length = 409

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/407 (88%), Positives = 364/407 (89%)

Query: 39  GAAPYAXXXXXXXXXXXXIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 98
           GAAPYA            IEA+IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 3   GAAPYADKLKAIDKDLKDIEAKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62

Query: 99  RCTKIIKXXXXXXXXXXXXXXXXKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 158
           RCTKIIK                KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK
Sbjct: 63  RCTKIIKPEASEDNTGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 122

Query: 159 YHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGI 218
           YHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGI
Sbjct: 123 YHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGI 182

Query: 219 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 278
           DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART
Sbjct: 183 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 242

Query: 279 RKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 338
           RKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT
Sbjct: 243 RKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 302

Query: 339 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR 398
           LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR
Sbjct: 303 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR 362

Query: 399 SVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           SVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTS+YMQYN
Sbjct: 363 SVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN 409

>Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W
           (REAL)
          Length = 471

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/471 (79%), Positives = 384/471 (81%), Gaps = 26/471 (5%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN--VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXIE 58
           MPPKE+W                +  VPLTEGDIQVLK+YGAAPYA            IE
Sbjct: 1   MPPKENWEKYKAPLEDDDKKSDEDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIE 60

Query: 59  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK------------- 105
           ARIKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK             
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDSTTNNN 120

Query: 106 -----------XXXXXXXXXXXXXXXXKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGV 154
                                      KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 121 NDINSSNNNNSNSNQESADADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180

Query: 155 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFA 214
           DRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QI+KLREVVELPLLSPERFA
Sbjct: 181 DRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFA 240

Query: 215 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 274
           ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300

Query: 275 MARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 334
           MART+KACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 301 MARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 360

Query: 335 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTG 394
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER IRWELISRLCPNSTG
Sbjct: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNSTG 420

Query: 395 AELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           AELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 471

>NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {ON}
           Anc_5.251
          Length = 474

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/474 (78%), Positives = 382/474 (80%), Gaps = 29/474 (6%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN----VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXX 56
           MPPKEDW                     VPL+EGDIQVLKTYGAAPYA            
Sbjct: 1   MPPKEDWEKYKAPVDAEDEKEKAKEDKIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60

Query: 57  IEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXX------- 109
           IE +IKEK+GV+ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSNGNEEEQEGE 120

Query: 110 ------------------XXXXXXXXXXXXKYIINLKQIAKFVVGLGERVSPTDIEEGMR 151
                                         KY+INLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 121 GESAASATSTTNNASTTGSGENGEDEDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180

Query: 152 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPE 211
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QI+KLREVVELPLLSPE
Sbjct: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240

Query: 212 RFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 271
           RFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300

Query: 272 LFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 331
           LFEMART+KACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 301 LFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 360

Query: 332 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPN 391
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER IRWELISRLCPN
Sbjct: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420

Query: 392 STGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474

>KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.251
           YKL145W
          Length = 477

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/477 (77%), Positives = 380/477 (79%), Gaps = 32/477 (6%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXN----VPLTEGDIQVLKTYGAAPYAXXXXXXXXXXXX 56
           MPPKEDW                      PLTE DIQVLKTYG APYA            
Sbjct: 1   MPPKEDWEKQKPAVENAEDDAAKKGEDVAPLTEDDIQVLKTYGVAPYAVKLKETENDLKE 60

Query: 57  IEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 116
           IEARIKEKAGV+ESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK           
Sbjct: 61  IEARIKEKAGVRESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKSGEGDGNGSGN 120

Query: 117 XXXX----------------------------XKYIINLKQIAKFVVGLGERVSPTDIEE 148
                                            KY+INLKQIAKFVVGLGERVSPTDIEE
Sbjct: 121 NSNGAAADGAGAAAAAGENAAQAAGADDDEDDSKYVINLKQIAKFVVGLGERVSPTDIEE 180

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
           GMRVGVDRSKYHIELPLPPRIDP+VTMMTVEEKPDVTYSDVGGCK+QI+KLREVVELPLL
Sbjct: 181 GMRVGVDRSKYHIELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 240

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
           SPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM
Sbjct: 241 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 300

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VRELFEMART++ACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIK
Sbjct: 301 VRELFEMARTKRACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIK 360

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRL 388
           VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRL
Sbjct: 361 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRL 420

Query: 389 CPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           CPN+TGAELRSVCTEAGMFAIRARRKVA+EKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 421 CPNATGAELRSVCTEAGMFAIRARRKVASEKDFLKAVDKVINGYKKFSSTSRYMQYN 477

>KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 475

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/475 (77%), Positives = 380/475 (80%), Gaps = 30/475 (6%)

Query: 1   MPPKEDWXXXXXXXXXXXXXXXXNV-PLTEGDIQVLKTYGAAPYAXXXXXXXXXXXXIEA 59
           MPPKEDW                 V PL+EGDI+VLKTYGAAPYA            IE 
Sbjct: 1   MPPKEDWEKYKAPIEDEESKEEKKVVPLSEGDIEVLKTYGAAPYAKKLKSIENDLKEIEK 60

Query: 60  RIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXX----------- 108
           +IKEKAGVKESDTGLAPSHLWDI+GDRQRLSEE PLQVARCTKIIK              
Sbjct: 61  KIKEKAGVKESDTGLAPSHLWDIVGDRQRLSEEQPLQVARCTKIIKAEKPQRSGNALGGD 120

Query: 109 ------------------XXXXXXXXXXXXXKYIINLKQIAKFVVGLGERVSPTDIEEGM 150
                                          KY+INLKQIAKFVVGLGERVSPTDIEEGM
Sbjct: 121 ADGNGVAAAAAAAAAAAAAASGTEDEDDDDAKYVINLKQIAKFVVGLGERVSPTDIEEGM 180

Query: 151 RVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSP 210
           RVGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSP
Sbjct: 181 RVGVDRSKYQIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSP 240

Query: 211 ERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR 270
           ERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR
Sbjct: 241 ERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR 300

Query: 271 ELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVM 330
           ELFEMART+KACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVM
Sbjct: 301 ELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVM 360

Query: 331 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCP 390
           FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCP
Sbjct: 361 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCP 420

Query: 391 NSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445
           NSTGAELRSVCTEAGMFAIRARRKV TEKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 NSTGAELRSVCTEAGMFAIRARRKVTTEKDFLKAVEKVINGYKKFSSTSRYMQYN 475

>NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {ON}
           Anc_5.251
          Length = 385

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/385 (84%), Positives = 331/385 (85%), Gaps = 22/385 (5%)

Query: 83  MGDRQRLSEEHPLQVARCTKIIKXXXXXXXX----------------------XXXXXXX 120
           MGDRQRLSEEHPLQVARCTKIIK                                     
Sbjct: 1   MGDRQRLSEEHPLQVARCTKIIKGNAASATEGEDGGDEQINPTSTSNNSNAENAEEDEED 60

Query: 121 XKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE 180
            KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE
Sbjct: 61  NKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE 120

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           KPD+TYSDVGGCK+QI+KLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARA
Sbjct: 121 KPDITYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 180

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
           VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+KACIIFFDEI           
Sbjct: 181 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGGARFDDG 240

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL
Sbjct: 241 AGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 300

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
           EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVA+EKD
Sbjct: 301 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVASEKD 360

Query: 421 FLQAVEKVINGYKKFSSTSRYMQYN 445
           FL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 361 FLKAVEKVINGYKKFSSTSRYMQYN 385

>Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  311 bits (798), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 208/309 (67%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
            RA I RIHS+ M++ RGI    ++      +GA+++ VCTEAGMFA+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDF 382

Query: 422 LQAVEKVIN 430
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates
          Length = 404

 Score =  311 bits (797), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/309 (49%), Positives = 208/309 (67%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYQLHKVLENKVDPLVSLMMVEKV 141

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSG 261

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 262 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVA 321

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
            R  I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 322 ARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 381

Query: 422 LQAVEKVIN 430
             AV KV+N
Sbjct: 382 ELAVAKVMN 390

>Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  311 bits (796), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 208/309 (67%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
            RA I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 422 LQAVEKVIN 430
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  310 bits (795), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 208/309 (67%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
            RA I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 422 LQAVEKVIN 430
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}
           RPT6One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in the degradation of
           ubiquitinated substrates; bound by ubiquitin-protein
           ligases Ubr1p and Ufd4p; localized mainly to the nucleus
           throughout the cell cycle
          Length = 405

 Score =  310 bits (795), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 208/309 (67%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
            RA I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 422 LQAVEKVIN 430
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {ON}
           YGL048C (RPT6) - ATPase [contig 51] FULL
          Length = 405

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 204/301 (67%), Gaps = 1/301 (0%)

Query: 131 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 190
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 191 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 250
           G  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 251 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 309
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 310 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 369
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 370 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 429
           HS+ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 430 N 430
           N
Sbjct: 391 N 391

>KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 204/301 (67%), Gaps = 1/301 (0%)

Query: 131 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 190
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKASQRVCLKSDSYALHKILENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 191 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 250
           G  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 251 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 309
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 310 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 369
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 370 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 429
           HS+ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 430 N 430
           N
Sbjct: 391 N 391

>AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL048C
           (RPT6)
          Length = 405

 Score =  305 bits (781), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 154/301 (51%), Positives = 203/301 (67%), Gaps = 1/301 (0%)

Query: 131 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 190
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKVSQRVCLKSDSYVLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 191 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 250
           G  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 251 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 309
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 310 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 369
           TMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 271 TMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRI 330

Query: 370 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 429
           HS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 390

Query: 430 N 430
           N
Sbjct: 391 N 391

>SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048C RPT6 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 408

 Score =  305 bits (781), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 203/301 (67%), Gaps = 1/301 (0%)

Query: 131 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 190
            K++V + + +   D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 94  GKYIVDIAKDIDVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 153

Query: 191 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 250
           G  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 154 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 213

Query: 251 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 309
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 214 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 273

Query: 310 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 369
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 274 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTIAARTEILRI 333

Query: 370 HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 429
           HS+ M++ RGI  + I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 334 HSRKMNLTRGINLKKIAEQMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 393

Query: 430 N 430
           N
Sbjct: 394 N 394

>ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]
           {ON} highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  305 bits (780), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 211/318 (66%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDISKDINIKDLKPSQRVCLKSDSYTLHKILENKADPLVSLMMVEKV 142

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  +GG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMLGGLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAV 202

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARENAPSIIFMDEIDSIGSSRVEGSG 262

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIVMATNRLDILDPALLRPGRIDRKIEFPPPTVA 322

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
            R  I RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D 
Sbjct: 323 ARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDL 382

Query: 422 LQAVEKVINGYKKFSSTS 439
             AV KV+N  ++ + +S
Sbjct: 383 ELAVGKVMNRNQETAISS 400

>CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048c SUG1 26S proteasome regulatory subunit
          Length = 400

 Score =  305 bits (780), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 208/311 (66%), Gaps = 2/311 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 76  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLVNKADPLVSLMMVEKV 135

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 136 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 195

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXX--XXXXXXXX 299
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 196 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGG 255

Query: 300 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 359
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 256 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPT 315

Query: 360 LEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           +  RA I RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 316 VAARAEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 375

Query: 420 DFLQAVEKVIN 430
           DF  AV KV+N
Sbjct: 376 DFELAVGKVMN 386

>Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON}
           (110852..112063) [1212 nt, 404 aa]
          Length = 403

 Score =  304 bits (779), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 207/310 (66%), Gaps = 1/310 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           + ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 80  RVLVKVQPEGKYIVDVAKDINVKDLKPSQRVCLKSDTYMLHKVLENKADPLVSLMMVEKV 139

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 140 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 199

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 200 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGS 259

Query: 302 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
              + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 260 GGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 319

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
             R  I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 320 AARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 379

Query: 421 FLQAVEKVIN 430
           F  AV KV+N
Sbjct: 380 FELAVSKVMN 389

>NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa]
           {ON} Anc_4.57
          Length = 407

 Score =  304 bits (779), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 154/310 (49%), Positives = 207/310 (66%), Gaps = 1/310 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 84  KVLVKVQPEGKYIVDIAKDINVKDLKTSQRVCLKSDSYMLHKILENKADPLVSLMMVEKV 143

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 144 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 203

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 204 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGS 263

Query: 302 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 264 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 323

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
             R  I RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 324 AARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 383

Query: 421 FLQAVEKVIN 430
           F  AV KV+N
Sbjct: 384 FELAVGKVMN 393

>TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4.57
           YGL048C
          Length = 401

 Score =  302 bits (774), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 207/310 (66%), Gaps = 1/310 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           + ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 78  RVLVKIQPEGKYIVDVAKDINIKELKPSQRVCLKSDSYLLHKVLKNKSDPLVSLMMVEKV 137

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 138 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 197

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 198 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGS 257

Query: 302 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
              + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 258 GGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 317

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
             R  I RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 318 AARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 377

Query: 421 FLQAVEKVIN 430
           F  AV KV+N
Sbjct: 378 FELAVAKVMN 387

>TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa]
           {ON} Anc_4.57 YGL048C
          Length = 406

 Score =  302 bits (774), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 201/300 (67%)

Query: 131 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 190
            K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  +G
Sbjct: 93  GKYIVDISKDINIKELKPSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMLG 152

Query: 191 GCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 250
           G  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 153 GLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 212

Query: 251 RVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRT 310
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               +EVQRT
Sbjct: 213 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSGGGDSEVQRT 272

Query: 311 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 370
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RIH
Sbjct: 273 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTQILRIH 332

Query: 371 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 430
           S+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D   AV KV+N
Sbjct: 333 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDLELAVGKVMN 392

>KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {ON}
           Anc_4.57 YGL048C
          Length = 400

 Score =  302 bits (773), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 206/313 (65%), Gaps = 4/313 (1%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 74  KVLVKVQPEGKYIVDVAKDINVKELKVSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKV 133

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 134 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 193

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXX----XXXXXX 297
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 194 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVESSS 253

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                  +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  
Sbjct: 254 GGGGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPA 313

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAT 417
           P L  R  I RIHS+ M++ RGI    I       +GA+++ VCTEAGM+A+R RR   T
Sbjct: 314 PTLAARTEILRIHSRKMNLTRGINLRKIVEKMNGCSGADVKGVCTEAGMYALRERRIHVT 373

Query: 418 EKDFLQAVEKVIN 430
           ++DF  AV KV+N
Sbjct: 374 QEDFELAVGKVMN 386

>KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {ON}
           Anc_4.57 YGL048C
          Length = 405

 Score =  302 bits (773), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 154/310 (49%), Positives = 207/310 (66%), Gaps = 1/310 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYMLHKILENKADPLVSLMMVEKV 141

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVESGS 261

Query: 302 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 262 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 321

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
             R  I RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 322 AARTEILRIHSRKMNLTRGINLRKIADKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 381

Query: 421 FLQAVEKVIN 430
           F  AV KV+N
Sbjct: 382 FELAVGKVMN 391

>NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57
          Length = 405

 Score =  302 bits (773), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 207/310 (66%), Gaps = 1/310 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           K ++ ++   K++V + + +   +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDIDIKNLKPSQRVCLKSDSYMLHKVLENKSDPLVSLMMVEKV 141

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARQHAPSIIFMDEIDSIGSSRVEGGS 261

Query: 302 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 262 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 321

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
             RA I RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 322 AARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 381

Query: 421 FLQAVEKVIN 430
           F  AV KV+N
Sbjct: 382 FELAVGKVMN 391

>TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {ON}
           Anc_4.57 YGL048C
          Length = 403

 Score =  301 bits (771), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 208/310 (67%), Gaps = 1/310 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           + ++ ++   K++V +   ++  +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 80  RVLVKVQPEGKYIVDVAPDINVKELKPSQRVCLKSDSYLLHKVLDNKADPLVSLMMVEKV 139

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 140 PDSTYDMVGGLTKQIREIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 199

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 200 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGS 259

Query: 302 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
              + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 260 GGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 319

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
             RA I +IHS+ M++ RGI  + ++      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 320 AARAEILKIHSRKMNLTRGINLKKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 379

Query: 421 FLQAVEKVIN 430
           F  AV KV+N
Sbjct: 380 FELAVAKVMN 389

>KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 434

 Score =  279 bits (714), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 196/307 (63%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 172

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 232

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 352

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+ ++       +E   ++     GA++R+  TEAG FAIR  R    ++D 
Sbjct: 353 GRLEIFKIHTSNVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDYINQEDL 412

Query: 422 LQAVEKV 428
           ++AV KV
Sbjct: 413 MKAVRKV 419

>KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 433

 Score =  278 bits (712), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 194/307 (63%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 112 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFEQ 171

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            D+T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 172 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 231

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 232 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 291

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 292 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 351

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IHS  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 352 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 411

Query: 422 LQAVEKV 428
           ++AV KV
Sbjct: 412 MKAVRKV 418

>Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  277 bits (709), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH++ +       +E   ++     GA++R+  TEAG FAIR  R   T  D 
Sbjct: 356 GRLEIFKIHTEKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIREDRDHITSDDL 415

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {ON}
           Anc_8.708 YOR259C
          Length = 444

 Score =  276 bits (707), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 201/322 (62%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  T +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 123 KYIVKASSGPRYIVGVRNSVDRTKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 182

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 183 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 242

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 303 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNEA 362

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+ ++       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEIFKIHTANVKKHGEFDFDAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV +  KK   T  Y +
Sbjct: 423 MKAVRKV-SETKKLEGTIEYQK 443

>Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa]
           {ON} YOR259C (RPT4) - ATPase; component of the 26S
           proteasome cap subunit [contig 68] FULL
          Length = 434

 Score =  276 bits (705), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 193/307 (62%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 172

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            D+T+  +GG  EQI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAKAV 232

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 352

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IHS  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 353 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 412

Query: 422 LQAVEKV 428
           ++AV KV
Sbjct: 413 MKAVRKV 419

>YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON}
           RPT4One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in degradation of
           ubiquitinated substrates; contributes preferentially to
           ERAD; required for spindle pole body duplication; mainly
           nuclear localization
          Length = 437

 Score =  276 bits (705), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 197/322 (61%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R      D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 421

 Score =  275 bits (703), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 140/307 (45%), Positives = 193/307 (62%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E 
Sbjct: 100 KYIVKASSGPRYIVGVRNSVDRSKLKKGIRVTLDITTLTIMRILPRETDPLVYNMTTFEP 159

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 160 GEISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 219

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 220 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 279

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 280 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 339

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 340 GRLEIFKIHTAHVKKSGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIQDDL 399

Query: 422 LQAVEKV 428
           ++AV KV
Sbjct: 400 MKAVRKV 406

>AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR259C (RPT4)
          Length = 432

 Score =  275 bits (703), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 193/307 (62%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 111 KYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 170

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+AV
Sbjct: 171 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAKAV 230

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 231 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 290

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 291 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 350

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           G   IF+IH+  +       +E   ++C    GA++R+  TEAG FAIR  R    ++D 
Sbjct: 351 GMLEIFKIHTAKVKKSGEFDFEAAVKMCDGFNGADIRNCVTEAGFFAIRDDRDYIIQEDL 410

Query: 422 LQAVEKV 428
           ++AV KV
Sbjct: 411 MKAVRKV 417

>NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa]
           {ON} Anc_3.216
          Length = 437

 Score =  275 bits (703), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 198/306 (64%)

Query: 124 IINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD 183
           I+    +  F V +   V    +E G  V +      I   L    DP V++M +++ P 
Sbjct: 119 IVTSPTMPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPT 178

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
            +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN
Sbjct: 179 ESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVAN 238

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
           +T ATF+R++GSEL+QKY+G+G R+ R++F++A  +   IIF DEI              
Sbjct: 239 QTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGEQAPSIIFIDEIDAIGTKRYDSNSGG 298

Query: 304 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 363
             E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +
Sbjct: 299 EREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTK 358

Query: 364 ANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQ 423
             I  IH+  M++ + + +E +     + +GA+++++CTEAG+ A+R RR   T +DF Q
Sbjct: 359 RKILGIHTSKMNLSKDVDFETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTGEDFKQ 418

Query: 424 AVEKVI 429
           A E+V+
Sbjct: 419 AKERVM 424

>Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  275 bits (702), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V+ + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVNRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R      D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar to
           Ashbya gossypii AAL113W
          Length = 427

 Score =  274 bits (701), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 194/307 (63%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 106 KYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 165

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI+ PKG+LLYGPPGTGKTL A+AV
Sbjct: 166 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGINSPKGVLLYGPPGTGKTLLAKAV 225

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 226 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 285

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 286 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 345

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    ++D 
Sbjct: 346 GRLEIFKIHTAKVKKTGEFDFEATVKMSDGFNGADIRNCVTEAGFFAIRDDRDYIIQEDL 405

Query: 422 LQAVEKV 428
           ++AV KV
Sbjct: 406 MKAVRKV 412

>NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708
          Length = 426

 Score =  274 bits (700), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 105 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 164

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 165 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 224

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 225 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 284

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 285 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 344

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+  +  +    +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 345 GRLEIFKIHTAKVKKQGDFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 404

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV    KK   +  Y +
Sbjct: 405 MKAVRKVAE-VKKLEGSLEYQK 425

>TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa]
           {ON} Anc_8.708 YOR259C
          Length = 435

 Score =  274 bits (701), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 114 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 173

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            D+++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 174 GDISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 233

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 234 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 293

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 294 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 353

