Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G03762g5.527ON70970934710.0
Kwal_47.186425.527ON30930912541e-168
Kwal_47.18638singletonOFF37738712011e-159
SAKL0G04928g5.527ON89269910701e-133
TDEL0A039105.527ON7498139651e-119
ZYRO0D12562g5.527ON8188608601e-103
Ecym_40655.527ON7217598461e-102
ADR194C5.527ON6373448281e-100
NCAS0F010905.527ON7878517981e-94
YDR422C (SIP1)5.527ON8153647773e-91
Skud_4.6965.527ON8113647712e-90
Smik_4.6975.527ON8173647563e-88
Suva_2.5995.527ON8273627512e-87
NDAI0H016005.527ON8423767479e-87
CAGL0F03047g5.527ON7444017007e-81
TBLA0D016505.527ON10163596504e-72
KNAG0C032305.527ON5613815839e-66
Kpol_1004.215.527ON7553715745e-63
KAFR0E033005.527ON4663535069e-56
Kpol_1023.985.527ON6673795124e-55
TPHA0K005305.527ON6463633978e-40
Skud_5.1363.517ON4182872161e-17
Suva_5.1233.517ON4232862161e-17
KAFR0I023803.517ON4092892114e-17
TDEL0D058503.517ON4042912097e-17
CAGL0A03696g3.517ON4152882098e-17
YER027C (GAL83)3.517ON4172932099e-17
Smik_5.1503.517ON4172932099e-17
Kwal_47.190403.517ON4293012062e-16
Ecym_12103.517ON4503002044e-16
Skud_7.603.517ON4413032011e-15
YGL208W (SIP2)3.517ON4153021954e-15
Suva_7.533.517ON4143041921e-14
SAKL0F02002g3.517ON5032941921e-14
KLTH0G01848g3.517ON4162901902e-14
CAGL0K09350g3.517ON4322891841e-13
AER361C3.517ON4753041841e-13
Smik_7.553.517ON4152871778e-13
KNAG0B036905.527ON3261091623e-11
ZYRO0E08404g3.517ON348571473e-09
KNAG0E015903.517ON423411474e-09
KNAG0B006003.517ON389531474e-09
NDAI0I028903.517ON582401422e-08
KLLA0B00583g3.517ON486411412e-08
TBLA0I032703.517ON433411412e-08
NCAS0F037303.517ON432421403e-08
NDAI0B060103.517ON503421413e-08
Kpol_195.23.517ON435411393e-08
TPHA0A058103.517ON424411394e-08
NCAS0E006203.517ON500401351e-07
KAFR0F041403.517ON3481171277e-07
KNAG0F013302.81ON62670890.048
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G03762g
         (709 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...  1341   0.0  
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   487   e-168
Kwal_47.18638 s47 (907369..908499) [1131 bp, 377 aa] {OFF} [cont...   467   e-159
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   416   e-133
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   376   e-119
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   335   e-103
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   330   e-102
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   323   e-100
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   311   1e-94
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...   303   3e-91
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...   301   2e-90
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...   295   3e-88
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...   293   2e-87
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   292   9e-87
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   274   7e-81
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   254   4e-72
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   229   9e-66
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...   225   5e-63
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   199   9e-56
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   201   4e-55
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   157   8e-40
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    88   1e-17
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    88   1e-17
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    86   4e-17
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    85   7e-17
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    85   8e-17
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    85   9e-17
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    85   9e-17
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    84   2e-16
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    83   4e-16
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    82   1e-15
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    80   4e-15
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    79   1e-14
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    79   1e-14
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    78   2e-14
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    75   1e-13
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    75   1e-13
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    73   8e-13
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    67   3e-11
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    61   3e-09
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    61   4e-09
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    61   4e-09
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    59   2e-08
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    59   2e-08
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    59   2e-08
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    59   3e-08
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    59   3e-08
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    58   3e-08
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    58   4e-08
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     57   1e-07
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    54   7e-07
KNAG0F01330 Chr6 complement(239604..241484) [1881 bp, 626 aa] {O...    39   0.048