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 354 GRLEIFKIHTVHVKKSGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 413

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV    KK   +  Y +
Sbjct: 414 MKAVRKVAE-VKKLEGSLDYQK 434

>Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  274 bits (700), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKLEIPLPNEA 355

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPEDL 415

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708
          Length = 443

 Score =  273 bits (698), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 197/322 (61%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V    +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRKKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 181

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            +VT+  +GG  EQI  LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEVTFDGIGGLTEQIRALREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 301

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH++ +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 421

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV    KK   +  Y +
Sbjct: 422 MKAVRKVAE-VKKLEGSLEYQK 442

>KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {ON}
           Anc_8.708 YOR259C
          Length = 424

 Score =  273 bits (697), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 201/322 (62%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 103 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 162

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            +++++ +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 163 GEISFNGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 222

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           +    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 223 SATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 282

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 283 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 342

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+ ++       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 343 GRLEIFKIHTANVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 402

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV +  KK   T  Y +
Sbjct: 403 MKAVRKV-SEVKKLEGTLEYQK 423

>NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON}
           Anc_3.216
          Length = 376

 Score =  271 bits (692), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 181/265 (68%)

Query: 165 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 224
           L   +DP V++M +++ P  +Y D+GG + QI +++E VELPL  PE +  +GI PPKG+
Sbjct: 99  LQDDVDPMVSVMKIDKSPTESYGDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGV 158

Query: 225 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 284
           +LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+VR++F++A      II
Sbjct: 159 ILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFKVASENSPSII 218

Query: 285 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 344
           F DEI                E+QRTMLEL+ QLDGFD    +KV+ ATN+  TLDPAL+
Sbjct: 219 FIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSEVKVIMATNKIETLDPALI 278

Query: 345 RPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEA 404
           RPGRIDRK+ F  PDL  +  I  IH+  M++   + +E +     + +GA+++++CTEA
Sbjct: 279 RPGRIDRKILFENPDLSTKRKILGIHTSKMNLSSDVDFETLVTTKDDLSGADIQAMCTEA 338

Query: 405 GMFAIRARRKVATEKDFLQAVEKVI 429
           G+ A+R RR   T +DF QA E+V+
Sbjct: 339 GLLALRERRMQVTAEDFKQAKERVM 363

>YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for normal peptide hydrolysis by
           the core 20S particle
          Length = 437

 Score =  272 bits (696), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 181/260 (69%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF QA E+V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.216
           YDL007W
          Length = 436

 Score =  272 bits (695), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 181/260 (69%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 164 DPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 223

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 224 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 283

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 284 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 343

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 344 DRKILFENPDLSTKRKILGIHTSKMNLSSDVDLEKLVTSKDDLSGADIQAMCTEAGLLAL 403

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF QA E+V+
Sbjct: 404 RERRMQVTSEDFEQAKERVL 423

>Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {ON}
           complement(38724..40022) [1299 nt, 433 aa]
          Length = 432

 Score =  272 bits (695), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 111 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 170

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 171 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 230

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 231 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 290

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 291 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 350

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 351 GRLEIFKIHTAHVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 410

Query: 422 LQAVEKVINGYKKFSSTSRY 441
           ++AV KV    KK   +  Y
Sbjct: 411 MKAVRKVAE-VKKLEGSLEY 429

>CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259c CRL13
          Length = 436

 Score =  272 bits (695), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 115 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 174

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 175 GEISFEGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 234

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 235 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 294

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 295 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 354

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH+  +       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 355 GRLEIFKIHTSKVKKSGEFDFDAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 414

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV    KK   T  Y +
Sbjct: 415 MKAVRKVAE-VKKLEGTLEYQK 435

>Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  272 bits (695), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 181/260 (69%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF QA E+V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  272 bits (695), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 181/260 (69%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF QA E+V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {ON}
           Anc_3.216 YDL007W
          Length = 435

 Score =  271 bits (694), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 127/260 (48%), Positives = 181/260 (69%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 163 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 222

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 223 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGDNAPSIVFIDEI 282

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 283 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 342

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL  +  I  IH+  M++   +  E +     + +GA++++VCTEAG+ A+
Sbjct: 343 DRKILFESPDLATKKKILGIHTSKMNLSADVDLEKLVTSKDDLSGADIQAVCTEAGLLAL 402

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF QA E+V+
Sbjct: 403 RERRMQVTAEDFKQAKERVM 422

>TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.708
           YOR259C
          Length = 443

 Score =  271 bits (694), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 199/320 (62%), Gaps = 1/320 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTAFEQ 181

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 301

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR +IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLDIFKIHTSKVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 421

Query: 422 LQAVEKVINGYKKFSSTSRY 441
           ++AV KV +  KK   +  Y
Sbjct: 422 MKAVRKV-SEVKKLEGSLEY 440

>TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  271 bits (693), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 127/273 (46%), Positives = 185/273 (67%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP +++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMISVMKIDKSPTESYSDIGGLENQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 284

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 285 DAIGTKRYESNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 344

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL  +  I  IH+  MS+   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLGTKRKILGIHTSKMSLSSDVHLEELVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 410 RARRKVATEKDFLQAVEKVINGYKKFSSTSRYM 442
           R RR   T +DF QA E+V+    + +    YM
Sbjct: 405 RERRMQVTAEDFKQAKERVMKNKVEENLEGLYM 437

>ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 437

 Score =  271 bits (693), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 127/260 (48%), Positives = 179/260 (68%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP +  M +++ P   YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMIAAMKIDKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIRPPKGVILYGA 224

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAEHSPSIVFIDEI 284

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           EVQRTMLEL+ QLDGFD RG+IKV+ ATNR  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYESNSGGEREVQRTMLELLNQLDGFDDRGDIKVVMATNRIETLDPALIRPGRI 344

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PD+  +  I  IH+  M++   +R + +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDMNTKKRILGIHTAKMNLSEDVRLDELVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF QA E+V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa]
           {ON} complement(182279..183592) [1314 nt, 438 aa]
          Length = 437

 Score =  271 bits (692), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 181/260 (69%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 284

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 344

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL+ +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFEQPDLQTKRKILTIHTSKMNLSEDVNLEQLVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF Q  E+V+
Sbjct: 405 RERRMQVTAEDFKQGKERVL 424

>Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007W
           (RPT2) - (putative) 26S protease subunit [contig 31]
           FULL
          Length = 376

 Score =  268 bits (686), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 132/310 (42%), Positives = 195/310 (62%)

Query: 133 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 192
           F V +   V    +E G  V +      I   L    DP + +M +++ P  +YSD+GG 
Sbjct: 67  FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPMINVMKIDKSPTESYSDIGGL 126

Query: 193 KEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 252
           + QI +++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 127 ESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 186

Query: 253 IGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 312
           +GSEL+QKY+G+G R+ R++F+ A      I+F DEI                E+QRTML
Sbjct: 187 VGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 246

Query: 313 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK 372
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IH+ 
Sbjct: 247 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDISTKRKILTIHTS 306

Query: 373 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGY 432
            M++   +  E +     + +GA+++++CTEAG+ A+R RR   T +DF QA E+++   
Sbjct: 307 KMNLAPDVDLENLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERILKNK 366

Query: 433 KKFSSTSRYM 442
            + +  S Y+
Sbjct: 367 VEENLESLYL 376

>KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 432

 Score =  270 bits (691), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 129 MVGL---VDPVKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 185

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQGEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ Y+GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 246 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNAQSTIKHEDFVEAIGEV--QAR 423

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 424 KSKSVSFY 431

>SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736)
           [1311 bp, 436 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 436

 Score =  270 bits (691), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 135/310 (43%), Positives = 197/310 (63%)

Query: 133 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 192
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +YSD+GG 
Sbjct: 127 FYVSILSFVDKEMLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYSDIGGL 186

Query: 193 KEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 252
           + QI +++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 187 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 246

Query: 253 IGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 312
           +GSEL+QKY+G+G R+ R++F++A      I+F DEI                E+QRTML
Sbjct: 247 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 306

Query: 313 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK 372
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IH+ 
Sbjct: 307 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDISTKRKILGIHTS 366

Query: 373 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGY 432
            M++   I  E +     + +GA+++++CTEAG+ A+R RR   T +DF QA E+V+   
Sbjct: 367 KMNLSGDIDLENLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNK 426

Query: 433 KKFSSTSRYM 442
            + +  S Y+
Sbjct: 427 VEENLESLYL 436

>Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii AER254W
          Length = 432

 Score =  270 bits (690), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 194/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V+P  ++    VGV++  Y +   LP   D  V  M V++KP  TYSDVGG  
Sbjct: 129 MVGL---VNPKKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 185

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQAEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 246 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVVKHEDFVEAISEV--QAR 423

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 424 KTKSVSFY 431

>TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.251
           YKL145W
          Length = 434

 Score =  270 bits (689), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P +++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 LVGL---VDPKNLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEESRAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W  ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWSELARSTDEFNGAQLKAVAVEAGMIALRNGQSSVKHEDFVEAISEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428
          Length = 434

 Score =  270 bits (689), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V PT ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPTKLKPNDLVGVNKDSYLILEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  +GRA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDGRAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  270 bits (689), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKQSEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEEARAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KTKSVSFY 433

>CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007w YTA5
          Length = 433

 Score =  270 bits (689), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 181/260 (69%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 161 DPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 220

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 221 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 280

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 281 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 340

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 341 DRKILFENPDLSTKRKILGIHTSKMNLSSDVDLENLVTSKDDLSGADIQAMCTEAGLLAL 400

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF QA E+V+
Sbjct: 401 RERRMQVTAEDFKQAKERVM 420

>TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  269 bits (688), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 180/260 (69%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKKKILGIHTSKMNLAEDVDLETLVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF Q  E+V+
Sbjct: 405 RERRMQVTAEDFKQGKERVL 424

>Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  269 bits (688), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 181/260 (69%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P  +YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL  +  I  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLCEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF QA E+V+
Sbjct: 405 RERRMQVTGEDFKQAKERVM 424

>TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {ON}
           Anc_8.708 YOR259C
          Length = 455

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 198/320 (61%), Gaps = 1/320 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   +  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 134 KYIVKASSGPRYIVGVRNSIDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 193

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 194 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 253

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 254 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKDHEPCIIFMDEVDAIGGRRFSEGT 313

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGF+  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 314 SADREIQRTLMELLTQMDGFENLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 373

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  IF+IH++ +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 374 GRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIREDRNHIIPEDL 433

Query: 422 LQAVEKVINGYKKFSSTSRY 441
           ++AV KV    KK   +  Y
Sbjct: 434 MKAVRKVAE-VKKLEGSLEY 452

>Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar to
           Ashbya gossypii AEL011W
          Length = 437

 Score =  269 bits (687), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 191/297 (64%)

Query: 133 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 192
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +Y+D+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGALQDDADPMVSVMKIDKSPAESYNDIGGL 187

Query: 193 KEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 252
           + QI +++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 253 IGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 312
           +GSEL+QKY+G+G R+ R++F++A      I+F DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 313 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK 372
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IH+ 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDITTKRKILGIHTS 367

Query: 373 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 429
            M++   +  E +       +GA+++++CTEAG+ A+R RR   T +DF QA E+V+
Sbjct: 368 KMNLSEDVNLETLVTSKDELSGADIKAMCTEAGLLALRERRMQVTVEDFKQAKERVM 424

>TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.216
           YDL007W
          Length = 434

 Score =  268 bits (685), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 179/260 (68%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P  TYSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 162 DPMVSVMKMDKSPTETYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 221

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+VR++F++A      I+F DEI
Sbjct: 222 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFKVAGENAPSIVFIDEI 281

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD   ++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 282 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSDVKVIMATNKIESLDPALIRPGRI 341

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PDL  +  I  IH+  MS+   +  + +     + +GA+++++CTEAG+ A+
Sbjct: 342 DRKILFENPDLSTKRKILAIHTSKMSLSEDVSLDELVTSKDDLSGADIQAMCTEAGLLAL 401

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T KDF Q  E+V+
Sbjct: 402 RERRMQVTAKDFEQGKERVL 421

>AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL007W (RPT2)
          Length = 437

 Score =  268 bits (685), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 192/297 (64%)

Query: 133 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 192
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +Y+D+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYNDIGGL 187

Query: 193 KEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 252
           + QI +++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 253 IGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 312
           +GSEL+QKY+G+G R+ R++F++A      I+F DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 313 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK 372
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IH+ 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDVSTKRKILGIHTS 367

Query: 373 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 429
            M++   +  E +     + +GA+++++CTEAG+ A+R RR   T +DF QA E+V+
Sbjct: 368 KMNLSADVDLETLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTVEDFKQAKERVM 424

>KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 434

 Score =  268 bits (684), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEG+++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117w YTA1
          Length = 429

 Score =  267 bits (683), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 126 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 182

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 183 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 242

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 243 APQLVQMFIGEGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 302

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 303 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 362

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 363 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMLALRNGQSSVKHEDFVEAIGEV--QAR 420

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 421 KSKSVSFY 428

>KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {ON}
           Anc_5.428 YOR117W
          Length = 423

 Score =  267 bits (682), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 120 MVGL---VDPDTLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 176

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 177 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 236

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 237 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 296

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF    N+KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 297 LLNQLDGFSSDDNVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 356

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V    +
Sbjct: 357 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQASVKHEDFVDAIGEV--QAR 414

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 415 KSKSVSFY 422

>Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {ON}
           YOR117W (RPT5) - 26S protease regulatory subunit [contig
           130] FULL
          Length = 434

 Score =  267 bits (682), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEG+++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  267 bits (682), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ Y+GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; recruited to the GAL1-10 promoter region
           upon induction of transcription; similar to human TBP1
          Length = 434

 Score =  267 bits (682), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ Y+GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  266 bits (681), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ Y+GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  266 bits (681), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMQRADKFKDLGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 444

 Score =  266 bits (681), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 197/322 (61%), Gaps = 1/322 (0%)

Query: 122 KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 181
           KYI+      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  ++
Sbjct: 123 KYIVKASSGPRYIVGVRNSVERSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFDQ 182

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI  P G+LLYGPPGTGKTL A+AV
Sbjct: 183 DNISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKSPTGVLLYGPPGTGKTLLAKAV 242

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 303 SADREIQRTLMELLTQMDGFDSLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 362

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 421
           GR  +F+IH+ ++       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEVFKIHTTNVKKAGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 422 LQAVEKVINGYKKFSSTSRYMQ 443
           ++AV KV    KK   T  Y +
Sbjct: 423 MKAVRKVAES-KKLEGTVDYQK 443

>KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085)
           [1368 bp, 455 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 455

 Score =  267 bits (682), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 131/306 (42%), Positives = 191/306 (62%)

Query: 124 IINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD 183
           II       F V +   V    +E G  V +      I   L    DP + +M +++ P 
Sbjct: 137 IITSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPMINVMKIDKSPT 196

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
             YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN
Sbjct: 197 ENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVAN 256

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
           +T ATF+R++GSEL+QKY+G+G R+ R++F+ A      I+F DEI              
Sbjct: 257 QTSATFLRIVGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAIGTKRYDSNSGG 316

Query: 304 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 363
             E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +
Sbjct: 317 EREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDITTK 376

Query: 364 ANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQ 423
             I  IH+  M++   +  + +     + +GA+++++CTEAG+ A+R RR   T +DF Q
Sbjct: 377 RKILAIHTSKMNLATDVDLDNLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQ 436

Query: 424 AVEKVI 429
           A E+++
Sbjct: 437 AKERIL 442

>Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {ON}
           complement(71197..72501) [1305 nt, 435 aa]
          Length = 434

 Score =  266 bits (679), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  266 bits (679), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ Y+GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+    I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTADDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR117W (RPT5)
          Length = 460

 Score =  266 bits (680), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V++KP  TYSDVGG  
Sbjct: 157 MVGL---VDPKQLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 213

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 214 KQIEELVEAIVLPMKQADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 273

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 274 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 333

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 334 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 393

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V    +
Sbjct: 394 MTSDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVIKHEDFVEAIGEV--QAR 451

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 452 KTKSVSFY 459

>KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 434

 Score =  265 bits (677), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 122/260 (46%), Positives = 180/260 (69%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           DP V++M +++ P   YSD+GG + QI +++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 162 DPMVSVMKMDKSPTENYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 221

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 222 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 281

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 282 DAIGTKRYESNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 341

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           DRK+ F  PD+  +  I  IH+  M++   +  + +     + +GA+++++CTEAG+ A+
Sbjct: 342 DRKILFENPDITTKRKIVGIHTSKMNLAEDVDLDNLVTSKDDLSGADIKAMCTEAGLLAL 401

Query: 410 RARRKVATEKDFLQAVEKVI 429
           R RR   T +DF +A E+V+
Sbjct: 402 RERRMQVTAQDFKEAKERVL 421

>TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {ON}
           Anc_5.428 YOR117W
          Length = 434

 Score =  265 bits (677), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDTLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVDAIGEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON}
           Anc_5.428
          Length = 482

 Score =  266 bits (680), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V PT ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 179 MVGL---VDPTKLKPNDLVGVNKDSYLVLEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 235

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 236 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 295

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 296 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 355

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 356 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 415

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 416 MTTDNDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 473

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 474 KSKSVSFY 481

>TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  264 bits (675), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP   YSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTENYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     IKV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  263 bits (671), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 135/308 (43%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 134 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 193
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 194 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 253
           +QI++L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFTDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 254 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 313
             +LVQ ++GEGA++VR+ F +A+ +   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 314 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 373
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF +P  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVVAATNRVDVLDPALLRSGRLDRKIEFPIPSEDSRAQILQIHSRK 367

Query: 374 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 433
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MATDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 434 KFSSTSRY 441
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score =  253 bits (647), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 133/278 (47%), Positives = 177/278 (63%), Gaps = 5/278 (1%)

Query: 150 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLS 209
           M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+ 
Sbjct: 135 MSVALHRHSNALVDILPPDSDSSISIMGANEKPDVTYADVGGLDMQKQEIREAVELPLVQ 194

Query: 210 PERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 269
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMV
Sbjct: 195 ADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMV 254

Query: 270 RELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 329
           R++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 255 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 314

Query: 330 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISRL 388
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S +
Sbjct: 315 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 372

Query: 389 CPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 424
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 VRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  251 bits (642), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 180/293 (61%), Gaps = 8/293 (2%)

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGSNEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QGDLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 387
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTVASKMSL--APEADLDSL 369

Query: 388 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVE---KVINGYKKF 435
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A     K  N   KF
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYTAQVKTDNDVDKF 422

>ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 453

 Score =  252 bits (644), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 138/293 (47%), Positives = 180/293 (61%), Gaps = 8/293 (2%)

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
            M V + R    + + LPP  D S+++M   EKPDVTYSDVGG   Q  ++RE VELPL 
Sbjct: 159 SMSVALHRHSNALVVILPPDSDSSISIMNESEKPDVTYSDVGGLDIQKQEIREAVELPLT 218

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 219 QADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRM 278

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 279 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELMTQMDGFDQSTNVK 338

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 387
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 339 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSL 396

Query: 388 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVE---KVINGYKKF 435
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A +   K  N   KF
Sbjct: 397 IIRNDSLSGAVIAAIMQEAGLRAVRRNRYVILQSDLEEAYDAQVKTENDVDKF 449

>NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  251 bits (640), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRM 251

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 387
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 369

Query: 388 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 424
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates
          Length = 428

 Score =  251 bits (640), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 171/262 (65%), Gaps = 3/262 (1%)

Query: 165 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 224
           LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 150 LPPDSDSSISIMAANEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 209

Query: 225 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 284
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 210 LLYGPPGTGKTMLVKAVANATEAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 269

Query: 285 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 344
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 270 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 329

Query: 345 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 402
           RPGR+DRK+EF SL D   R  IF   +  MS+      + LI R  P S GA + ++  
Sbjct: 330 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 388

Query: 403 EAGMFAIRARRKVATEKDFLQA 424
           EAG+ A+R  R V  + D  +A
Sbjct: 389 EAGLRAVRKNRYVILQSDLEEA 410

>Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  250 bits (639), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 179/293 (61%), Gaps = 8/293 (2%)

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 387
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 388 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVE---KVINGYKKF 435
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A     K  N   KF
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKF 424

>CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394w YTA2 26S proteasome regulatory subunit
          Length = 431

 Score =  250 bits (638), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 171/263 (65%), Gaps = 5/263 (1%)

Query: 165 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 224
           LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 225 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 284
           LLYGPPGTGKT+  +AVAN T A FIRV GSE VQKY+GEG RMVR++F +AR     I+
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVQKYLGEGPRMVRDVFRLARENSPSIV 272

Query: 285 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 344
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 345 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS--TGAELRSVC 401
           RPGR+DRK+EF SL D   R  IF   +  MS+      +L S +  N   +GA + ++ 
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSLIIRNDAISGAVIAAIM 390

Query: 402 TEAGMFAIRARRKVATEKDFLQA 424
            EAG+ A+R  R V  + D  +A
Sbjct: 391 QEAGLRAVRKNRYVILQSDLEEA 413

>YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; substrate of N-acetyltransferase B
          Length = 428

 Score =  250 bits (638), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 179/293 (61%), Gaps = 8/293 (2%)

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 387
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 388 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVE---KVINGYKKF 435
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A     K  N   KF
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKF 424

>Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {ON}
           similar to Ashbya gossypii AFR394W
          Length = 425

 Score =  250 bits (638), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 173/262 (66%), Gaps = 3/262 (1%)

Query: 165 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 224
           LPP  D S++++   EKPDVTY+DVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISILGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 225 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 284
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 285 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 344
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 326

Query: 345 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 402
           RPGR+DRK+EF SL D   R  IF   +  MS+   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 403 EAGMFAIRARRKVATEKDFLQA 424
           EAG+ A+R  R V  ++D  +A
Sbjct: 386 EAGLRAVRKNRYVILQRDLEEA 407

>Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  250 bits (638), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 387
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 388 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 424
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5.486
           YDR394W
          Length = 431

 Score =  250 bits (638), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 172/263 (65%), Gaps = 5/263 (1%)

Query: 165 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 224
           LPP  D S+++M   EKPDV+YSDVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISIMGDNEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 225 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 284
           LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 272

Query: 285 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 344
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 345 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS--TGAELRSVC 401
           RPGR+DRK+EF SL D   R  IF   +  MS+      +L S +  N   +GA + ++ 
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLIVRNDSLSGAIIAAIM 390

Query: 402 TEAGMFAIRARRKVATEKDFLQA 424
            EAG+ A+R  R V  + D  +A
Sbjct: 391 QEAGLRAVRKNRYVILQSDLEEA 413

>TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {ON}
           Anc_5.486 YDR394W
          Length = 429

 Score =  249 bits (636), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
            M V + R    +   LPP  D S++++   EKPDVTY+DVGG   Q  ++RE VELPL+
Sbjct: 135 SMSVALHRHSNALVDILPPDSDSSISILGSGEKPDVTYADVGGLDMQKQEIREAVELPLV 194

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
             + +  +GIDPP G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 195 QADLYEQIGIDPPSGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 254

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 255 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 314

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 387
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 315 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSL 372

Query: 388 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 424
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 IIRNDSLSGATIAAIMQEAGLRAVRKNRYVILQNDLEEA 411

>KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {ON}
           Anc_5.486 YDR394W
          Length = 425

 Score =  249 bits (636), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL 
Sbjct: 131 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLT 190

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
             + +  +G+DPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 191 QADLYEQIGVDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 250

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 251 VRDVFRLARENAPAIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 310

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 387
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 311 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFSTIAGKMSL--APETDLDSL 368

Query: 388 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 424
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 369 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 407

>AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR394W (RPT3)
          Length = 472

 Score =  250 bits (639), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 131/259 (50%), Positives = 170/259 (65%), Gaps = 3/259 (1%)

Query: 165 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 224
           LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 189 LPPDSDSSISIMGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 248

Query: 225 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 284
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 249 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 308

Query: 285 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 344
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 309 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 368

Query: 345 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 402
           RPGR+DRK+EF SL D   R  IF   +  MS+   +  + LI R  P S GA + ++  
Sbjct: 369 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 427

Query: 403 EAGMFAIRARRKVATEKDF 421
           EAG+ A+R  R V  + D 
Sbjct: 428 EAGLRAVRKNRYVILQSDL 446

>Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  248 bits (634), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 136/293 (46%), Positives = 179/293 (61%), Gaps = 8/293 (2%)

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
            M V + R    +   LPP  D S+++M   EKPDV+Y+DVGG   Q  ++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGESEKPDVSYADVGGLDMQKQEIREAVELPLV 193

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 387
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 388 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVE---KVINGYKKF 435
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A     K  N   KF
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKF 424

>SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  248 bits (632), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 170/262 (64%), Gaps = 3/262 (1%)

Query: 165 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 224
           LPP  D S+++M   EKPDVTY+DVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGSGEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 225 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 284
           LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 266

Query: 285 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 344
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 326

Query: 345 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 402
           RPGR+DRK+EF SL D   R  IF   +  MS+      + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 385

Query: 403 EAGMFAIRARRKVATEKDFLQA 424
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {ON}
           Anc_5.486 YDR394W
          Length = 432

 Score =  248 bits (633), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 181/296 (61%), Gaps = 5/296 (1%)

Query: 132 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 191
            +VV +   +    ++  M V + R    +   LPP  D S+ +M   EKPDVTY+DVGG
Sbjct: 121 NYVVRILSTLDREQLKPSMSVALHRHSNALVDILPPDSDSSIAVMGENEKPDVTYADVGG 180

Query: 192 CKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 251
              Q  ++RE VELPL   + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIR
Sbjct: 181 LDMQKQEIREAVELPLTQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIR 240

Query: 252 VIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTM 311
           V GSE V KY+GEG RMVR++F +AR     IIF DE+                EVQR +
Sbjct: 241 VNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRIL 300

Query: 312 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIH 370
           +EL+TQ+DGFD   N+KV+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   
Sbjct: 301 IELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTV 360

Query: 371 SKSMSVERGIRWELISRLCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 424
           +  M++      +L S +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 361 AAKMAL--APEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 414

>TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.486
           YDR394W
          Length = 426

 Score =  240 bits (613), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 176/279 (63%), Gaps = 5/279 (1%)

Query: 149 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLL 208
            M V + R    +   LPP  D S+++M+  EKPDVTY+DVGG   Q  ++RE VELPL 
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISIMSENEKPDVTYADVGGLDMQKQEIREAVELPLT 191

Query: 209 SPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 268
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 269 VRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 328
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 329 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWELISR 387
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APETDLDSL 369

Query: 388 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 424
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  238 bits (608), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 130/262 (49%), Positives = 172/262 (65%), Gaps = 3/262 (1%)

Query: 165 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 224
           LPP  D S+++M+  EKPDV+YSDVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMSANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 225 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 284
           LLYGPPGTGKT+  +AVAN T+  FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNVAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 285 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 344
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSINVKVIMATNRADTLDPALL 326

Query: 345 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 402
           RPGR+DRK+EF SL D   R  IF   +  M++   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTVAAKMALAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 403 EAGMFAIRARRKVATEKDFLQA 424
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7.288
           YDL126C
          Length = 852

 Score =  207 bits (526), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 214 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 273

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 274 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 329

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 330 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAA 389

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 390 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 440

 Score =  180 bits (456), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 137/241 (56%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 474 NPSALRETVVENVNVTWDDIGGLDDIKNELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 533

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 534 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 593

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 594 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 653

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 654 DQLIYVPLPDEVARESILSAQLRKSPIEPGVDLTAIAKATKGFSGADLSYIAQRAAKFAI 713

Query: 410 R 410
           +
Sbjct: 714 K 714

>TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  206 bits (525), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLAEDVDLESLASETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 145/254 (57%), Gaps = 4/254 (1%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I +   +   +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSIMKAQLRKAPLEPGLDLNAISKATQGFSGADLSYIVQRAAKFAI 709

Query: 410 R----ARRKVATEK 419
           +    A+R++  +K
Sbjct: 710 KDSIEAQRQLEAKK 723

>NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288
          Length = 601

 Score =  202 bits (515), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 43  DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 102

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 103 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 158

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN +DPAL R GR DR+V+  +PD  
Sbjct: 159 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNAIDPALRRFGRFDREVDIGIPDAV 218

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I RIH+K+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 219 GRLEILRIHTKNMKLADDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 269

 Score =  178 bits (451), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 141/250 (56%), Gaps = 1/250 (0%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  E   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 303 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 362

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 363 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 422

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 423 -DSIAKARGGSMGEGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 481

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     ++  +E G+   LI++     +GA+L  +   A  FAI
Sbjct: 482 DQLIYVPLPDEVARLSILHAQLRNTPLEPGLDLSLIAKASQGFSGADLSYIVQRAAKFAI 541

Query: 410 RARRKVATEK 419
           +   +   E+
Sbjct: 542 KESIEAQVER 551

>TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON}
           Anc_7.288 YDL126C
          Length = 847

 Score =  205 bits (522), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           D+ Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 217 DIGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLIYGPPGTGKTLMARAVA 276

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 277 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 332

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 333 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAT 392

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 393 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 443

 Score =  177 bits (450), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 139/241 (57%), Gaps = 2/241 (0%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  +   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 477 NPSALRETVVENVNVTWDDIGGLDDIKSELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 536

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 537 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 596

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ LDPA+LRPGR+
Sbjct: 597 DSIAKARGHNAGDDASD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQLDPAILRPGRL 654

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 655 DQLIYVPLPDEVARLSILKAQLRKSPLEPGVDLTAIAKATKGFSGADLSYIAQRAAKYAI 714

Query: 410 R 410
           +
Sbjct: 715 K 715

>KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126C CDC48 ATPase in ER nuclear membrane
           and cytosol with homology to mammalian p97 in a complex
           with Npl4p and Ufd1p participates in retrotranslocation
           of ubiquitinated proteins from the ER into the cytosol
           for degradation by the proteasome
          Length = 830

 Score =  205 bits (521), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD+ 
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGVPDVT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEKLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  185 bits (469), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 140/241 (58%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  E  D+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD  GR +I     ++  +E G+  + I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDETGRLSILSAQLRNTPLEPGLDLKTIAQATQGFSGADLLYIVQRAAKFAI 709

Query: 410 R 410
           +
Sbjct: 710 K 710

>SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 842

 Score =  205 bits (521), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPSIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  180 bits (457), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 145/255 (56%), Gaps = 4/255 (1%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG     ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDGIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I +   ++  +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDDTARLSILKAQLRNTPLEPGLDLGAISKATQGFSGADLSYIAQRAAKFAI 709

Query: 410 R----ARRKVATEKD 420
           +    A+R+   E++
Sbjct: 710 KDSIEAQRRAQIERE 724

>NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON} 
          Length = 825

 Score =  204 bits (519), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 270

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEVLRIHTKNMKLADDVDLEYIASETHGYVGADIASLCSEAAMQQIREK 437

 Score =  180 bits (457), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 138/241 (57%), Gaps = 2/241 (0%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  E   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDIGGLDEIKQELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 530

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARASAPTVVFLDEL 590

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 --DSIAKARGNSAGDNGSDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLNAIAKAAQGFSGADLSYIVQRAAKFAI 708

Query: 410 R 410
           +
Sbjct: 709 K 709

>KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  204 bits (520), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  179 bits (453), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILGAQLRNTPLEPGLDLTAIAKATTGFSGADLSYIAQRAAKYAI 709

Query: 410 R 410
           +
Sbjct: 710 K 710

>KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 832

 Score =  204 bits (519), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 144/254 (56%), Gaps = 4/254 (1%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELSTIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 410 R----ARRKVATEK 419
           +    A+R+   E+
Sbjct: 710 KDSIEAQRRALAEQ 723

>NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {ON} 
          Length = 842

 Score =  204 bits (519), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 216 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 275

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 276 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 331

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 332 TNGEVERRVVSQLLTLMDGMKTRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAV 391

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I RIH+K+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 392 GRLEILRIHTKNMKLSDDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 442

 Score =  184 bits (468), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 141/250 (56%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  E   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 476 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 535

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 536 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 595

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 596 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 655

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 656 DQLIYVPLPDEIARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 715

Query: 410 RARRKVATEK 419
           +   +   EK
Sbjct: 716 KESIEAQKEK 725

>NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {ON}
           Anc_7.288
          Length = 825

 Score =  203 bits (517), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLADDVDLEYLANETHGYVGADIASLCSEAAMQQIREK 435

 Score =  184 bits (468), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 142/241 (58%), Gaps = 2/241 (0%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT++D+GG  E   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWNDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 528

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGNSMGDGGSD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD E R +I R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEEARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 706

Query: 410 R 410
           +
Sbjct: 707 K 707

>Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  204 bits (518), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 146/231 (63%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (465), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 96/263 (36%), Positives = 145/263 (55%), Gaps = 4/263 (1%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ DVGG  E  D+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 410 R----ARRKVATEKDFLQAVEKV 428
           +    A R+   EK+     E V
Sbjct: 710 KDSIEAHRQHEAEKEVKAEGEDV 732

>Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL126C
           (CDC48) - microsomal ATPase [contig 12] FULL
          Length = 831

 Score =  203 bits (517), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  181 bits (459), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELTSIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 410 R 410
           +
Sbjct: 710 K 710

>Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON}
           complement(19429..21867) [2439 nt, 813 aa]
          Length = 812

 Score =  203 bits (516), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 202 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 261

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 262 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 317

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 318 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 377

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 378 GRLEVLRIHTKNMKLADDVDLESIAAETHGFVGADIASLCSEAAMQQIREK 428

 Score =  179 bits (455), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 143/251 (56%), Gaps = 3/251 (1%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 462 NPSALRETVVENVNVTWDDIGGLDEIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 521

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 522 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 581

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 582 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 638

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 639 DQLIYVPLPDETARLSILKAQLRKSPLEPGLDLNAIAKSTQGFSGADLSYIAQRAAKFAI 698

Query: 410 RARRKVATEKD 420
           +   +   E++
Sbjct: 699 KDSIQANIERE 709

>Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  202 bits (515), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (458), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 137/241 (56%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 410 R 410
           +
Sbjct: 710 K 710

>KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7.288
           YDL126C
          Length = 824

 Score =  202 bits (515), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEILRIHTKNMKLADDVDLETLAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  180 bits (457), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ DVGG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDDIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     ++  +E G+    IS+     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILNAQLRNTPLEPGLDLSAISKATQGFSGADLSYIVQRAAKYAI 709

Query: 410 R 410
           +
Sbjct: 710 K 710

>YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}
           CDC48AAA ATPase involved in multiple processes; subunit
           of a polyubiquitin-selective segregase complex involved
           in ERAD, cell wall integrity during heat stress and
           mitotic spindle disassembly; subunit of a complex
           involved in mitochondria-associated degradation; role in
           mobilizing membrane bound transcription factors by
           regulated ubiquitin/proteasome-dependent processing;
           roles in macroautophagy, PMN, ribophagy, and homotypic
           ER membrane fusion; functional ortholog of p97/VCP
          Length = 835

 Score =  202 bits (515), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (459), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 410 R----ARRKVATEKD 420
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to
           Ashbya gossypii AFR158W
          Length = 836

 Score =  202 bits (515), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I  IH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILHIHTKNMRLADDVNLETLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  184 bits (467), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 145/254 (57%), Gaps = 4/254 (1%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ DVGG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD  GR +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEVGRISILKAQLRKAPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 410 R----ARRKVATEK 419
           R    A+++ A EK
Sbjct: 711 RDSIEAQKRSAAEK 724

>Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON}
           YDL126C (REAL)
          Length = 836

 Score =  202 bits (515), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (459), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 95/263 (36%), Positives = 145/263 (55%), Gaps = 4/263 (1%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGMELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 410 R----ARRKVATEKDFLQAVEKV 428
           +    A R+   EK+     E V
Sbjct: 710 KDSIEAHRQREAEKEVKAEGEDV 732

>AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL126C (CDC48)
          Length = 832

 Score =  202 bits (515), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I  IH+K+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILNIHTKNMRLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 138/241 (57%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ DVGG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD  GR +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEAGRMSILKAQLRKAPLEPGLDLGAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 410 R 410
           R
Sbjct: 711 R 711

>CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa]
           {ON} highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126c CDC48
          Length = 830

 Score =  202 bits (515), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  180 bits (456), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKYAI 709

Query: 410 R 410
           +
Sbjct: 710 K 710

>ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 830

 Score =  202 bits (514), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 146/255 (57%), Gaps = 4/255 (1%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +V+++DVGG +E  ++LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVSWADVGGLEEIKEELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R  I +   +   +E G+    ++++    +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEAARLGIMKAQLRKTPLEPGLELSQLAKVTQGFSGADLSYIVQRAAKFAI 709

Query: 410 R----ARRKVATEKD 420
           +    A R+   +K+
Sbjct: 710 KDSIEAHRQAEAKKE 724

>Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {ON}
           complement(25249..27720) [2472 nt, 824 aa]
          Length = 823

 Score =  201 bits (512), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLVDDVDLESLAAETHGYVGADIASLCSEAAMQQIREK 435

 Score =  180 bits (456), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 145/254 (57%), Gaps = 3/254 (1%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG ++  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWDDIGGLEDIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 528

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILNAQLRKTPLEPGLDLGAIAKTTQGFSGADLSYIVQRAAKFAI 708

Query: 410 RAR---RKVATEKD 420
           +     ++V +E+D
Sbjct: 709 KESIEAQRVKSEED 722

>TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {ON}
           Anc_7.288 YDL126C
          Length = 826

 Score =  201 bits (511), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F A+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 243 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX 302
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 303 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 362 GRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  + RIH+K+M +   +  E ++       GA++ S+C+E  M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLSDDVDLETLAAETHGYVGADIASLCSEGAMQQIREK 436

 Score =  180 bits (456), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 96/260 (36%), Positives = 145/260 (55%), Gaps = 12/260 (4%)

Query: 170 DPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGP 229
           +PS    TV E  +VT+ D+GG  E   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKRELRETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 230 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEI 289
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 290 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 349
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 350 DRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           D+ +   LPD  GR +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEVGRLSILEAQLRKSPLEPGLDLRAIAKASQGFSGADLSYIAQRAAKFAI 706

Query: 410 R---------ARRKVATEKD 420
           +           +KV +E+D
Sbjct: 707 KDSIEAHKLAESKKVKSEED 726

>NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34
          Length = 1329

 Score =  194 bits (492), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 109/279 (39%), Positives = 158/279 (56%), Gaps = 25/279 (8%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 393 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 452

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 453 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 512

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 513 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 569

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 409
           PDL+ RA I +IH+K  +      + E +++L     GA+LR++CTEA +F+I       
Sbjct: 570 PDLKARAKILQIHTKKWNPPLDPEFIENLAKLTKGYGGADLRALCTEAALFSIQRKFPQI 629

Query: 410 -RARRKVATE--------KDFLQAVEKVINGYKKFSSTS 439
            R+  K+  +         DF+ A+EK++    + S  S
Sbjct: 630 YRSSEKLQVDPKLVRVHTTDFMLALEKIVPSSARSSGNS 668

>ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1420

 Score =  191 bits (486), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 157/269 (58%), Gaps = 25/269 (9%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V + DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 432 NVKFEDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 491

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+ ++  +IFFDEI        
Sbjct: 492 ASCSSEGRKITFFMRKGADVLSKWVGEAERQLRLLFEEAKKQQPSVIFFDEIDGLAPVRS 551

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 552 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 608

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 409
           PD+ GR  I +IH+K+      +++ + ++ L     GA+LR++CTEA + +I       
Sbjct: 609 PDVRGREKIIKIHTKNWKPPLSVKFVQNLATLTKGFGGADLRALCTEAALLSIQRQYPQI 668

Query: 410 -RARRKVATE--------KDFLQAVEKVI 429
            R+  K+A +        KDF+ A++K++
Sbjct: 669 YRSNEKLAVDPNKVKVGVKDFMMALKKIV 697

>Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {OFF}
           YDR394W (RPT3) - ATPase (AAA family) component of the
           26S proteasome complex [contig 189] PARTIAL
          Length = 302

 Score =  179 bits (453), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 107/156 (68%)

Query: 165 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGI 224
           LPP  D S+++M   EKPDV+YSDVGG   Q  ++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYRQIGIDPPRGV 206

Query: 225 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACII 284
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 285 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 320
           F DE+                EVQR ++EL+TQ+DG
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDG 302

>KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1261

 Score =  190 bits (483), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 151/269 (56%), Gaps = 25/269 (9%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++++ DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 347 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLVARALA 406

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 407 ASCSSDSKKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 466

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ LDPAL RPGR DR+  F L
Sbjct: 467 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDALDPALRRPGRFDREFYFPL 523

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR------ 410
           PD + RA I +IH+K+        + E + ++     GA+LR++CTEA +F I+      
Sbjct: 524 PDSKARAKILKIHTKNWHPSLSDEFIENLVKMTKGYGGADLRALCTEAALFCIQRKFPQI 583

Query: 411 ----------ARRKVATEKDFLQAVEKVI 429
                      R    T  DF+ A++K++
Sbjct: 584 YRSDEKLMVNPRHLRVTLNDFILALDKIV 612

>TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5.34
           YGR270W
          Length = 1400

 Score =  189 bits (480), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/270 (37%), Positives = 154/270 (57%), Gaps = 27/270 (10%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + DVGG    ID+L+E++ LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 429 NINFDDVGGLDNYIDQLKEMITLPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 488

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 489 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 548

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 549 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 605

Query: 358 PDLEGRANIFRIHSKSMS--VERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR--- 412
           PD++ RA I  IH++  +  +++ +  +L + L     GA+LR++CTEA + +I+ +   
Sbjct: 606 PDIDARAKILEIHTRKWNPPLQKPVILQL-ANLTKGYGGADLRALCTEAALISIQHKYPQ 664

Query: 413 -------------RKVATEKDFLQAVEKVI 429
                        +   +  DF+ A+EK++
Sbjct: 665 IYRSNDKLDVDPSKITVSTSDFMLALEKIV 694

>KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1333

 Score =  189 bits (479), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 154/279 (55%), Gaps = 45/279 (16%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + DVGG    ID+L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 405 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 464

Query: 243 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
                 +   TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 465 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 524

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 525 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 581

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWE------LISRLCPNST---GAELRSVCTEAGMFA 408
           PDL  R+ I  IH+K        +W+       I RL   +    GA+LR++CTEA + +
Sbjct: 582 PDLSARSKILEIHTK--------KWDPPLPKPFIDRLASLTKGYGGADLRALCTEAALIS 633