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score = 1341 bits (3471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/709 (92%), Positives = 657/709 (92%)

Query: 1   MGNNPSTANMQNKRVSQLAQEPRGRQDSITSQLFPSRTSGRNPESKVGWKSRVLHGNRPS 60
           MGNNPSTANMQNKRVSQLAQEPRGRQDSITSQLFPSRTSGRNPESKVGWKSRVLHGNRPS
Sbjct: 1   MGNNPSTANMQNKRVSQLAQEPRGRQDSITSQLFPSRTSGRNPESKVGWKSRVLHGNRPS 60

Query: 61  ASPASTPPVQSPFRKNYTLEVTTESAPYNLKKSISGNPAPPMCTTTXXXXXXXXXXXXXX 120
           ASPASTPPVQSPFRKNYTLEVTTESAPYNLKKSISGNPAPPMCTTT              
Sbjct: 61  ASPASTPPVQSPFRKNYTLEVTTESAPYNLKKSISGNPAPPMCTTTHASADESSSSSLRD 120

Query: 121 XXXXLSLQNSESQPNRKTSPGLGXXXXXXXVLRSPGPSTPVVKYTKHDAISDQISSITSL 180
               LSLQNSESQPNRKTSPGLG       VLRSPGPSTPVVKYTKHDAISDQISSITSL
Sbjct: 121 HLAELSLQNSESQPNRKTSPGLGPAPAPAPVLRSPGPSTPVVKYTKHDAISDQISSITSL 180

Query: 181 KKMLVEGRVGDNIHPPPTSIDIPRRPSAALSDAYFSDDGDDEESLLQGTNDVVINNSVLE 240
           KKMLVEGRVGDNIHPPPTSIDIPRRPSAALSDAYFSDDGDDEESLLQGTNDVVINNSVLE
Sbjct: 181 KKMLVEGRVGDNIHPPPTSIDIPRRPSAALSDAYFSDDGDDEESLLQGTNDVVINNSVLE 240

Query: 241 NAMKRKRGTKKNKGVGASSESHEHISYPGLKKLKPLEHGGDKRDLPHFRAMHPRPSEDNV 300
           NAMKRKRGTKKNKGVGASSESHEHISYPGLKKLKPLEHGGDKRDLPHFRAMHPRPSEDNV
Sbjct: 241 NAMKRKRGTKKNKGVGASSESHEHISYPGLKKLKPLEHGGDKRDLPHFRAMHPRPSEDNV 300

Query: 301 GPDSAAIPRLITDSLNRIDSFEKGTVEHYEGANESGFSSQNLTXXXXXXXXXXXXXRGPG 360
           GPDSAAIPRLITDSLNRIDSFEKGTVEHYEGANESGFSSQNLT             RGPG
Sbjct: 301 GPDSAAIPRLITDSLNRIDSFEKGTVEHYEGANESGFSSQNLTSSDMRDSDDADEDRGPG 360

Query: 361 THVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFSKIPMVFDMERNCWTAHDLYLPSG 420
           THVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFSKIPMVFDMERNCWTAHDLYLPSG
Sbjct: 361 THVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFSKIPMVFDMERNCWTAHDLYLPSG 420

Query: 421 VYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVKLSKDQI 480
           VYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVKLSKDQI
Sbjct: 421 VYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVKLSKDQI 480

Query: 481 AVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPELRHNNTSS 540
           AVEQPAPERPAL              RHVERSGTPFSDYTGLCSRSELTKPELRHNNTSS
Sbjct: 481 AVEQPAPERPALGSDGSSSSNWKGSSRHVERSGTPFSDYTGLCSRSELTKPELRHNNTSS 540

Query: 541 YDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQ 600
           YDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQ
Sbjct: 541 YDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQ 600