Query: 409 IRARRKV------------------ATEKDFLQAVEKVI 429
           I  +RKV                     +DF+ A+EK++
Sbjct: 634 I--QRKVPQIYQSEMKLSINLASVNVKARDFMMALEKIV 670

>NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {ON}
           Anc_5.34
          Length = 1348

 Score =  189 bits (479), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 106/279 (37%), Positives = 157/279 (56%), Gaps = 25/279 (8%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++++ DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQTFNITPPRGVLFHGPPGTGKTLMARALA 470

Query: 243 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
                +    TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 471 ASCSSDSQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 530

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 587

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 409
           PD + R+ I +IH+K  +      + + ++ L     GA+LR++CTEA +F I       
Sbjct: 588 PDEKARSKILKIHTKKWNPPLSDDFIDNLATLTKGYGGADLRALCTEAALFCIQRKFPQI 647

Query: 410 -RARRKV--------ATEKDFLQAVEKVINGYKKFSSTS 439
            R+  K+         T  DF+ A+EK++    + + +S
Sbjct: 648 YRSNEKLLVDPKDLKVTPTDFMLALEKIVPSSARSTGSS 686

>TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1294

 Score =  189 bits (479), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 142/236 (60%), Gaps = 9/236 (3%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 372 NVKFGDIGGLDNFIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 431

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 432 ASCSSEGHKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPAIIFFDEIDGLAPVRS 491

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 492 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 548

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           P+LE RA I RIH+KS        + + ++ L     GA+LR++CTEA + +I+ +
Sbjct: 549 PNLESRAQILRIHTKSWKTSLSDDFVKHLALLTKGYGGADLRALCTEAALLSIQRK 604

>ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 727

 Score =  186 bits (473), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 102/264 (38%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V++ DV GC E   ++ E V   L  PE++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 251 VSFQDVAGCNEAKQEIMEFVHF-LKKPEKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 309

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
                F+ V GSE V+ +VG GA  VR++FE AR     IIF DEI              
Sbjct: 310 EAGVPFLSVSGSEFVEMFVGVGASRVRDMFEQARQMAPSIIFVDEIDAIGKERGKGGAMG 369

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR V+   PD+E
Sbjct: 370 GANDEREATLNQLLVEMDGFSTSDQVVVLAGTNRPDVLDPALMRPGRFDRHVQIDSPDIE 429

Query: 362 GRANIFRIHSKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I+ +H   +++         +R +    ++ L P   GA++ + C EA + A R +
Sbjct: 430 GRKAIYLVHLHDLNLAPEYTESKEQRELLAGKLAALTPGFAGADISNACNEAALIAARRQ 489

Query: 413 RKVATEKDFLQAVEKVINGYKKFS 436
               T K F QA+E+VI G +K S
Sbjct: 490 AAHVTLKHFEQAIERVIAGLEKKS 513

>Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii AAR025C
          Length = 747

 Score =  186 bits (473), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 148/264 (56%), Gaps = 12/264 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E   ++ E V   L +P+++ ALG   P+G +L G PGTGKTL ARA A 
Sbjct: 271 VNFKDVAGCDEAKMEIMEFVHF-LKNPDKYKALGAQIPRGAILSGAPGTGKTLLARATAG 329

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 330 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 389

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 390 GSNDEREATLNQLLVEMDGFTARDQIVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 449

Query: 362 GRANIFRIHSKSMSVERGIRWEL---------ISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I+R+H   ++++  ++            ++ L P  +GA++ + C EA + A R +
Sbjct: 450 GRKAIYRVHLPRLNLQPALKTSTLDLDSFAGRLAALTPGFSGADIANACNEAALIAARHQ 509

Query: 413 RKVATEKDFLQAVEKVINGYKKFS 436
            +    K F QA+E+VI G +K S
Sbjct: 510 DEYVELKHFEQAIERVIAGLEKKS 533

>TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1426

 Score =  188 bits (478), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 153/269 (56%), Gaps = 25/269 (9%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 NINFDDVGGLDNYIDQLKEMVSLPLLYPELYQNFNISPPRGVLFHGPPGTGKTLMARALA 495

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 496 ASCSSDDRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKNQPSIIFFDEIDGLAPVRS 555

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 556 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 612

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 409
           PDLE R  I  IH+K  +      + + ++RL     GA+LR++CT+A + +I       
Sbjct: 613 PDLEAREKIIGIHTKKWNPPLSSEFRKTLARLTKGFGGADLRALCTDAVLISIQRQYPQI 672

Query: 410 -RARRKVATE--------KDFLQAVEKVI 429
            R+ +K+  +         DF+ A+EK+I
Sbjct: 673 YRSNKKLKIDPTSVKININDFMIALEKLI 701

>KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {ON}
           Anc_7.168 YER017C
          Length = 713

 Score =  186 bits (471), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 148/261 (56%), Gaps = 9/261 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V++ DV GC E   ++ E V   L +P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 237 VSFKDVAGCNEAKQEIMEFVHF-LKNPKKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 295

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXX--XX 301
                F+ V GSE V+ +VG GA  VR+LFE AR+    IIF DEI              
Sbjct: 296 EAAVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSLAPSIIFVDEIDAIGKERGKGGPLG 355

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 356 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDSPDIT 415

Query: 362 GRANIFRIHSKSMSVERGIRWE------LISRLCPNSTGAELRSVCTEAGMFAIRARRKV 415
           GR  I+ +H + ++++  +  +       ++ L P  TGA++ + C EA + A R +   
Sbjct: 416 GRKQIYLVHLERLNLQEKLALDRENLAGKLATLTPGFTGADIANACNEAALIAARHKDAT 475

Query: 416 ATEKDFLQAVEKVINGYKKFS 436
            T   F QA+E+VI G +K S
Sbjct: 476 ITLDHFEQAIERVIAGLEKKS 496

>KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 739

 Score =  186 bits (472), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 147/263 (55%), Gaps = 11/263 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E   ++ E V   L  P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VNFKDVAGCNEAKAEIMEFVHF-LQKPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXX--XXXXXX 301
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 383

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 384 GANDEREATLNQLLVEMDGFGTNDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 443

Query: 362 GRANIFRIHSKSMSV--------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARR 413
           GR  I+++H K +++        E+ +    ++ L P   GA++ + C EA + A R ++
Sbjct: 444 GRKAIYQVHLKKLNLSPRYASPGEKEMLAGKLAALTPGFAGADIANACNEAALIAARYKK 503

Query: 414 KVATEKDFLQAVEKVINGYKKFS 436
                 +F QA+E+VI G +K S
Sbjct: 504 PFVELANFEQAIERVIAGLEKKS 526

>KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1319

 Score =  188 bits (477), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 154/271 (56%), Gaps = 29/271 (10%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 400 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 459

Query: 243 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 460 ASCSNEKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPAIIFFDEIDGLAPVRS 519

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  TML L   +DG D RG I ++ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 520 SKQEQIHASIVSTMLAL---MDGMDNRGQIIIIGATNRPDAVDPALRRPGRFDREFYFPL 576

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAI----- 409
           PDL+ R  I  IH+K  +    I  + IS+L   +    GA+LR++CTEA + +I     
Sbjct: 577 PDLKARDKILHIHTKKWNPP--ISDQFISKLASLTKGYGGADLRALCTEASLISIQRKFP 634

Query: 410 ---RARRKVATE--------KDFLQAVEKVI 429
              ++  K+  +        +DF+ A+EK++
Sbjct: 635 QIYKSEEKLKIDPKSVRVKARDFMLALEKIV 665

>KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1408

 Score =  188 bits (477), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 156/271 (57%), Gaps = 29/271 (10%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ ++DVGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 445 NINFNDVGGLDSYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 504

Query: 243 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXX 296
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  IIFFDEI       
Sbjct: 505 ASCSTENRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 563

Query: 297 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 356
                     +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 564 SSKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 620

Query: 357 LPDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 409
           LPD + RA I  IH+K         + + ++RL     GA+LRS+CTEA +  I      
Sbjct: 621 LPDEKARARILTIHTKKWDPPLTEEFLQNLARLTKGYGGADLRSLCTEAALLCIQRNFPQ 680

Query: 410 -----------RARRKVATEKDFLQAVEKVI 429
                      +++ KV T KDF+ A++K++
Sbjct: 681 IYRSDEKLVVDKSKLKVNT-KDFILALQKIV 710

>Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON}
           (53678..57811) [4134 nt, 1378 aa]
          Length = 1377

 Score =  188 bits (477), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 107/270 (39%), Positives = 158/270 (58%), Gaps = 27/270 (10%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           D+ + +VGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 DINFEEVGGLDNYIDQLKEMVTLPLLYPEVYQNFNITPPRGVLFHGPPGTGKTLMARALA 495

Query: 243 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXX 296
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  IIFFDEI       
Sbjct: 496 ASCSTGNRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 554

Query: 297 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 356
                   + +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 555 SSKQEQIHSSIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 611

Query: 357 LPDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 409
           LPD++ R+ I  IH+K  +     +  + ++RL     GA+LRS+CTEA + +I      
Sbjct: 612 LPDVKARSIILGIHTKKWNPPPNKKLIDDLARLTKGYGGADLRSLCTEAALISIQRKFPQ 671

Query: 410 --RARRKVATEK--------DFLQAVEKVI 429
             ++ +K+  +         DF+ A+EK++
Sbjct: 672 IYKSEQKLMVDPTKIRVSYGDFMLALEKIV 701

>ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR270W (YTA7)
          Length = 1270

 Score =  187 bits (474), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 150/268 (55%), Gaps = 25/268 (9%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + D+GG    ID+L+E+V LPLL PE +    I PP+G+L YGPPGTGKTL ARA+A
Sbjct: 366 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFYGPPGTGKTLMARALA 425

Query: 243 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 426 ASCSTEKRKITFYMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 485

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 486 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 542

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRAR---- 412
           PD+  RA I  IH++         + E ++ L     GA+LR++CTEA + +I+ R    
Sbjct: 543 PDIRARAKILEIHTRKWHPPVSSAFIEKLASLTKGYGGADLRALCTEAALNSIQRRFPQY 602

Query: 413 ---RKVATE---------KDFLQAVEKV 428
               +V  +         KDF+ A+EK+
Sbjct: 603 IKVSQVGNKPKGKCQVKAKDFMIAMEKI 630

>Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {ON}
           similar to Ashbya gossypii ABR139W
          Length = 1339

 Score =  186 bits (473), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 151/269 (56%), Gaps = 27/269 (10%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 419 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 478

Query: 243 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
                ++   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 479 VSCSTDKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 538

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 539 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 595

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRARR--- 413
           PD   RA I  IH+K  +      + E ++ L     GA+LR++CTEA + +I+ +    
Sbjct: 596 PDTSARAKILEIHTKKWNPPLPKEFIEKLASLTKGYGGADLRALCTEAALVSIQRKFPQI 655

Query: 414 --------------KVATEKDFLQAVEKV 428
                         KV T KDF+ A++K+
Sbjct: 656 YQSESKLVINPKDVKVKT-KDFMAAMDKI 683

>AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER017C
           (AFG3)
          Length = 726

 Score =  184 bits (467), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           + + DV GC E   ++ E V+  L +PE++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 248 IKFKDVAGCDEAKMEIMEFVDF-LKTPEKYRALGAQIPRGAILSGPPGTGKTLLAKATAG 306

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXX--XXXXXXXXXX 301
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 307 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKARGKGGEMG 366

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 367 GSNDEREATLNQLLVEMDGFTSRDQIVVIAGTNRPDVLDPALLRPGRFDRHIQVDAPDVE 426

Query: 362 GRANIFRIHSKSMSVERGIRWE---------LISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I+++H   ++++  ++            ++ L P   GA++ + C EA + A R  
Sbjct: 427 GRKAIYKVHLSKLNLDPSLKTTPDTLDNFAGKLAALTPGFAGADISNACNEAALIAARHN 486

Query: 413 RKVATEKDFLQAVEKVINGYKKFS 436
                 + F QA+E+VI G +K S
Sbjct: 487 DAFVEFRHFDQAIERVIAGLEKKS 510

>KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa]
           {ON} Anc_4.259 YLR397C
          Length = 772

 Score =  184 bits (467), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/262 (38%), Positives = 146/262 (55%), Gaps = 6/262 (2%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           + PS       E P V +SD+GG  E   KL+E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 VRPSAMREIFLEMPKVYWSDIGGQDELKRKLKEMIQLPLDASETFARLGVSAPKGVLLYG 549

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 550 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDGESTSAANHV---LTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 407
           +DR +    PD + R  I R  +   ++E  G+  E +++     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVGPPDYDARLQILRKCTSKFNIESSGVDLEALAQKTDGCSGAEVVLLCQEAGLA 726

Query: 408 AIRARRKVATEKDFLQAVEKVI 429
           +I     V TEK   +  EK +
Sbjct: 727 SI--MENVETEKVSTEHFEKAL 746

 Score =  164 bits (415), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/231 (38%), Positives = 129/231 (55%), Gaps = 6/231 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           VTY+ VGG   +I+ L+  +ELPL  P+ F   G+ PP+GI+L+GPPGTGKT+  R VA+
Sbjct: 236 VTYNSVGGLFSEIEILKNTIELPLRQPQLFTDFGVTPPRGIMLHGPPGTGKTMILRCVAH 295

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
            T+A  + + G  +V KY+GE    +R++F  A   +  I+F DEI              
Sbjct: 296 STNAHVLTIDGPSIVSKYLGETEATLRDIFNEAVKYQPSIVFIDEIDSIAPNRANDDSGE 355

Query: 304 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 363
                R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R
Sbjct: 356 AE--SRVVATLLTLMDGMGASGKVVVIGATNRPNSVDPALRRPGRFDQEVEIGIPDAEAR 413

Query: 364 ANIFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 410
            +I     + MS +R    E     I+       GA+L ++C EA M  I+
Sbjct: 414 LDILHKQFQRMSSDRQELTEEDIKTIASKTHGYVGADLSALCREAVMKTIQ 464

>Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON}
           complement(5130..7490) [2361 nt, 787 aa]
          Length = 786

 Score =  184 bits (467), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 149/264 (56%), Gaps = 12/264 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           +++ DV GC E   ++ E V   L +P+R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 301 ISFKDVAGCAEAKQEIMEFVHF-LKNPQRYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 359

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
                F+ V GSE V+ +VG GA  VR+LFE AR+    IIF DEI              
Sbjct: 360 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSMSPSIIFIDEIDAIGKERGKGGALG 419

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR +E   PD+E
Sbjct: 420 GANDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDPALMRPGRFDRHIEIDPPDVE 479

Query: 362 GRANIFRIHSKSMSVE------RGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR +I+ +H   ++++      +  + EL   ++ L P   GA++ + C EA + A R  
Sbjct: 480 GRKSIYLVHLSKLNLDPIFTETKEAKDELAGKLAALTPGFAGADIANACNEAALIAARYN 539

Query: 413 RKVATEKDFLQAVEKVINGYKKFS 436
            K    + F QA+E+VI G +K S
Sbjct: 540 DKYVELRHFEQAIERVIAGLEKKS 563

>Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {ON}
           YMR089C (REAL)
          Length = 824

 Score =  184 bits (468), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 344 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 402

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 403 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 462

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 463 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 522

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF +H   + +  GI ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 523 RKAIFAVHLHHLKLAGGI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 581

Query: 420 DFLQAVEKVINGYKKFS 436
            F QA+E+VI G ++ S
Sbjct: 582 HFEQAIERVIGGVERKS 598

>SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1337

 Score =  185 bits (469), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/236 (41%), Positives = 141/236 (59%), Gaps = 9/236 (3%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++++ +VGG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 387 NISFENVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 446

Query: 243 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 447 ASCSTEQRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 506

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 507 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 563

Query: 358 PDLEGRANIFRIHSKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           PDL+ R+ I +IH+K        +  E ++ L     GA+LR++CTEA + +I+ +
Sbjct: 564 PDLKARSKILQIHTKEWKPPLSQVFVEKLASLTKGYGGADLRALCTEAALISIQRK 619

>Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {ON}
           YGR270W (YTA7) - 26S proteasome ATPase [contig 1] FULL
          Length = 1329

 Score =  184 bits (468), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 154/279 (55%), Gaps = 45/279 (16%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + DVGG    ID+L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 470

Query: 243 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
                 +   TF    G++++ K+VGE  R +R LF+ A+ ++  IIFFDEI        
Sbjct: 471 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFDEAKKQQPSIIFFDEIDGLAPVRS 530

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 587

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW------ELISRLCPNST---GAELRSVCTEAGMFA 408
           P LE R+ I  IH+K        +W        IS+L   +    GA+LR++CTEA + +
Sbjct: 588 PGLEARSKILTIHTK--------KWNPPLPNHFISKLASLTKGYGGADLRALCTEAALIS 639

Query: 409 IRARRKV------------------ATEKDFLQAVEKVI 429
           I  +RK+                     +DF+ A+EK++
Sbjct: 640 I--QRKLPQIYQSDIKLHIDPSTVNVKARDFMLALEKIV 676

>Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON}
           YGR270W (REAL)
          Length = 1389

 Score =  184 bits (468), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 140/234 (59%), Gaps = 9/234 (3%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 415 NIDFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 474

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 475 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 534

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 535 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 591

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 410
           PD++ R+ I +I ++  S    I + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 592 PDVKARSKILQIQTRKWSAPLSINFIDKLAFLTKGYGGADLRSLCTEAALISIQ 645

>Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR270W
           (REAL)
          Length = 1386

 Score =  184 bits (468), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 95/234 (40%), Positives = 140/234 (59%), Gaps = 9/234 (3%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 413 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 472

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+  +  +IFFDEI        
Sbjct: 473 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSVIFFDEIDGLAPVRS 532

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 533 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 589

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 410
           PD++ R+ I +I +K  S    + + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 590 PDVKARSKILQIQTKKWSSPLSVNFVDKLAILTKGYGGADLRSLCTEAALISIQ 643

>Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C
           (YTA12) - mitochondrial membrane ATPase of the
           CDC48/PAS1/SEC18 (AAA) family [contig 55] FULL
          Length = 814

 Score =  183 bits (464), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           VT+ DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 341 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 399

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 400 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 459

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 460 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 519

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF++H   + +   I  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 520 RKQIFQVHLSKIKLAGSID-DLKNRLAALTPGFSGADISNVCNEAALTAARCECTSVKLE 578

Query: 420 DFLQAVEKVINGYKKFS 436
            F QA+E+VI G ++ S
Sbjct: 579 HFEQAIERVIGGVERKS 595

>CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {ON}
           similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270w YTA7
          Length = 1317

 Score =  184 bits (468), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 152/271 (56%), Gaps = 29/271 (10%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 392 NIKFDDVGGLDNYIEQLKEMVSLPLLYPEVYQKFNITPPRGVLFHGPPGTGKTLMARALA 451

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 452 ASCSSESRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 511

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 512 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 568

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAI----- 409
           PD   R  I +IH+K  S    +  ELI RL   +    GA+LR++CTEA + +I     
Sbjct: 569 PDTNARKTILKIHTKKWSP--PLSDELIHRLASLTKGYGGADLRALCTEAALSSIQRTYP 626

Query: 410 ---RARRKV--------ATEKDFLQAVEKVI 429
              R+  K+            DF +A+EK++
Sbjct: 627 QIYRSSGKLLIDTDLIRVNSSDFTRALEKIV 657

>TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {ON}
           Anc_2.472 YMR089C
          Length = 835

 Score =  183 bits (464), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 146/265 (55%), Gaps = 6/265 (2%)

Query: 176 MTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKT 235
              E    + ++DV GC E  +++ E V+  L  P R+  +G   P+G +L GPPGTGKT
Sbjct: 341 FNTETAVQIRFNDVAGCDEAKEEIMEFVDF-LKQPSRYEKMGAKIPRGAILSGPPGTGKT 399

Query: 236 LCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXX 295
           L A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI      
Sbjct: 400 LLAKATAGEAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTAKENAPSIVFIDEIDAIGKA 459

Query: 296 XXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 354
                    N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR V 
Sbjct: 460 RQKGNFSGANDERENTLNQLLVEMDGFSSTDHIVVLAGTNRPDILDRALLRPGRFDRHVN 519

Query: 355 FSLPDLEGRANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRA 411
             LP+LEGR  IF +H K + +  G  ++L +RL    P  +GA++ +VC EA + A R 
Sbjct: 520 IDLPELEGRKAIFGVHLKKIKIA-GTIYDLQNRLAALTPGFSGADISNVCNEAALIAARY 578

Query: 412 RRKVATEKDFLQAVEKVINGYKKFS 436
                    F +A+E+VI G ++ S
Sbjct: 579 NSSFVKLSHFEKAIERVIGGVERKS 603

>TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.472
           YMR089C
          Length = 816

 Score =  183 bits (464), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E  +++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 338 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 396

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     ++F DEI              
Sbjct: 397 EAGVPFFFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMVFIDEIDAIGKARQKGNISG 456

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 457 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDVLDKALLRPGRFDRHVNIDKPELSG 516

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R   K    +
Sbjct: 517 RQAIFEVHMKKIKLASDI-FDLKNRLAALTPGFSGADIANVCNEAALIAARNDAKSVRLE 575

Query: 420 DFLQAVEKVINGYKKFS 436
            F QAVE+VI G ++ S
Sbjct: 576 HFEQAVERVIGGVERKS 592

>Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2340
           bp, 779 aa] {ON} ANNOTATED BY YGOB -
          Length = 779

 Score =  182 bits (462), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 146/263 (55%), Gaps = 11/263 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E   ++ E V   L  P+++  LG   PKG +L GPPGTGKTL A+A A 
Sbjct: 297 VKFKDVAGCDEAKGEIMEFVHF-LQKPDKYRKLGAQIPKGAILSGPPGTGKTLLAKATAG 355

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 356 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 415

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 416 GANDEREATLNQLLVEMDGFTSTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQLDAPDVE 475

Query: 362 GRANIFRIHSKSMSVE----RGIRWEL----ISRLCPNSTGAELRSVCTEAGMFAIRARR 413
           GR  I+++H ++++++    R   +E     ++ L P   GA++ + C EA + A R   
Sbjct: 476 GRKAIYQVHLRNLNLDPKYIRTSEFEALAGKLAALTPGFAGADIANACNEAALIAARHSD 535

Query: 414 KVATEKDFLQAVEKVINGYKKFS 436
                + F QA+E+VI G +K S
Sbjct: 536 AFVEFRHFEQAIERVIAGLEKKS 558

>KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 813

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           VT+ DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 340 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 398

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 399 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPSIVFVDEIDAIGKARQKGNFSG 458

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 459 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 518

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF++H   + +  G   +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 519 RKQIFQVHLAKVKLA-GSMEDLKNRLAALTPGFSGADISNVCNEAALTAARNECTSVKLE 577

Query: 420 DFLQAVEKVINGYKKFS 436
            F QA+E+VI G ++ S
Sbjct: 578 HFEQAIERVIGGVERKS 594

>SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} similar
           to uniprot|P39925 Saccharomyces cerevisiae YER017C AFG3
           Component with Yta12p of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 742

 Score =  181 bits (460), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 145/263 (55%), Gaps = 11/263 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E   ++ E V   L +P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 267 VNFKDVAGCDEAKGEIMEFVHF-LKNPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 325

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 326 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 385

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 386 GANDEREATLNQLLVEMDGFSTTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQIDAPDVE 445

Query: 362 GRANIFRIHSKSMSVERGIRWE--------LISRLCPNSTGAELRSVCTEAGMFAIRARR 413
           GR  I+++H   ++++  +            ++ L P   GA++ + C EA + A R + 
Sbjct: 446 GRKAIYKVHLTRLTLDPKLSKSENIQSLAGKLAALTPGFAGADIANACNEAALIAARRKE 505

Query: 414 KVATEKDFLQAVEKVINGYKKFS 436
                K F QA+E+VI G +K S
Sbjct: 506 PYVEFKHFDQAIERVIAGLEKKS 528

>Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}
           similar to Ashbya gossypii ABL041W
          Length = 804

 Score =  182 bits (461), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VKFKDVAGCDEAKEEIMEFVSF-LKQPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 393 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 452

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 453 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALLRPGRFDRHINIDKPELEG 512

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF++H   +++   I  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 513 RKEIFKVHLSKITLAEDI-VDLENRLAALTPGFSGADIANVCNEAALVAARGDNSSVKLE 571

Query: 420 DFLQAVEKVINGYKKFS 436
            F  A+E+VI G ++ S
Sbjct: 572 HFEHAIERVIGGVERKS 588

>Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {ON}
           YMR089C (REAL)
          Length = 823

 Score =  182 bits (461), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 343 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 401

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 402 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 461

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 462 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 521

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 522 RKAIFAVHLHHIKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 580

Query: 420 DFLQAVEKVINGYKKFS 436
           +F QA+E+VI G ++ S
Sbjct: 581 NFEQAIERVIGGVERKS 597

>Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}
           complement(51934..54285) [2352 nt, 784 aa]
          Length = 783

 Score =  181 bits (460), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/261 (37%), Positives = 143/261 (54%), Gaps = 7/261 (2%)

Query: 154 VDRSKYHIELP----LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLS 209
           +DRSK  + L         I PS       E P V +SD+GG  +   K++EV++LPL +
Sbjct: 480 IDRSKLQVTLKDVENAMAEIRPSAMREIFLEMPKVYWSDIGGQDDLKRKMKEVIQLPLEA 539

Query: 210 PERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 269
            E FA LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +
Sbjct: 540 AETFANLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAI 599

Query: 270 RELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 329
           RE+F  AR     IIFFDEI                     +  L+ ++DG +    + +
Sbjct: 600 REIFRKARAASPSIIFFDEIDAISAARDGGSSTAA--ASHVLTSLLNEIDGVEELNGVVI 657

Query: 330 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE-RGIRWELISRL 388
           + ATNRP+ +DPALLRPGR+DR +  + PD E R  I +  +   ++E   +  E +++ 
Sbjct: 658 VAATNRPDEIDPALLRPGRLDRHIYVAPPDYEARLQILKKRTGKFNLEGSNVNLEELAKH 717

Query: 389 CPNSTGAELRSVCTEAGMFAI 409
               +GAE+  +C EAG+ AI
Sbjct: 718 TEGCSGAEVVLLCQEAGLAAI 738

 Score =  172 bits (437), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/230 (40%), Positives = 136/230 (59%), Gaps = 8/230 (3%)

Query: 186 YSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRT 245
           Y+DVGG K +ID L + +ELPL  P  F+  GI+PP+G+LL+GPPGTGKT+  R VAN +
Sbjct: 245 YNDVGGLKREIDSLTKTIELPLHQPNLFSDFGINPPRGVLLHGPPGTGKTMLLRCVANSS 304

Query: 246 DATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN 305
           +A  + + G  +V KY+GE    +RE+F+ A+  +  IIF DEI                
Sbjct: 305 NAHVLTINGPSIVSKYLGETEAKLREIFDEAQKYQPSIIFIDEI---DSLAPNRANDDSG 361

Query: 306 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 364
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ R 
Sbjct: 362 EVESRVVATLLTLMDGMGGSGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVDARF 421

Query: 365 NIFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 410
           +I +     MS ER    E     I+       GA+L ++C E+ M  I+
Sbjct: 422 DILKKQFSRMSEERHTLNEDDIKNIASKTHGYVGADLSALCRESVMKTIQ 471

>NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168
          Length = 782

 Score =  181 bits (459), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 148/264 (56%), Gaps = 12/264 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 304 VSFKNVAGCDEAKVEIMEFVHF-LKNPNKYTVLGAKIPRGAILSGPPGTGKTLLAKATAG 362

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 363 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKLAPSIIFIDEIDAIGKERGKGGALG 422

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 423 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALLRPGRFDRHIQIDAPDIN 482

Query: 362 GRANIFRIHSKSMSVERGI---RWEL------ISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I+ +H K +++E  +   + ++      ++ L P  TGA++ + C EA + A R +
Sbjct: 483 GRKQIYLVHLKRLNLEEKLVETKEDVENLAGKLATLTPGFTGADIANACNEAALIAARHK 542

Query: 413 RKVATEKDFLQAVEKVINGYKKFS 436
               T + F QA+E+VI G +K S
Sbjct: 543 DPFVTIQHFEQAIERVIAGLEKKS 566

>NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {ON}
           Anc_4.259
          Length = 772

 Score =  181 bits (459), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/242 (40%), Positives = 138/242 (57%), Gaps = 3/242 (1%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           I PS       E P V +SD+GG +E   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 489 IRPSAMREIFLEMPKVYWSDIGGQEELKRKMKEMIQLPLEASETFARLGVTAPKGVLLYG 548

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 549 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 608

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 609 I--DALSPDRDGGSSSSAASHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 407
           +DR +  + PD E R  I R  +K   + E  I  E +SR     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVAPPDYEARLQILRKCTKKFQIDESTINLEDLSRRTDGCSGAEVVLLCQEAGLA 726

Query: 408 AI 409
           AI
Sbjct: 727 AI 728

 Score =  169 bits (429), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 131/232 (56%), Gaps = 8/232 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           +TY  VGG  +++D L+  + LPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 233 LTYDSVGGLHKEVDLLKTTISLPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVAN 292

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
             +A  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 293 TANAHVLTINGPSIVSKYLGETESALRDIFNEAKKYQPSIIFIDEI---DSIAPNRANDD 349

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGMGSAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 409

Query: 363 RANIFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 410
           R +I       MS ER    E     IS       GA+L S+C E+ M  I+
Sbjct: 410 RLDILMKQFSQMSSERHTLTEEDIKTISSKTHGYVGADLSSLCRESVMKTIQ 461

>YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}
           YTA7Protein that localizes to chromatin and has a role
           in regulation of histone gene expression; has a
           bromodomain-like region that interacts with the
           N-terminal tail of histone H3, and an ATPase domain;
           potentially phosphorylated by Cdc28p
          Length = 1379

 Score =  182 bits (462), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 138/234 (58%), Gaps = 9/234 (3%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           +V + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 409 NVNFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 468

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 469 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 528

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 529 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 585

Query: 358 PDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 410
           PD++ R  I +I ++  S      + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 586 PDVKARFKILQIQTRKWSSPLSTNFIDKLAFLTKGYGGADLRSLCTEAALISIQ 639

>Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W
           (REAL)
          Length = 1398

 Score =  181 bits (460), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 140/236 (59%), Gaps = 13/236 (5%)

Query: 183 DVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVA 242
           ++ + D+GG    ID+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 421 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 480

Query: 243 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXX 297
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 481 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 540

Query: 298 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 541 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 597

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIR 410
           PD++ R  I +I +K  +    +  E I++L        GA+LRS+CTEA + +I+
Sbjct: 598 PDVKARYKILQIQTKKWT--SPLSTEFINKLAILTKGYGGADLRSLCTEAALISIQ 651

>KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.472
           YMR089C
          Length = 784

 Score =  180 bits (456), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           + ++DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 308 IKFNDVAGCDEAKEEIMEFVSF-LKDPVRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 366

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 367 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 426

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 427 ANDERESTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDRALLRPGRFDRHINIDKPELEG 486

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 487 RKEIFAVHLKGLKLANTI-FDLKNRLAALTPGFSGADIANVCNEAALIAARTDSHAVVLT 545

Query: 420 DFLQAVEKVINGYKKFS 436
            F  A+E+VI G ++ S
Sbjct: 546 HFEHAIERVIGGVERKS 562

>KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON}
           Anc_4.259 YLR397C
          Length = 772

 Score =  180 bits (456), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 149/282 (52%), Gaps = 14/282 (4%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           I PS       E P V +SD+GG  E   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 IRPSAMREIFLEMPKVYWSDIGGQHELKRKMKEMIQLPLEASETFAELGVSAPKGVLLYG 549

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 550 PPGCSKTLTAKALATESGINFFAVKGPEIFSKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDSGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 666

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 407
           +DR +    PD E R  I    +K   +E   +  E ++R     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIFVGPPDYEARLQILHKCTKKFQLEGSDVNLEDLARRTDGCSGAEIVLLCQEAGLA 726

Query: 408 AI--RARRKVATEKDFLQAVEKVING--------YKKFSSTS 439
           AI    + K      F +A+E +  G        Y  F+S S
Sbjct: 727 AIMENLQAKEVRAAHFEKAMEGISRGITEDMLEYYNNFASRS 768

 Score =  163 bits (413), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 91/230 (39%), Positives = 130/230 (56%), Gaps = 8/230 (3%)

Query: 186 YSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRT 245
           Y  VGG  ++I  L+  +ELPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN +
Sbjct: 236 YEAVGGLSKEIGLLKSTIELPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVANTS 295

Query: 246 DATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXN 305
           +A  + + G  +V KY+GE    +R++F  A+  +  IIF DEI                
Sbjct: 296 NAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRANDDSG 352

Query: 306 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 364
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R 
Sbjct: 353 EVESRVVATLLTLMDGMGAAGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDAEARL 412

Query: 365 NIFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 410
           +I      +MS ER    E     I+       GA+L ++C E+ M  I+
Sbjct: 413 DILLKQFSNMSSERHSLTEDNIKTIASKTHGYVGADLSALCRESVMKTIQ 462

>YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON}
           YTA12Component, with Afg3p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 825

 Score =  180 bits (457), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 345 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 403

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 404 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 463

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 464 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 523

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 524 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDAVKLN 582

Query: 420 DFLQAVEKVINGYKKFS 436
            F QA+E+VI G ++ S
Sbjct: 583 HFEQAIERVIGGVERKS 599

>Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {ON}
           YMR089C (REAL)
          Length = 827

 Score =  180 bits (457), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 346 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 404

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 405 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 464

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 465 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 524

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 525 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDENSVKLN 583

Query: 420 DFLQAVEKVINGYKKFS 436
            F QA+E+VI G ++ S
Sbjct: 584 HFEQAIERVIGGVERKS 600

>CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089c YTA12
           or uniprot|P39925 Saccharomyces cerevisiae YER017c AFG3
          Length = 827

 Score =  180 bits (456), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 144/255 (56%), Gaps = 6/255 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E  +++ E V   L +P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 349 VKFKDVAGCDEAKEEIMEFVSF-LRNPQRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 407

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 408 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 467

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR++    P+LEG
Sbjct: 468 ANDERENTLNQMLVEMDGFTSADHVVVLAGTNRPDILDNALLRPGRFDRRIHIDRPELEG 527

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 528 RKAIFEVHLQKLKLAGSI-FDLKNRLAALTPGFSGADIANVCNEAALIAARHDENAVKLS 586

Query: 420 DFLQAVEKVINGYKK 434
            F QA+E+VI G ++
Sbjct: 587 HFEQAIERVIGGVER 601

>NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {ON}
           Anc_2.472
          Length = 803

 Score =  179 bits (454), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 319 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 377

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 378 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 437

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 438 ANDERENTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 497

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF +H + + +  G   +L +RL    P   GA++ +VC EA + A R  +     +
Sbjct: 498 RKAIFEVHLQKLKLA-GTVLDLKNRLAALTPGFAGADIANVCNEAALIAARNDQPSVRLE 556

Query: 420 DFLQAVEKVINGYKKFS 436
            F QA+E+VI G ++ S
Sbjct: 557 HFEQAIERVIGGVERKS 573

>NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa]
           {ON} Anc_2.472
          Length = 791

 Score =  179 bits (454), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 144/265 (54%), Gaps = 6/265 (2%)

Query: 176 MTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKT 235
              E    + + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKT
Sbjct: 303 FNTETDVKIKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKT 361

Query: 236 LCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXX 295
           L A+A A      F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI      
Sbjct: 362 LLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKA 421

Query: 296 XXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 354
                    N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR + 
Sbjct: 422 RQKGNFSGANDERENTLNQMLVEMDGFTTEDHVVVLAGTNRPDILDQALLRPGRFDRHIN 481

Query: 355 FSLPDLEGRANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRA 411
              P+LEGR  IF +H   + +   I ++L +RL    P   GA++ +VC EA + A R 
Sbjct: 482 LDKPELEGRKAIFAVHLGKLKLSSSI-FDLKNRLAALTPGFAGADIANVCNEAALIAARN 540

Query: 412 RRKVATEKDFLQAVEKVINGYKKFS 436
            +K    + F QA+E+VI G ++ S
Sbjct: 541 DQKSVKLEHFEQAIERVIGGVERKS 565

>CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397c AFG2
          Length = 771

 Score =  179 bits (453), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 117/312 (37%), Positives = 167/312 (53%), Gaps = 26/312 (8%)

Query: 142 SPTDIEEGMRVGV-DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLR 200
           S TD+ E ++VG+ D     +E      I PS       E P V +SD+GG ++   K++
Sbjct: 468 STTDMTE-LKVGITDVESAMLE------IRPSAMREIFLEMPKVYWSDIGGQEDLKRKMK 520

Query: 201 EVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQK 260
           E+++LPL + + FAALGI  PKGILLYGPPG  KTL A+A+A  +   F+ V G E+  K
Sbjct: 521 EMIQLPLEAADTFAALGIKAPKGILLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNK 580

Query: 261 YVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 320
           YVGE  R +RE+F  AR     IIFFDEI               N V   +  L+ ++DG
Sbjct: 581 YVGESERAIREIFRKARAASPSIIFFDEIDALSPDRDGSSTSAANHV---LTSLLNEIDG 637

Query: 321 FDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGI 380
            +    + ++ ATNRP+ +D ALLRPGR+DR V  S PD   R  I +  +K+  ++   
Sbjct: 638 VEELNGVVIVAATNRPDEIDSALLRPGRLDRHVYVSPPDFNARLQILKKCTKNFDLDN-- 695

Query: 381 RWELISRLCPNS---TGAELRSVCTEAGMFAIR--ARRKVATEKDF---LQAVEKVING- 431
             EL++ L   +   +GAE+  +C EAG+ AI      K      F   LQ + K I   
Sbjct: 696 TDELLNDLATRTEGCSGAEVVLLCQEAGLAAIMDDIHTKKVDANHFEVALQGISKCITPE 755

Query: 432 ----YKKFSSTS 439
               Y++F+S S
Sbjct: 756 MLEYYQEFASRS 767

 Score =  169 bits (428), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 136/232 (58%), Gaps = 8/232 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           ++Y  VGG K +ID L++ ++LPL  PE FA  GI PPKGIL++GPPGTGKT+  R VAN
Sbjct: 233 LSYDAVGGLKCEIDLLKKAIDLPLHRPEIFADFGISPPKGILMHGPPGTGKTMLLRCVAN 292

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
            ++A  + + G  +V KY+GE    +RE+F  A+  +  IIF DEI              
Sbjct: 293 ASNAHVLSIDGPSIVSKYLGETESKLREIFNEAKKYQPAIIFIDEI---DSIAPNRANDD 349

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             EV+ R +  L+T +DG    G I V+ ATNRPN +DPAL RPGR D+++E  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGTSSSGRIAVIAATNRPNAVDPALRRPGRFDQEIEIGIPDVDA 409

Query: 363 RANIFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 410
           R +I +   + +S ++    E     I+       GA+L ++C E+ M  I+
Sbjct: 410 RFDILKKQFEKISTDKHTLSEGDIKSIASKTHGYVGADLTALCRESVMKTIQ 461

>NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168
          Length = 773

 Score =  179 bits (453), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V++ +V GC E   ++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 295 VSFKNVAGCDEAKVEIMEFVHF-LKNPKKYTTLGAKIPRGAILSGPPGTGKTLLAKATAG 353

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 354 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKMAPSIIFIDEIDAIGKERGKGGALG 413

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR ++   PD+ 
Sbjct: 414 GSNDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALMRPGRFDRHIQIDAPDIN 473

Query: 362 GRANIFRIHSKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I+ +H K +++E  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 474 GRKEIYLVHLKKLNLETRLVETDSDRENLAGKLATLTPGFTGADIANACNEAALIAARNK 533

Query: 413 RKVATEKDFLQAVEKVINGYKKFS 436
                   F QA+E+VI G +K S
Sbjct: 534 DPYILLSHFEQAIERVIAGLEKKS 557

>TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.168
           YER017C
          Length = 744

 Score =  178 bits (452), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 144/264 (54%), Gaps = 12/264 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E   ++ E V   L +P+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VQFKDVAGCNEAKQEIMEFVHF-LKNPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
                F+ V GSE V+ +VG GA  VR+LFE  R     IIF DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQGRKMAPSIIFVDEIDAIGKERGKGGAMG 383

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+E
Sbjct: 384 GSNDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDVE 443

Query: 362 GRANIFRIHSKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I+ +H + +++++        R EL   ++ L P   GA++ + C EA + A R  
Sbjct: 444 GRKAIYLVHMRKLNLDKRFTTLQSEREELAGKLAALTPGFAGADIANACNEAALIAARHN 503

Query: 413 RKVATEKDFLQAVEKVINGYKKFS 436
                   F QA+E+VI G +K S
Sbjct: 504 DPCIELHHFEQAIERVIAGLEKKS 527

>SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P40341 Saccharomyces
           cerevisiae YMR089C YTA12 Component with Afg3p of the
           mitochondrial inner membrane m-AAA protease that
           mediates degradation of misfolded or unassembled
           proteins and is also required for correct assembly of
           mitochondrial enzyme complexes
          Length = 830

 Score =  179 bits (453), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV G  E  +++ E V   L  P R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 352 VKFKDVAGMDEAKEEVMEFVSF-LKEPSRYEKLGAKIPRGAILSGPPGTGKTLLAKATAG 410

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 411 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 470

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +L+ ++DGF P  +I V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 471 ANDERENTLNQLLVEMDGFTPADHIVVLAGTNRPDILDQALMRPGRFDRHINIDKPELEG 530

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF++H   + +  G  ++L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 531 RKEIFQVHLAKIKLA-GEMYDLKNRLATLTPGFSGADIANVCNEAALIAARNDCTAVKLE 589

Query: 420 DFLQAVEKVINGYKKFS 436
            F QA+E+VI G ++ S
Sbjct: 590 HFEQAIERVIGGVERKS 606

>Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON}
           YER017C (REAL)
          Length = 761

 Score =  178 bits (452), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 95/259 (36%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           +++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 286 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 344

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
             +  F  V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 345 EANVPFFSVSGSEFVEMFVGVGASRVRDLFTQARSMSPSIIFIDEIDAIGKERGKGGALG 404

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 405 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 464

Query: 362 GRANIFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 415
           GR  I+ +H K ++++  +R ++      ++ L P  TGA++ + C EA + A R   + 
Sbjct: 465 GRQQIYLVHLKRLNLDPLLRDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDQY 524

Query: 416 ATEKDFLQAVEKVINGYKK 434
            T   F QA+E+VI G +K
Sbjct: 525 ITIHHFEQAIERVIAGLEK 543

>TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa]
           {ON} Anc_7.168 YER017C
          Length = 782

 Score =  178 bits (452), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/294 (35%), Positives = 153/294 (52%), Gaps = 25/294 (8%)

Query: 153 GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPER 212
           GV +SK H              +   E    VT+ DV GC+E   ++ E V+  L +P +
Sbjct: 293 GVGKSKAH--------------LFNKETDVKVTFKDVAGCQEAKQEIMEFVDF-LKNPHK 337

Query: 213 FAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 272
           +  LG   P+G +L GPPGTGKTL A+AVA      F+ V GSE V+ +VG GA  VR+L
Sbjct: 338 YTELGAKIPRGAILSGPPGTGKTLLAKAVAGEAGVPFLSVSGSEFVEMFVGVGASRVRDL 397

Query: 273 FEMARTRKACIIFFDEIXXXXXXXXXXXXX--XXNEVQRTMLELITQLDGFDPRGNIKVM 330
           FE A      IIF DEI                 +E + T+ +L+ ++DGF     + V+
Sbjct: 398 FEQASKMAPSIIFVDEIDAIGKARGKNGSLGGSNDEREATLNQLLVEMDGFSTSDQVVVL 457

Query: 331 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSV--------ERGIRW 382
             TNRP+ LD ALLRPGR DR V+   PD+EGR  I+ +H K +++        ++ +  
Sbjct: 458 AGTNRPDVLDKALLRPGRFDRHVQIDAPDVEGRKLIYLVHLKKLNLDPLYSEDKQKQLLA 517

Query: 383 ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFS 436
             ++ L P  TGA++ + C E+ + A R          F +A+E+VI G +K S
Sbjct: 518 GKLAALTPGFTGADIANACNESALIAARKMDPYVQFTHFEEAIERVIAGLEKKS 571

>Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON}
           (50661..53240) [2580 nt, 860 aa]
          Length = 859

 Score =  179 bits (453), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E  +++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 379 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 437

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI              
Sbjct: 438 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFIDEIDAIGKARQKGNFSG 497

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 498 ANDERENTLNQLLVEMDGFTTSDHIVVLAGTNRPDILDKALLRPGRFDRHINIDKPELSG 557

Query: 363 RANIFRIHSKSMSVERGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF +H K + +   I ++L   +S L P  +GA++ +VC EA + A R   +    +
Sbjct: 558 RKAIFEVHLKKIKIAGDI-FDLKNRLSALTPGFSGADIANVCNEAALIAARNEARFVKLE 616

Query: 420 DFLQAVEKVINGYKKFS 436
            F QA+E+VI G ++ S
Sbjct: 617 HFEQAIERVIGGVERKS 633

>TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.168
           YER017C
          Length = 784

 Score =  178 bits (452), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E   ++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 294 VAFKDVAGCNEAKQEIMEFVHF-LKNPKKYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 352

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
                F+ V GSE V+ +VG GA  VR+LFE ART    IIF DEI              
Sbjct: 353 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARTMAPSIIFIDEIDAIGKERGKGGALG 412

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR +E   PD+E
Sbjct: 413 GANDEREATLNQLLVEMDGFQTSDQVIVLAGTNRPDVLDKALMRPGRFDRHIEIDPPDVE 472

Query: 362 GRANIFRIHSKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR +I+ +H   +++         ++ +    ++ L P   GA++ + C EA + A R  
Sbjct: 473 GRKSIYLVHLSKLNLDPSFLKTKHDKEMLAGKLAALTPGFAGADIANACNEAALIAARYN 532

Query: 413 RKVATEKDFLQAVEKVINGYKKFS 436
            +    + F QA+E+VI G +K S
Sbjct: 533 DEYVEMRHFEQAIERVIAGLEKKS 556

>YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON}
           AFG2ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a
           hexameric complex; is essential for pre-60S maturation
           and release of several preribosome maturation factors;
           may be involved in degradation of aberrant mRNAs
          Length = 780

 Score =  178 bits (451), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 145/264 (54%), Gaps = 6/264 (2%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           I PS       E P V +SD+GG +E   K++E+++LPL + E FA LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKTKMKEMIQLPLEASETFARLGISAPKGVLLYG 557

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 407
           +DR +    PD+  R  I +  +K  + E  G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTEESGVDLHELADRTEGYSGAEVVLLCQEAGLA 734

Query: 408 AIRARRKVATEKDFLQAVEKVING 431
           AI     VA  K  L+  EK   G
Sbjct: 735 AIMEDLDVA--KVELRHFEKAFKG 756

 Score =  167 bits (422), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 136/232 (58%), Gaps = 8/232 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           ++Y+ VGG  ++I+ L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 LSYAAVGGLDKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGKVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 363 RANIFRIHSKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           R +I       MS +R +      + I+       GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQFSRMSSDRHVLDSEAIKYIASKTHGYVGADLTALCRESVMKTIQ 470

>SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 776

 Score =  178 bits (451), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 155/294 (52%), Gaps = 9/294 (3%)

Query: 146 IEEGMRVGVDRSKYHIELPLPPR----IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLRE 201
           I+ G+   +DR K  + L         I PS       E P V +SD+GG +E   K+RE
Sbjct: 466 IQRGLTESIDREKLKVILKDVEEAMMDIRPSAMREIFLEMPKVYWSDIGGQEELKQKMRE 525

Query: 202 VVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKY 261
           +++LPL + E F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KY
Sbjct: 526 MIQLPLEAAETFQRLGVSAPKGVLLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNKY 585

Query: 262 VGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGF 321
           VGE  R +RE+F  AR     IIFFDEI               +     +  L+ ++DG 
Sbjct: 586 VGESERAIREIFRKARAAAPSIIFFDEI--DALSPDRNSGSGTSAANHVLTSLLNEIDGV 643

Query: 322 DPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSV-ERGI 380
           +    + ++ ATNRP+ +DPALLRPGR+DR +  + PD   R  IF+  +K   +    +
Sbjct: 644 EELNGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPDHAARLQIFKKCTKKFQLGGSNV 703

Query: 381 RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKK 434
             E ++      +GAE+  +C EAG+ AI     + T K   +  EK ++G  K
Sbjct: 704 DLEELASKTEGCSGAEVVLLCQEAGLAAI--MEDLETSKVEARHFEKALSGISK 755

 Score =  159 bits (401), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 141/249 (56%), Gaps = 8/249 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           + Y+ VGG  ++I  L+  +ELPL  P  F    + PP+GILL+GPPGTGKT+  R VAN
Sbjct: 239 IGYNAVGGLAKEISLLKGTIELPLHQPTLFTDFSVTPPRGILLHGPPGTGKTMLLRCVAN 298

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
            T+A  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 299 ETNAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRAGDD 355

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             E++ R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ 
Sbjct: 356 SGEIESRVVATLLTLMDGMGGAGRLVVVAATNRPNKIDPALRRPGRFDQEVEIGIPDVDA 415

Query: 363 RANIFRIHSKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 418
           R +I       +S +R  +  E IS +   +    GA+L ++C EA M AI+     + +
Sbjct: 416 RLDILTKQFSKISHQRHELIAEDISTIASKTHGYVGADLIALCREAVMKAIQRGLTESID 475

Query: 419 KDFLQAVEK 427
           ++ L+ + K
Sbjct: 476 REKLKVILK 484

>TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.259
           YLR397C
          Length = 776

 Score =  178 bits (451), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 166/311 (53%), Gaps = 19/311 (6%)

Query: 146 IEEGMRVGVDRSKYHIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKL 199
           I+ G++   D S   +++ +         I PS       E P V +SD+GG +E   K+
Sbjct: 464 IQRGLKTASDMSSDSLKITVNDVEDAMLEIRPSAMREIFLEMPKVYWSDIGGQEELKRKM 523

Query: 200 REVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 259
           +E+++LPL + + F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  
Sbjct: 524 KEMIQLPLEAADTFDRLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFN 583

Query: 260 KYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 319
           KYVGE  R +RE+F  AR+    IIFFDEI                     +  L+ ++D
Sbjct: 584 KYVGESERAIREIFRKARSASPSIIFFDEIDALSPDRDGGSSSS--AASHVLTSLLNEID 641

Query: 320 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERG 379
           G +    + ++ ATNRP+ +DPALLRPGR+DR +  + P  + R  I + ++K+  VE+ 
Sbjct: 642 GVEDLKGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPTYDARLQILKNNTKNFQVEKA 701

Query: 380 -IRWELISRLCPNSTGAELRSVCTEAGMFAIRAR--RKVATEKDFLQAVEKVING----- 431
            I  E ++R     +GAE+  +C EAG+ AI         T + F +A++ +  G     
Sbjct: 702 NIDLEELARRTDGCSGAEVVLLCQEAGLAAIMENIDTDFVTPEHFEKALQGIARGITPEM 761

Query: 432 ---YKKFSSTS 439
              Y++F+S S
Sbjct: 762 LEYYQEFASRS 772

 Score =  167 bits (424), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 138/239 (57%), Gaps = 6/239 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V+Y+ VG   ++I+ LR  VELPL   + FA  GI PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 VSYNSVGALSKEIEVLRNAVELPLNQSQLFADFGITPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
            +DA  + + G  +V KY+G+    +R++F  A+  +  IIF DEI              
Sbjct: 297 SSDAHVLTIDGPSIVSKYLGDTENTLRDIFREAQKYQPSIIFIDEIDSIAPNRTNDDSGE 356

Query: 304 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 363
                R +  L+T +DG +  G + V+ ATNRPN++DPAL RPGR D++VE  +PD+EGR
Sbjct: 357 AE--SRVVATLLTLMDGMNGSGKVVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVEGR 414

Query: 364 ANIFRIHSKSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 418
            +I       MS +R  +  E I  +   +    GA+L ++C E+ M  I+   K A++
Sbjct: 415 LDILSKQFSKMSPKRHNLSDEDIKVIAAKTHGYVGADLTALCRESVMKTIQRGLKTASD 473

>KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40341 Saccharomyces cerevisiae
           YMR089C YTA12 Component with Afg3p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 842

 Score =  178 bits (452), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VNFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 393 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 452

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD AL+RPGR DR +    P+L+G
Sbjct: 453 ANDERENTLNQLLVEMDGFTTADHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELQG 512

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF++H K +++  G   +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 513 RQEIFKVHLKKITLA-GDMTDLQNRLAVMTPGFSGADIANVCNEAALIAARNDCDAVRLE 571

Query: 420 DFLQAVEKVINGYKKFS 436
            F QA+E+VI G ++ S
Sbjct: 572 HFEQAIERVIGGVERKS 588

>KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} similar
           to uniprot|P32794 Saccharomyces cerevisiae YLR397C AFG2
           ATPase of the CDC48/PAS1/SEC18 (AAA) family forms a
           hexameric complex may be involved in degradation of
           aberrant mRNAs
          Length = 804

 Score =  177 bits (450), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 143/245 (58%), Gaps = 8/245 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V Y+ VGG K++   L+  VE PL  P+ F   GI+PP+GILL+GPPGTGKT+  R VAN
Sbjct: 267 VLYNAVGGLKKETSILKSTVEFPLHQPQLFTDFGINPPRGILLHGPPGTGKTMLLRCVAN 326

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
            TDA  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 327 ETDAHILTISGPSIVSKYLGETEAALRDIFNEAKRYQPSIIFIDEI---DSLAPNRANDD 383

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             EV+ R +  L+T +DG D  G + V+ ATNRPN++DPAL RPGR D+++E S+PD+E 
Sbjct: 384 SGEVESRVVATLLTLMDGMDGSGRLAVVAATNRPNSIDPALRRPGRFDQEIEISIPDVEA 443

Query: 363 RANIFRIHSKSMSVERGIRW-ELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 418
           R +I R     MS +R +   E IS +   +    GA+L ++C E+ M  I+       E
Sbjct: 444 RHDILRKQFSRMSKQRQLLSPEDISNIASKTHGYVGADLIALCRESVMKTIQRGLNENIE 503

Query: 419 KDFLQ 423
           +D L+
Sbjct: 504 RDDLK 508

 Score =  172 bits (435), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 135/242 (55%), Gaps = 3/242 (1%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           I PS       E P V + D+GG +E   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 521 IRPSAMREIFLETPKVYWDDIGGQEELKQKMKEMIQLPLEAAETFAKLGVSAPKGVLLYG 580

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 581 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 640

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 641 I--DALSPDRDSGSGTSAANHVLTSLLNEIDGVEELKGVIIVAATNRPDEIDPALLRPGR 698

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSVERGI-RWELISRLCPNSTGAELRSVCTEAGMF 407
           +DR +    P  + R  I +  +K  +++  I   + ++      +GAE+  +C EAG+ 
Sbjct: 699 LDRHIYVGPPSYDARLQILQKCTKKFNIDTAIVDLKALAECTDGCSGAEVVLLCQEAGLA 758

Query: 408 AI 409
           AI
Sbjct: 759 AI 760

>ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR089C (YTA12)
          Length = 818

 Score =  177 bits (449), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 331 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAQIPRGAILSGPPGTGKTLLAKATAG 389

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 390 EAGVPFFSVSGSEFVEMFVGIGASRVRDLFKTARENAPAIIFIDEIDAIGKSRQKGNFSG 449

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +L+ ++DGF P  +I V+  TNR + LD AL+RPGR DR +    P+L G
Sbjct: 450 ANDERENTLNQLLVEMDGFTPSDHIVVLAGTNRQDVLDRALMRPGRFDRHIHIDKPELSG 509

Query: 363 RANIFRIHSKSMSV--ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
           R  IF++H   + +  + G   + ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 510 RQEIFKVHLSKIKLAGDIGDLKDRLAALTPGFSGADIANVCNEAALIAARYDSSSVKLEH 569

Query: 421 FLQAVEKVINGYKKFS 436
           F QA+E+VI G ++ S
Sbjct: 570 FEQAIERVIGGVERKS 585

>CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly
           similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017c AFG3 or uniprot|P40341 Saccharomyces cerevisiae
           YMR089c YTA12
          Length = 750

 Score =  176 bits (447), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           +++ DV GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 275 ISFKDVAGCDEAKQEIMEFVHF-LKNPAKYTQLGAKIPRGAILSGPPGTGKTLLAKATAG 333

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 334 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKGGALG 393

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNR + LDPAL+RPGR DR +E   PD+ 
Sbjct: 394 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRMDVLDPALMRPGRFDRHIEIDAPDMS 453

Query: 362 GRANIFRIHSKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I+ +H + ++++  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 454 GRKAIYNVHLQRLNLDPKLTETAEKRDNLSGKLATLTPGFTGADIANACNEAALIAARHQ 513

Query: 413 RKVATEKDFLQAVEKVINGYKKFS 436
            K      F QA+E+VI G +K S
Sbjct: 514 DKYVELLHFEQAIERVIAGLEKKS 537

>TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.472
           YMR089C
          Length = 792

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 143/266 (53%), Gaps = 6/266 (2%)

Query: 175 MMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGK 234
           M   +    V ++ V GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGK
Sbjct: 317 MFNSDTNVKVKFNAVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGK 375

Query: 235 TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXX 294
           TL A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI     
Sbjct: 376 TLLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFVDEIDAIGK 435

Query: 295 XXXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKV 353
                     N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +
Sbjct: 436 ARQKGNFSGANDERENTLNQLLVEMDGFTSSDHVVVLAGTNRPDILDKALLRPGRFDRHI 495

Query: 354 EFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIR 410
               P+L GR  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R
Sbjct: 496 NIDKPELSGRKAIFDVHLKKIKISDDI-YDLKNRLAVLTPGFSGADIANVCNEAALIAAR 554

Query: 411 ARRKVATEKDFLQAVEKVINGYKKFS 436
                     F QAVE+VI G ++ S
Sbjct: 555 DDSHFVALNHFEQAVERVIGGVERKS 580

>KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {ON}
           Anc_7.430 YPR024W
          Length = 766

 Score =  176 bits (446), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 293 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 351

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 352 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 411

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 412 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 468

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I R+H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 469 RGRADILRLHMKKITMATDVEPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMSH 528

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 529 FEWAKDKILMGAER 542

>KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {ON}
           Anc_7.168 YER017C
          Length = 783

 Score =  176 bits (446), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 142/264 (53%), Gaps = 12/264 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           + + DV GC+E   ++ E V   L SP+++ ALG   P+G +L GPPGTGKTL A+A A 
Sbjct: 303 IQFKDVAGCQEAKQEIMEFVHF-LKSPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 361

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXX- 302
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 362 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKNGALG 421

Query: 303 -XXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 422 GANDEREATLNQLLVEMDGFTTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDIT 481

Query: 362 GRANIFRIHSKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412
           GR  I+ +H   + +         +  +    ++ L P  TGA++ + C EA + A R +
Sbjct: 482 GRKEIYLVHLAKLHLDPVFTKTKKDGDMLAGKLATLTPGFTGADIANACNEAALIAARYK 541

Query: 413 RKVATEKDFLQAVEKVINGYKKFS 436
                   F QA+E+VI G +K S
Sbjct: 542 DPYVGLSHFEQAIERVIAGLEKKS 565

>Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON}
           YER017C (REAL)
          Length = 760

 Score =  176 bits (445), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 144/259 (55%), Gaps = 9/259 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           +++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 284 ISFRNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 342

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 343 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 402

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 403 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 462

Query: 362 GRANIFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 415
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 463 GRQQIYLVHLKKLNLDPLLTDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDSY 522

Query: 416 ATEKDFLQAVEKVINGYKK 434
            T   F QA+E+VI G +K
Sbjct: 523 ITIHHFEQAIERVIAGLEK 541

>Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON}
           YER017C (REAL)
          Length = 762

 Score =  176 bits (445), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 144/259 (55%), Gaps = 9/259 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           +++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 287 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 345

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 346 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 405

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 406 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 465

Query: 362 GRANIFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 415
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 466 GRQQIYLVHLKRLNLDPLLTDDMGNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 525

Query: 416 ATEKDFLQAVEKVINGYKK 434
            T   F QA+E+VI G +K
Sbjct: 526 ITIHHFEQAIERVIAGLEK 544

>NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {ON}
           Anc_4.259
          Length = 778

 Score =  176 bits (445), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 137/242 (56%), Gaps = 3/242 (1%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           I PS       E P V +SD+GG +E   K++E+++LPL +   FA LGI  PKG+LLYG
Sbjct: 495 IRPSAMREIFLEMPKVFWSDIGGQEELKRKMKEMIQLPLEASATFARLGISAPKGVLLYG 554

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARAASPSIIFFDE 614

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 I--DALSPDRDGGSSTSAASHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 672

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 407
           +DR +  + PD + R  I +  +K   +E   I+ E ++      +GAE+  +C EAG+ 
Sbjct: 673 LDRHIYVAPPDYDARLQILQKCTKKFQIENTNIKLEDLAERTAGCSGAEVVLLCQEAGLA 732

Query: 408 AI 409
           AI
Sbjct: 733 AI 734

 Score =  160 bits (405), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 139/250 (55%), Gaps = 10/250 (4%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           +TY  +GG +++++ L+  + LPL  P  F   G+ PP+GILL+GPPGTGKT+  + VAN
Sbjct: 239 ITYDAIGGLRKEVELLQSTISLPLHQPTLFTDFGVTPPRGILLHGPPGTGKTMLLQCVAN 298

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
             +A  + + G  +V KY+GE    +R++F  A+  +  IIF DE+              
Sbjct: 299 TANAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEV---DSLAPNRANDD 355

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             EV+ R +  L+T + G    G + V+ ATNRPN++DPAL RPGR D++VE  +PD + 
Sbjct: 356 AGEVESRVVATLLTLMSGMSAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDADA 415

Query: 363 RANIFRIHSKSMSVER----GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 418
           R +I   +   MS ER    G   + I+       GA+L ++C E+ M  I  +R +   
Sbjct: 416 RLDILLKNFSKMSTERHTLTGEDIKTIASKTHGYVGADLSALCRESVMKTI--QRGMHLY 473

Query: 419 KDFLQAVEKV 428
           KD   ++ KV
Sbjct: 474 KDIDSSLLKV 483

>KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7.430
           YPR024W
          Length = 726

 Score =  175 bits (443), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K DV + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 254 KTDVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 312

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF+ AR R   IIF DE+           
Sbjct: 313 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFQQARNRSPAIIFIDELDAIGGKRNPKD 372

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 373 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 429

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H + +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 430 RGRADILKHHMQKITLAPDVDPTIIARGTPGLSGAELSNLVNQAAVYACQKNAIAVDMSH 489

Query: 421 FLQAVEKVINGYKK 434
           F  A +K + G +K
Sbjct: 490 FEWAKDKTLMGAEK 503

>NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON}
           Anc_7.430
          Length = 750

 Score =  175 bits (443), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 278 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 336

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 337 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 396

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 397 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 453

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I ++H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 454 RGRADILKLHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQQNAIAVDMSH 513

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 514 FEWAKDKILMGAER 527

>ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} similar
           to uniprot|P32795 Saccharomyces cerevisiae YPR024W YME1
           Mitochondrial inner membrane protease of the AAA family
           responsible for degradation of unfolded or misfolded
           mitochondrial gene products mutation causes an elevated
           rate of mitochondrial turnover
          Length = 740

 Score =  174 bits (441), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 268 KTNVKFDDVHGCDEARAELEEIVDF-LKDPAKYESLGGTLPKGVLLTGPPGTGKTLLARA 326

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ VRELF  AR+R   I+F DE+           
Sbjct: 327 TAGEAGVDFFFMSGSEFDEVYVGVGAKRVRELFSQARSRAPAIVFIDELDAIGGKRNPKD 386

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 387 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKLVNVDLPDV 443

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 444 RGRADILKHHMKKITLANDVDPTLIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 503

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 504 FEWAKDKILLGAER 517

>YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}
           AFG3Component, with Yta12p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 761

 Score =  174 bits (442), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 144/259 (55%), Gaps = 9/259 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           +++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 285 ISFKNVAGCDEAKQEIMEFVHF-LKNPGKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 343

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXX--XXX 301
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 344 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 403

Query: 302 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 361
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 404 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 463

Query: 362 GRANIFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 415
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 464 GRQQIYLVHLKRLNLDPLLTDDMNNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 523

Query: 416 ATEKDFLQAVEKVINGYKK 434
            T   F QA+E+VI G +K
Sbjct: 524 ITIHHFEQAIERVIAGLEK 542

>KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 769

 Score =  174 bits (442), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 98/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 297 KTNVRFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 355

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 356 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 415

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 416 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 472

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I R H K ++V   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 473 RGRADILRHHMKKVTVAPDVDPTIIARGTPGLSGAELMNLVNQAAVYACQKNAIAVDMQH 532

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 533 FEWAKDKILMGAER 546

>Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  174 bits (441), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 145/266 (54%), Gaps = 6/266 (2%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           I PS       E P V +SD+GG +E   K++E+++LPL + E F+ LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKKKMKEMIQLPLEASETFSRLGISAPKGVLLYG 557

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 407
           +DR +    PD+  R  I +  +K  +  E G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTKESGVDLYELADRTEGYSGAEVVLLCQEAGLA 734

Query: 408 AIRARRKVATE--KDFLQAVEKVING 431
           AI     V     + F +A E +  G
Sbjct: 735 AIMDNLDVTMVELRHFEKAFEGIARG 760

 Score =  170 bits (431), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 138/234 (58%), Gaps = 12/234 (5%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           ++Y+ VGG  ++I+ L+  +E+PL  PE F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLNKEIESLKSAIEIPLHQPELFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETESALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 363 RANIFRIHSKSMSVER------GIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           R +I       MS ER      GI+   I+       GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQFSRMSPERHLLNSEGIKH--IASKTHGYVGADLTALCRESVMKTIQ 470

>Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {ON}
           YLR397C (REAL)
          Length = 777

 Score =  174 bits (441), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 146/271 (53%), Gaps = 10/271 (3%)

Query: 146 IEEGMRVGVDRSKYHIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKL 199
           I+ G+ +  D  K+ + + L         I PS       E P V +SD+GG  E   K+
Sbjct: 466 IQRGLGLDADIDKFSLIVTLKDVESAMVDIRPSAMREIFLEMPKVYWSDIGGQDELKTKM 525

Query: 200 REVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 259
           +E+++LPL + E FA LGI  PKG+LLYGPPG  KTL A+A+A  +   F  V G E+  
Sbjct: 526 KEMIQLPLEASETFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFFAVKGPEVFN 585

Query: 260 KYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 319
           KYVGE  R +RE+F  AR+    IIFFDEI               N V   +  L+ ++D
Sbjct: 586 KYVGESERAIREIFRKARSAAPSIIFFDEIDALSPVRDGGSTSAANHV---LTSLLNEID 642

Query: 320 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE-R 378
           G +    + ++ ATNRP+ +D ALLRPGR+DR +    PD   R  I +  +K  + E  
Sbjct: 643 GVEELKGVVIVAATNRPDEIDGALLRPGRLDRHIYVGPPDANARLEILKKCTKKFNTEGS 702

Query: 379 GIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           G+  + ++      +GAE+  +C EAG+ AI
Sbjct: 703 GVDLQELAARTKGYSGAEVVLLCQEAGLAAI 733

 Score =  168 bits (426), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 151/283 (53%), Gaps = 16/283 (5%)

Query: 141 VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD--------VTYSDVGGC 192
           VS  D+      G    +Y++  P   R   +    T E +          ++Y+ VGG 
Sbjct: 188 VSQLDLNSDEVYGSSNGQYYLSPPFIFRKGSTHIAFTKEMQASRKYNLPEPISYAAVGGL 247

Query: 193 KEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 252
            ++I+ L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN ++A  + +
Sbjct: 248 NKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVANTSNAHVLTI 307

Query: 253 IGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQ-RTM 311
            G  +V KY+GE    +RE+F  AR  +  IIF DEI                EV+ R +
Sbjct: 308 NGPSIVSKYLGETESALREIFNEARKYQPSIIFIDEI---DSIAPNRANDDSGEVESRVV 364

Query: 312 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHS 371
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ R +I     
Sbjct: 365 ATLLTLMDGMGAAGRLIVIAATNRPNCVDPALRRPGRFDQEVEIGIPDVDARFDILTRQF 424

Query: 372 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 410
             MS +R  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 425 SKMSPDRHALNLEEIKHIASKTHGYVGADLTALCRESVMKTIQ 467

>ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 830

 Score =  174 bits (441), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 99/255 (38%), Positives = 139/255 (54%), Gaps = 6/255 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E  +++ E V   L  P R+  +G   P+G +L G PGTGKTL A+A A 
Sbjct: 351 VKFKDVAGCDEAKEEIEEFVSF-LKEPSRYEKMGAKIPRGAILSGAPGTGKTLLAKATAG 409

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     +IF DEI              
Sbjct: 410 EAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMIFVDEIDAIGKARQKGNFSG 469

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 470 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDILDRALLRPGRFDRHVNIDKPELSG 529

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R  IF +H K + +   I ++L +RL    P  +GA++ + C EA + A R         
Sbjct: 530 RQAIFEVHLKKIKLAGDI-FDLKNRLAALTPGFSGADIANACNEAALIAARNESDSVKLV 588

Query: 420 DFLQAVEKVINGYKK 434
            F QA+E+VI G ++
Sbjct: 589 HFEQAIERVIGGVER 603

>KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.472
           YMR089C
          Length = 845

 Score =  174 bits (441), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 142/257 (55%), Gaps = 6/257 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           V + DV GC E  +++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 366 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 424

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 425 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNISG 484

Query: 304 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 485 ANDERENTLNQMLVEMDGFTAADHVVVLAGTNRPDILDKALLRPGRFDRHINLDNPELSG 544

Query: 363 RANIFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 419
           R +IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 545 RKDIFAVHLQKLKLAGDI-YDLKNRLAALTPGFSGADIANVCNEAALIAARNDCDSVKLV 603

Query: 420 DFLQAVEKVINGYKKFS 436
            F QA+E+VI G ++ S
Sbjct: 604 HFEQAIERVIGGVERKS 620

>Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  174 bits (440), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 147/267 (55%), Gaps = 6/267 (2%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           I PS       E P V +SD+GG ++   K++E+++LPL + E F  LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEDLKTKMKEMIQLPLEASETFTRLGITAPKGVLLYG 557

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 674

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 407
           +DR +    PD+  R  I +  +K  ++E  GI  + ++R     +GAE+  +C E+G+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNIEESGIDLQELARRTEGYSGAEVVLLCQESGLS 734

Query: 408 AIRARRKVATEKDFLQAVEKVINGYKK 434
           AI     V   K  L+  EK   G  +
Sbjct: 735 AIMEDLDVT--KVELRHFEKAFKGISR 759

 Score =  166 bits (420), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 137/232 (59%), Gaps = 8/232 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           ++Y+ VGG +++I+ L+  +++PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLRKEIELLKSAIDIPLHQPALFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD+E 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVEA 418

Query: 363 RANIFRIHSKSMSVER----GIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           R +I       MS +R        +LI+       GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQVSRMSPDRHSLDSEAIKLIASKTHGYVGADLTALCRESVMKTIQ 470

>SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024W YME1 Mitochondrial inner membrane protease of
           the AAA family responsible for degradation of unfolded
           or misfolded mitochondrial gene products mutation causes
           an elevated rate of mitochondrial turnover
          Length = 741

 Score =  172 bits (437), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 269 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 327

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 328 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 387

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 388 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 444

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 445 RGRADILKHHMKKVTLASEVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMSH 504

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 505 FEWAKDKILMGAER 518

>NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {ON}
           Anc_7.430
          Length = 712

 Score =  172 bits (436), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 145/255 (56%), Gaps = 6/255 (2%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 305 KTNVKFDDVQGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 363

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 364 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 423

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 424 QAY---AKQTLNQLLVELDGFSQSTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 480

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H K +++   +   LI+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 481 RGRADILKHHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQ-QNAIAVDMS 539

Query: 421 FLQ-AVEKVINGYKK 434
            L+ A +K++ G ++
Sbjct: 540 HLEWAKDKILMGAER 554

>TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.430
           YPR024W
          Length = 740

 Score =  172 bits (436), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 267 KTNVKFDDVCGCDEARAELEEIVDF-LKDPAKYESLGGSLPKGVLLTGPPGTGKTLLARA 325

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF  AR R   I+F DE+           
Sbjct: 326 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 385

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 386 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 442

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GR++I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 443 RGRSDILKHHMKKITMAADVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMQH 502

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 503 FEWAKDKILMGAER 516

>Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}
           similar to Ashbya gossypii AGL274W
          Length = 727

 Score =  172 bits (435), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 147/255 (57%), Gaps = 6/255 (2%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG + PKG+LL GPPGTGKTL ARA
Sbjct: 255 KTNVKFEDVRGCDEARAELEEIVDF-LKDPTKYESLGGNLPKGVLLTGPPGTGKTLLARA 313

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF  AR     IIF DE+           
Sbjct: 314 TAGEAGVDFFFMSGSEFDEIYVGVGAKRIRELFAHARAHAPAIIFIDELDAIGGKRNPKD 373

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 374 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVTVDLPDV 430

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H K +++  G+   +I+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 431 RGRADILQHHMKKVTLAAGVDPYIIARGTPGLSGAELMNLVNQAAVYACQ-QNAIAVDMS 489

Query: 421 FLQ-AVEKVINGYKK 434
            L+ A +K++ G ++
Sbjct: 490 HLEWAKDKILMGAER 504

>CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024w protease
          Length = 745

 Score =  172 bits (435), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 272 KTNVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 330

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 331 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 390

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 391 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 447

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 448 RGRADILKHHMKKITLAPNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMTH 507

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 508 FEWAKDKILMGAER 521

>NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23
          Length = 857

 Score =  172 bits (437), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 157/288 (54%), Gaps = 13/288 (4%)

Query: 127 LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY 186
           L  I KF+    E   P + E+  ++ +   KY   L   P I P+         PDVT+
Sbjct: 496 LSIIQKFIQNFPE---PLNDEQLAQLSI---KYEDFLKALPTIQPTAKREGFATVPDVTW 549

Query: 187 SDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTD 246
           ++VG   +   +L   +  P+  PE +  +GI+ P G+LL+GPPG GKTL A+AVAN + 
Sbjct: 550 ANVGALGKVRVELNMAIVQPIKRPELYEKVGINAPAGVLLWGPPGCGKTLLAKAVANESR 609

Query: 247 ATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNE 306
           A FI + G EL+ KYVGE  R +R++F  AR    C+IFFDE+               + 
Sbjct: 610 ANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSR 669

Query: 307 VQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANI 366
           V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + +I
Sbjct: 670 VVNTLL---TELDGLNDRRGIFVVAATNRPDMIDPAMLRPGRLDKTIFIELPNYEEKVDI 726

Query: 367 FRIHSKSMS--VERGIRWELI--SRLCPNSTGAELRSVCTEAGMFAIR 410
               S+S    +  G+ +  I     C N +GA+L ++  E+ + A++
Sbjct: 727 ITTVSRSSGTPLAEGVDFRKIIQDERCRNFSGADLAALVRESSVLALK 774

 Score =  144 bits (362), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P    + +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PSSDLNSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI +    +V    GE  + +RELFE A++   C++FFDEI            
Sbjct: 263 AGELKVPFISISAPSVVSGMSGESEKKLRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 322

Query: 302 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSMEQTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 380

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEVSRLHILKKMSNNLKIDGEIDFLKLAKLTPGFVGADLKALTTAAGTCAIK 433

>Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  172 bits (435), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +R+LF  AR+R   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 510

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}
           YME1Catalytic subunit of the mitochondrial inner
           membrane i-AAA protease complex, which is responsible
           for degradation of unfolded or misfolded mitochondrial
           gene products; mutation causes an elevated rate of
           mitochondrial turnover
          Length = 747

 Score =  172 bits (435), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +R+LF  AR+R   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.259
           YLR397C
          Length = 778

 Score =  172 bits (436), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/268 (36%), Positives = 146/268 (54%), Gaps = 7/268 (2%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           + PS       E P V +SD+GG +E   K+ E+++LPL + E F+ LG+  PKG+LLYG
Sbjct: 495 VRPSAMREIFLEMPKVYWSDIGGQEELKRKMVEMIQLPLEASETFSRLGVSAPKGVLLYG 554

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 614

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I                 V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 IDALSPDRDGPSSSAAGHV---LTSLLNEIDGVEELNGVVIVGATNRPDEIDPALLRPGR 671

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 406
           +DR +  + PD   R  I    S   S E    ++L  ++R     +GAE+  +C EAG+
Sbjct: 672 LDRHIYVAPPDYAARLQILTKCSSKFSTEEEPDYDLENLARRTEGCSGAEVVLLCQEAGL 731

Query: 407 FAIRARRKVATEKDFLQAVEKVINGYKK 434
            AI     + T++   +  EK ++G  +
Sbjct: 732 AAI--MENLDTKRVEARHFEKALSGISR 757

 Score =  154 bits (390), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 129/231 (55%), Gaps = 6/231 (2%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           + YS VGG  ++ID L++ +ELPL  P  F    + PP+G+LL+GPPGTGKT+  R  AN
Sbjct: 241 LDYSLVGGLAKEIDSLKKTIELPLHQPTLFTRFAVSPPRGVLLHGPPGTGKTMLLRCFAN 300

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
             +A  + + G  +V K++GE    +RE+F+ A+  +  IIF DEI              
Sbjct: 301 TCNAHVLTINGPSIVSKFLGETEATLREIFDEAKKYQPSIIFIDEIDSIAPNRAHDDSGE 360

Query: 304 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 363
                R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD++ R
Sbjct: 361 AE--SRVVATLLTLMDGMGGAGRVVVVAATNRPNAVDPALRRPGRFDQEVEIAVPDVDAR 418

Query: 364 ANIFRIHSKSMSVERGIRWELISRLCPNST----GAELRSVCTEAGMFAIR 410
             I +     M+ +     +   R   + T    GA+L ++C E+ M AI+
Sbjct: 419 LEILKKQFDKMNSDLHTLSDDDIRNIASRTHGYVGADLIALCRESVMKAIQ 469

>Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}
           similar to Ashbya gossypii AFR188W
          Length = 838

 Score =  172 bits (436), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 142/257 (55%), Gaps = 7/257 (2%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY   L   P I P+         PDVT+++VG   +   +L   +  P+  PE +  +G
Sbjct: 502 KYEDFLKALPTIQPTAKREGFATVPDVTWTNVGALTKIRMELNMAIVQPIKRPELYEKVG 561

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 562 ISAPAGVLLWGPPGCGKTLIAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 621

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 622 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIAATNRPD 678

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHSKSMSVERGIRWELI--SRLCPNST 393
            +DPA+LRPGR+D+ +   LPDL  + +I +  I S    +   I   +I     C N +
Sbjct: 679 IIDPAMLRPGRLDKTLFIELPDLTEKHDILKTLIRSNGTPLAPNIDLSVIVSDERCRNFS 738

Query: 394 GAELRSVCTEAGMFAIR 410
           GA+L S+  E+ + A++
Sbjct: 739 GADLASLVRESSVLALK 755

 Score =  147 bits (371), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P    S +GG  + + +L E++ LP+L PE +A+ GI+PP+G+L +GPPG GKT  A A+
Sbjct: 206 PQTDLSSLGGMDDVVAQLMELIGLPILHPEIYASTGIEPPRGVLFHGPPGCGKTSIANAL 265

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 266 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAIAPKRDGGAQ 325

Query: 302 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D   FD      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 326 REME--RRIVAQLLTSMDELSFDKTDGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 383

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R +I +  + ++ +   I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 384 PNEASRMHILKKMTSNLKINGQIDFVKLSKLTPGFVGADLKALVTAAGTCAIK 436

>SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|Q07844 Saccharomyces cerevisiae
           YLL034C RIX7 Putative ATPase of the AAA family required
           for export of pre-ribosomal large subunits from the
           nucleus distributed between the nucleolus nucleoplasm
           and nuclear periphery depending on growth conditions
          Length = 830

 Score =  172 bits (436), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY   L   P I P+         PDVT+S+VG   +   +L   +  P+  PE +  +G
Sbjct: 498 KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALGKTRIELNMAIVQPIKRPELYEKVG 557

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 558 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 617

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
               CIIFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 618 ASVPCIIFFDELDALVPRRDTALSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPD 674

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS----MSVERGIRWELISRLCPNST 393
            +DPA+LRPGR+D+ +   LP+ + + +I +   KS    +S +  I+  +    C N +
Sbjct: 675 MIDPAMLRPGRLDKTLFIELPNYDEKLDIVKTLIKSNGTPLSSDVDIQCIVADERCRNFS 734

Query: 394 GAELRSVCTEAGMFAIR 410
           GA+L ++  E+ + A++
Sbjct: 735 GADLAALVRESSVLALK 751

 Score =  151 bits (382), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 134/233 (57%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P    + +GG  + I +L E++ LP+L PE +A+ G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PTTNLATLGGMDDVIAQLMELIGLPILHPEIYASTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI +    +V    GE  + +R+LF+ A+    C++FFDEI            
Sbjct: 263 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKNLAPCLVFFDEIDAITPKRDGGAQ 322

Query: 302 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D   F+  G   + V+ ATNRP++LDPAL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSFEKTGGKPVIVIGATNRPDSLDPALRRAGRFDREICLNV 380

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEISRLHILKKMSSALKIDGTIDFSKLAKLTPGFVGADLKALTTAAGTCAIK 433

>Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  171 bits (434), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +R+LF  AR+R   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}
           RIX7Putative ATPase of the AAA family, required for
           export of pre-ribosomal large subunits from the nucleus;
           distributed between the nucleolus, nucleoplasm, and
           nuclear periphery depending on growth conditions
          Length = 837

 Score =  172 bits (436), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 146/259 (56%), Gaps = 7/259 (2%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRLELNMAIVQPIKRPELYEKVG 563

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMS--VERGIRWELISR--LCPNST 393
            +DPA+LRPGR+D+ +   LP+ E + +I +  +KS    +   + +E I R   C N +
Sbjct: 681 MIDPAMLRPGRLDKSLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEEIIRNEKCNNFS 740

Query: 394 GAELRSVCTEAGMFAIRAR 412
           GA+L ++  E+ + A++ +
Sbjct: 741 GADLAALVRESSVLALKRK 759

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 133/233 (57%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI +    +V    GE  + +R+LF+ AR+   C++FFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 302 XXXNEVQRTMLELITQLDGFD-PRGNIK---VMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D     + N K   ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSDNLKIDGAIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  172 bits (435), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 98/273 (35%), Positives = 150/273 (54%), Gaps = 15/273 (5%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS----MSVERGIRWELISRLCPNST 393
            +DPA+LRPGR+D+ +   LP+ E + +I +  +KS    +S +      + +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEKIITNEKCNNFS 740

Query: 394 GAELRSVCTEAGMFAIRARRKVATEKDFLQAVE 426
           GA+L ++  E+ + A++        ++F Q+ E
Sbjct: 741 GADLAALVRESSVLALK--------RNFFQSEE 765

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 133/233 (57%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 302 XXXNEVQRTMLELITQLDGFD-PRGNIK---VMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D     + N K   ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--KRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSNNLKIDGIIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  172 bits (435), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 146/257 (56%), Gaps = 7/257 (2%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMS--VERGIRWELI--SRLCPNST 393
            +DPA+LRPGR+D+ +   LP++E + +I +  +KS    +   + +E I  +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNMEEKLDIIKTLTKSHGTPLSGDVDFEKIIKNEKCNNFS 740

Query: 394 GAELRSVCTEAGMFAIR 410
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  147 bits (370), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKTLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 302 XXXNEVQRTMLELITQLDGFD-PRGNIK---VMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D     + N K   ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R +I R  S  + ++  I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILRKMSDDLKIDGAIDFAKLSKLTPGFVGADLKALVTAAGTCAIK 430

>Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  171 bits (433), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +R+LF  AR+R   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 510

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  171 bits (434), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 505 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRVELNMAIVQPIKRPELYEKVG 564

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 565 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 624

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 625 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 681

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS----MSVERGIRWELISRLCPNST 393
            +DPA+LRPGR+D+ +   LP+ E + +I +  +KS    +S +      + +  C N +
Sbjct: 682 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSDDVDFEKIITNEKCNNYS 741

Query: 394 GAELRSVCTEAGMFAIR 410
           GA+L ++  E+ + A++
Sbjct: 742 GADLAALVRESSVLALK 758

 Score =  143 bits (361), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 131/232 (56%), Gaps = 6/232 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P+ +   +GG  + I +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVIAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 302 XXXNEVQRTMLELITQLDGFD-PRGNIK---VMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D     + N K   ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIVGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 409
           P+   R +I +  S  + ++  I +  +++L P   GA+L+++ T AG  AI
Sbjct: 378 PNEVSRLHILKKMSDKLKIDGTIDFAKLAKLTPGFVGADLKALVTAAGTCAI 429

>AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR024W (YME1)
          Length = 732

 Score =  171 bits (432), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG + PKG+LL GPPGTGKTL ARA
Sbjct: 260 KTNVKFEDVRGCDEARAELEEIVDF-LKDPAKYESLGGNLPKGVLLTGPPGTGKTLLARA 318

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF  AR R   IIF DE+           
Sbjct: 319 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 378

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 379 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 435

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GRA+I + H + +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 436 RGRADILQHHMRKVTLAPDVDPSIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMTH 495

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 496 FEWAKDKILMGAER 509

>KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 744

 Score =  170 bits (431), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 140/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 273 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 331

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F  + GSE  + YVG GA+ +RELF  AR R   I+F DE+           
Sbjct: 332 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 391

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 392 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 448

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GR +I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 449 RGRTDILKHHMKKVTLASDVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMNH 508

Query: 421 FLQAVEKVINGYKK 434
           F  A +K++ G ++
Sbjct: 509 FEWAKDKILMGAER 522

>KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]
           {ON} similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 774

 Score =  170 bits (431), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/269 (35%), Positives = 142/269 (52%), Gaps = 5/269 (1%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           I PS       E P V +SD+GG ++   K++E+++LPL +PE F+ L +  PKG+LLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQEDLKLKMKEMIQLPLEAPESFSRLSVSAPKGVLLYG 550

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREVFRKARAAAPSIIFFDE 610

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMS-VERGIRWELISRLCPNSTGAELRSVCTEAGMF 407
           +DR +    PD E R  I R  +K    ++     +  ++     +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFEARLQILRKSTKDFHLIDSDALLQEFAQKTEGCSGAEVVLLCQEAGLA 728

Query: 408 AIRARRKV--ATEKDFLQAVEKVINGYKK 434
           AI           K F +A+  +  G  K
Sbjct: 729 AIMENLDAEKVDRKHFDKAIAGISRGIDK 757

 Score =  160 bits (404), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 134/228 (58%), Gaps = 8/228 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           ++Y+ VGG +++I+ L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 MSYNSVGGLQKEIELLKRTIELPLHQPTLFADFGVTPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
             +A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARIYQPSIIFIDEI---DSLAPSRTSDD 353

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             EV+ R +  L+T +DG    G + V+ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSTGRVVVVAATNRPNAVDMALRRPGRLDQEVEIGIPDVES 413

Query: 363 RANIFRIHSKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGM 406
           R +I     + +S +R  +  E I  +   +    GA+L ++C EA M
Sbjct: 414 RHDILLKQFRKVSEKRHELTLEDIQAIASKTHGYVGADLVALCREAVM 461

>Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C
           (AFG2) - homology to the CDC48 gene product [contig 1]
           FULL
          Length = 774

 Score =  170 bits (431), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 148/277 (53%), Gaps = 6/277 (2%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           I PS       E P V +SD+GG  +   K++E+++LPL + E F  LG++ PKGILLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQHDLKLKMKEMIQLPLEASESFKRLGVNAPKGILLYG 550

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 610

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMF 407
           +DR +    PD + R  I    +K+  +E   +  E ++      +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFDARLQILNKCTKNFHMENQDQMLEDLAHKTEGCSGAEVVLLCQEAGLA 728

Query: 408 AIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQY 444
           AI     + TE    +  EK ++G  +    +  +QY
Sbjct: 729 AI--MENLETENVEQRHFEKALSGISR-GINAEMLQY 762

 Score =  159 bits (403), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 132/228 (57%), Gaps = 8/228 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           ++Y+ VGG  ++I+ L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA 
Sbjct: 237 MSYNSVGGLNKEIELLKRTIELPLHQPTLFAEFGVTPPRGILLHGPPGTGKTMLLRCVAG 296

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
             +A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARLYQPSIVFIDEI---DSLAPSRASDD 353

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             EV+ R +  L+T +DG    G + ++ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSSGRVVIVAATNRPNAIDTALRRPGRLDQEVEIGIPDVES 413

Query: 363 RANIFRIHSKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGM 406
           R +I     + +S +R  +  E I  +   +    GA+L ++C EA M
Sbjct: 414 RHDILTKQFRKVSEKRHELTLEDIESIASKTHGYVGADLVALCREAVM 461

>ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 826

 Score =  170 bits (431), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 153/288 (53%), Gaps = 13/288 (4%)

Query: 127 LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY 186
           L  I KF+    E   P + E+   + +   +Y   L   P I P+         PDVT+
Sbjct: 462 LTIIQKFIQNFPE---PLNDEQLSNLSI---QYEDFLKALPTIQPTAKREGFATVPDVTW 515

Query: 187 SDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTD 246
           + VG   +   +L   +  P+  PE +  +GI  P G+LL+GPPG GKTL A+AVAN + 
Sbjct: 516 ASVGALTKVRVELNMAIVQPIKKPELYEKVGISAPAGVLLWGPPGCGKTLLAKAVANESR 575

Query: 247 ATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNE 306
           A FI + G EL+ KYVGE  R +R++F  AR    C+IFFDE+               + 
Sbjct: 576 ANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDSTLSESSSR 635

Query: 307 VQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANI 366
           V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + +I
Sbjct: 636 VVNTLL---TELDGLNDRRGIFVVGATNRPDMIDPAMLRPGRLDKTLFIELPNAEEKLDI 692

Query: 367 F----RIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
                R +   MS +  +   +    C N +GA++ S+  E+ + A++
Sbjct: 693 LKTLVRTNGTPMSSDVDLETVIADDRCKNFSGADIASLVRESSVLALK 740

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P      +GG ++ + +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 187 PQSRLESIGGMEDVVAQLMELIGLPILHPEIYISTGVEPPRGVLLHGPPGCGKTSIANAL 246

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      F+ +    +V    GE  + +R+LF+ AR+   C++FFDEI            
Sbjct: 247 AGELQVPFLSISAPSVVSGMSGESEKKIRDLFDEARSLAPCLMFFDEIDAITPKRDGGAQ 306

Query: 302 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D  +        + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 307 REME--RRIVAQLLTSMDELNMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 364

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R +I +  ++++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 365 PNELSRVHILKKLAQNLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 417

>KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 814

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 140/257 (54%), Gaps = 7/257 (2%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY   L   P I P+         PDVT+S VG   +   +L   +  P+  PE +  +G
Sbjct: 485 KYEDFLKALPTIQPTAKREGFATVPDVTWSSVGALDKIRIELNMAIVQPIKRPELYEKVG 544

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 545 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFNRAR 604

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
               CIIFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 605 ASVPCIIFFDELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPD 661

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHSKSMSVERGIRWELI--SRLCPNST 393
            +DPA+LRPGR+D+ +   LP+ E + +I R  I S    +   +    I     C N +
Sbjct: 662 MIDPAMLRPGRLDKTLFIELPNFEEKVDIMRTLIRSNGTPIADDVDINRIVNDERCKNFS 721

Query: 394 GAELRSVCTEAGMFAIR 410
           GA++ ++  E+ + A++
Sbjct: 722 GADIAALVRESSVLALK 738

 Score =  144 bits (364), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P    S +GG  + I +L E++ LP+L PE ++A G++PP+G+LL+GPPG GKT  A A+
Sbjct: 194 PSSNLSTLGGMDDVIAQLMELIGLPILHPEIYSATGVEPPRGVLLHGPPGCGKTSIANAL 253

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI +    +V    GE  + +RELF+ A++   C++FFDEI            
Sbjct: 254 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 313

Query: 302 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D   F+      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 314 REME--RRIVAQLLTSMDELSFEKMEGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 371

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R  I +  + S+ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 372 PNETSRYFILKKMASSLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 424

>TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.430
           YPR024W
          Length = 802

 Score =  170 bits (430), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 181 KPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARA 240
           K DV + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 332 KTDVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 390

Query: 241 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXX 300
            A      F+ + GSE  + YVG GA+ +R+LF  AR +   IIF DE+           
Sbjct: 391 TAGEAGVDFLFMSGSEFDEVYVGVGAKRIRDLFAQARAKAPAIIFIDELDAIGGKRNPKD 450

Query: 301 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 360
                  ++T+ +L+ +LDGF     I ++ ATN P+ LD AL RPGR D+ V   LPD+
Sbjct: 451 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPDALDKALTRPGRFDKIVNVDLPDV 507

Query: 361 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 420
            GR++I R H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 508 RGRSDILRHHMKKITLAPDVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 567

Query: 421 FLQAVEKVINGYKK 434
              A +K++ G +K
Sbjct: 568 LEWAKDKILMGAEK 581

>CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034c
          Length = 834

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 145/257 (56%), Gaps = 7/257 (2%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY   L   P I P+         PDVT+S+VG  ++   +L   +  P+  PE +  +G
Sbjct: 503 KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALQKVRIELNMAIVQPIKRPELYEKVG 562

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 563 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 622

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 623 ASVPCVIFFDELDALVPRRDTSMSESSSRVVNTLL---TELDGLNDRHGIFVVGATNRPD 679

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS----MSVERGIRWELISRLCPNST 393
            +DPA+LRPGR+D+ +   LP+ + + +I R  + S    +S +  ++  +    C N +
Sbjct: 680 MIDPAMLRPGRLDKTLFIELPNEQEKFDIIRTLTISNGTPLSKDVDLKEIVADERCRNFS 739

Query: 394 GAELRSVCTEAGMFAIR 410
           GA+L ++  E+ + A++
Sbjct: 740 GADLAALVRESSVLALK 756

 Score =  144 bits (362), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P  + S +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 193 PTSSLSALGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 252

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI +    +V    GE  + +RELF+ A++   C++FFDEI            
Sbjct: 253 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQ 312

Query: 302 XXXNEVQRTMLELITQLDGF---DPRGN-IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D     +  G  + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 313 REME--RRIVAQLLTSMDELTLSNTNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 370

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R +I +  +  + ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 371 PNEISRLHILKKMAGKLKIDGEIDFHKLAKLTPGFVGADLKALTTAAGTCAIK 423

>ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]
           {ON} highly similar to uniprot|P32794 Saccharomyces
           cerevisiae YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18
           (AAA) family forms a hexameric complex may be involved
           in degradation of aberrant mRNAs
          Length = 777

 Score =  169 bits (428), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 153/283 (54%), Gaps = 16/283 (5%)

Query: 141 VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD--------VTYSDVGGC 192
           VS  D+ +     V+ S  ++  P+  R   +    T   KP         + Y  VGG 
Sbjct: 185 VSKCDLNQDSTTTVEDSSPYLSPPVIFRRGSTKVEFTKASKPSSRFNLSHSIGYDSVGGL 244

Query: 193 KEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 252
            ++I+ L+  + LPL  P+ F+  G+ PP+GILL+GPPGTGKT+  R VAN TDA  + +
Sbjct: 245 AKEIEVLKNAIHLPLHKPKLFSEFGVAPPRGILLHGPPGTGKTMLLRCVANTTDAHILTI 304

Query: 253 IGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQ-RTM 311
            G  +V KY+GE    +RE+F+ A+  +  IIF DEI                EV+ R +
Sbjct: 305 NGPSIVSKYLGETEATLREIFDEAKLYQPSIIFIDEI---DSIAPNRASDDSGEVESRVV 361

Query: 312 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHS 371
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD+E R +I     
Sbjct: 362 ATLLTLMDGMGAAGRLVVVAATNRPNNIDPALRRPGRFDQEVEIAIPDVEERIDILMKQF 421

Query: 372 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 410
           + MS E+  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 422 ERMSSEKHSLSAEDIKEVAAKTHGYVGADLTALCRESVMKTIQ 464

 Score =  167 bits (422), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 141/269 (52%), Gaps = 5/269 (1%)

Query: 169 IDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYG 228
           I PS       E P V ++D+GG      K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 492 IRPSAMREIFLEMPKVYWTDIGGQDVLKRKMKEMIQLPLEASETFARLGVSAPKGVLLYG 551

Query: 229 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDE 288
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 552 PPGCSKTLTAKALATESGVNFLAVKGPEIFSKYVGESERAIREIFHKARSAAPSIIFFDE 611

Query: 289 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 348
           I                     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 612 I-DAISSSRDDGGSSTTAASNVLTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 670

Query: 349 IDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 406
           +DR +    PD   R  I +  +   S++    + L  ++      +GAE+  +C EAG+
Sbjct: 671 LDRHIYVGPPDYSARLQILKKCTSKFSIDSQPDYNLEKLAEHTDGCSGAEIVLLCQEAGL 730

Query: 407 FAIRARRKVATEKDFLQAVEKVINGYKKF 435
            AI     V   K   +  EK ++G  + 
Sbjct: 731 AAI--MEDVEANKVESRHFEKALSGISRI 757

>TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON}
           Anc_4.259 YLR397C
          Length = 808

 Score =  169 bits (428), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 146/282 (51%), Gaps = 15/282 (5%)

Query: 171 PSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPP 230
           PS       E P V +SD+GG +E   K++E+++LPL + E F  LG+  PKG+LLYGPP
Sbjct: 525 PSAMREIFLEMPKVYWSDIGGQEELKQKMKEMIQLPLEASETFNKLGVTAPKGVLLYGPP 584

Query: 231 GTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIX 290
           G  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR     IIFFDEI 
Sbjct: 585 GCSKTLTAKALATESGINFFAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDEID 644

Query: 291 XXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRID 350
                         +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR+D
Sbjct: 645 AISSSREGGSGSDVS--NHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGRLD 702

Query: 351 RKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS---TGAELRSVCTEAGMF 407
           R +    PD   R  I +  +     E       +  L   +   +GAE+  +C EAG+ 
Sbjct: 703 RHLYVGPPDFNARLQIIKKCTIKFGSEIQNDEPFLRELSAKTGGCSGAEVVLLCQEAGLS 762

Query: 408 AIRARRKV--ATEKDFLQAVEKVING--------YKKFSSTS 439
           AI A  +V    +  F  A+E +  G        Y++F+S S
Sbjct: 763 AIMADYQVDKVGKHHFQNALEGLSRGITEDMLGYYQQFASRS 804

 Score =  165 bits (418), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 137/232 (59%), Gaps = 8/232 (3%)

Query: 184 VTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVAN 243
           ++Y+ VGG  ++I+ L+  +ELPL  P+ F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 269 LSYNLVGGLNKEIEILKNAIELPLHKPKLFSRFGVSPPRGILLHGPPGTGKTMLLRCVAN 328

Query: 244 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXXXX 303
            ++A  + + G  +V KY+GE    +R+ F  A+  +  IIF DEI              
Sbjct: 329 NSNAHVLTINGPSIVSKYLGETESSLRDFFNEAKKYQPSIIFIDEI---DSIAPNRSSDD 385

Query: 304 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 362
             EV+ R +  L+T +DG    G + V+ ATNRPN++D AL RPGR D+++E  +PD++G
Sbjct: 386 SGEVESRVVATLLTLMDGMGNSGRVVVVGATNRPNSIDSALRRPGRFDQEIEIGIPDVDG 445

Query: 363 RANIFRIHSKSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 410
           R +I       MS ER  +  E I  +   +    GA+L ++C E+ M AI+
Sbjct: 446 RKDILLKQFHKMSSERHSLSDEDIQSIASKTHGYVGADLSALCRESVMKAIQ 497

>KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {ON}
           Anc_4.23 YLL034C
          Length = 785

 Score =  168 bits (426), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY   L   P I P+         PDVT++++G       +L   +  P+  PE +  +G
Sbjct: 454 KYEDFLKALPTIQPTAKREGFATVPDVTWNNIGALSNVRLELNMAIVQPIKRPELYEKVG 513

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           I+ P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 514 INAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 573

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 574 ASIPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 630

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHSKSMSVERGIRW-ELISRL-CPNST 393
            +DPA+LRPGR+D+ +   LP  E + +I +  + S    V   I + E+I+   C N +
Sbjct: 631 MIDPAMLRPGRLDKTIFIELPTKEEKLDILQTLLRSNGTPVAHDIDFAEIINDFRCQNFS 690

Query: 394 GAELRSVCTEAGMFAIR 410
           GA+L ++  E+ + A++
Sbjct: 691 GADLAALVRESSVSALK 707

 Score =  146 bits (368), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P+     +GG  + + +L E++ LP+L PE F   GIDPP+G+LL+GPPG GKT  A A+
Sbjct: 167 PETNLQSLGGMDDVVAQLMELIGLPILHPEIFETTGIDPPRGVLLHGPPGCGKTSIANAL 226

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI V    +V    GE  + +R+LFE A+    C+IFFDEI            
Sbjct: 227 AGELKVPFISVSAPSVVSGMSGESEKKIRDLFEEAQQIAPCLIFFDEIDAITPKRDGGAQ 286

Query: 302 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D    +      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 287 REME--KRIVAQLLTSMDELTLQKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 344

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 345 PNEVSRLHILKKLSSTLKLDGEIDFLQLAKLTPGFVGADLKALITAAGTCAIK 397

>Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {ON}
           complement(29676..32195) [2520 nt, 840 aa]
          Length = 839

 Score =  168 bits (425), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/257 (36%), Positives = 143/257 (55%), Gaps = 7/257 (2%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217
           KY   L   P I P+         PDVT+++VG   +   +L   +  P+  PE +  +G
Sbjct: 512 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALDKTRVELNMAIVQPIKRPELYEKVG 571

Query: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 572 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 631

Query: 278 TRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 632 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 688

Query: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRL----CPNST 393
            +DPA+LRPGR+D+ +   LP+ + + +I +  ++S         EL + +    C N +
Sbjct: 689 MIDPAMLRPGRLDKTLFIELPNEDEKLDIIKTLTRSNGTPLADDVELQTIISDERCRNFS 748

Query: 394 GAELRSVCTEAGMFAIR 410
           GA+L ++  E+ + A++
Sbjct: 749 GADLAALVRESSVLALK 765

 Score =  142 bits (357), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P      +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 205 PSSDLKSLGGMDDVIAQLMELIGLPILHPEIYQSTGVEPPRGVLLHGPPGCGKTSIANAL 264

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI +    +V    GE  + +R+LF+ A+    C++FFDEI            
Sbjct: 265 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKAIAPCLMFFDEIDAITPKRDGGAQ 324

Query: 302 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 325 REME--RRIVAQLLTSMDELSMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 382

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P+   R +I +  S+++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 383 PNEVSRLHILKKMSENLKIDGEIDFAQLAKLTPGFVGADLKALSTAAGTCAIK 435

>TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {ON}
           Anc_4.23 YLL034C
          Length = 861

 Score =  168 bits (425), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 144/261 (55%), Gaps = 15/261 (5%)

Query: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVEL----PLLSPERF 213
           KY   L   P I P+         PDVT+  +G     +DK+R  + L    P+  PE +
Sbjct: 506 KYEDFLKALPTIQPTAKREGFATVPDVTWESIGA----LDKIRAELNLAIVQPVKRPELY 561

Query: 214 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 273
             +GI  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F
Sbjct: 562 EKVGISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVF 621

Query: 274 EMARTRKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 333
             AR    C+IFFDE+               + V  T+L   T+LDG + R  I V+ AT
Sbjct: 622 SRARASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGAT 678

Query: 334 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIF----RIHSKSMSVERGIRWELISRLC 389
           NRP+ +DPA+LRPGR+D+ +   LP+ E + +I     +++   ++ +  +   +    C
Sbjct: 679 NRPDMIDPAMLRPGRLDKTLFIELPNFEEKLDILKTITKVNGTPLASDVDLSIIINDERC 738

Query: 390 PNSTGAELRSVCTEAGMFAIR 410
            N +GA++ S+  E+ + A++
Sbjct: 739 RNYSGADIASLVRESSVLALK 759

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 182 PDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAV 241
           P  + S +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 202 PTSSLSSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 261

Query: 242 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIXXXXXXXXXXXX 301
           A      FI V    +V    GE  + VRELFE A++   C++FFDEI            
Sbjct: 262 AGELQVPFISVSAPSVVSGMSGESEKKVRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 321

Query: 302 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 357
                 +R + +L+T +D           + V+ ATNRP+ LD AL R GR DR++  ++
Sbjct: 322 REME--RRIVAQLLTSMDELSMEKTDGKPVIVIGATNRPDALDAALRRAGRFDREICLNV 379

Query: 358 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 410
           P    R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 380 PSEVSRLHILKKMSNNLRIDGHIDFSKLAKLTPGFVGADLKALVTAAGTCAIK 432

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,258,924
Number of extensions: 1345403
Number of successful extensions: 4553
Number of sequences better than 10.0: 527
Number of HSP's gapped: 3957
Number of HSP's successfully gapped: 644
Length of query: 445
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 332
Effective length of database: 40,524,141
Effective search space: 13454014812
Effective search space used: 13454014812
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)