Query: 601 DVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHI 660
           DVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHI
Sbjct: 601 DVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHI 660

Query: 661 VPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYYSNKDGAH 709
           VPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYYSNKDGAH
Sbjct: 661 VPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYYSNKDGAH 709

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  487 bits (1254), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 229/309 (74%), Positives = 261/309 (84%), Gaps = 6/309 (1%)

Query: 401 MVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDS 460
           MVFDME NCW A DLYLP+GVYKFQFLINGELRHS++LPTATDSFGNCVNWFEVV GH  
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 461 IEPSRDVISSEDVKLSKDQIAVEQPAPE---RPALXXXXXXXXXXXXXXRHVERSGTPFS 517
           IEPSRDVIS++    +++Q+A+    P    RP +              +H+ERSGTP+S
Sbjct: 61  IEPSRDVISND---FTENQVAISANDPSASPRPPILSGSSSFSNWKNSAKHIERSGTPYS 117

Query: 518 DYTGLCSRSELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEE 577
           DYTGLCSR++L KPELRH NTSSYDLLAPVPRP YEY++EIPELFKANF+GS  PPPY+E
Sbjct: 118 DYTGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQE 177

Query: 578 RELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDS 637
              +++  +  PSFLHRVQDCNQDVLFADLQ+NG+IDSQAAEEAFLQQYPTPDLPVYLDS
Sbjct: 178 SVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDS 237

Query: 638 SFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIY 697
           SFLNAVF GFQ+K D+K+++NHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIY
Sbjct: 238 SFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIY 297

Query: 698 TPCYYSNKD 706
           TPCYY NK+
Sbjct: 298 TPCYYGNKE 306

>Kwal_47.18638 s47 (907369..908499) [1131 bp, 377 aa] {OFF} [contig
           192] PARTIAL
          Length = 377

 Score =  467 bits (1201), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 240/387 (62%), Positives = 282/387 (72%), Gaps = 13/387 (3%)

Query: 1   MGNNPSTANMQNKRVSQLAQEPRGRQDSITSQLFPSRTSGRNPESKVGWKSRVLHGNRP- 59
           MGNNPSTANMQN+RVSQL  + RGRQDSITSQLFPSRT+GRNPE K GWKSRVLHG R  
Sbjct: 1   MGNNPSTANMQNRRVSQLVNDSRGRQDSITSQLFPSRTTGRNPEEKKGWKSRVLHGKRAG 60

Query: 60  SASPASTPPVQSPFRKNYTLEVTTESAPYNLKKSISGNPAPPMCTTTXXXXXXXXXXXXX 119
           + SP+S P   SPFRK+Y+L+  +E+A YN KKS SGNPAPPMC                
Sbjct: 61  TTSPSSAP---SPFRKDYSLDSASETASYNFKKSASGNPAPPMCIAAHASAEDSSSLLLR 117

Query: 120 XXXXXLSLQNSESQPNRKTSPGLGXXXXXXXVLRSPGPSTPVVKYTKHDAISDQISSITS 179
                LSLQNSESQ +   SP          +L+SPGPS+PVV+ TK +A+ +Q+SS+TS
Sbjct: 118 DHLAELSLQNSESQAHVAASPA--------PLLQSPGPSSPVVQSTKQEALFEQLSSMTS 169

Query: 180 LKKMLVEGRVGDNIHPPPTSIDIPRRPSAALSDAYFSDDGDDEESLLQGTNDVVINNSVL 239
           LKKMLVEGR+GD I+ PP+SIDIPRRPS A+SD Y SDDGDDEESLLQG NDVVINNS+L
Sbjct: 170 LKKMLVEGRIGDQINAPPSSIDIPRRPSVAVSDTYMSDDGDDEESLLQGVNDVVINNSML 229

Query: 240 ENAMKRKRGTKKNKGVGASSESHEHISYPGLKKLKPLEHGGDKRDLPHFRAMHPRPSEDN 299
           ENAMKRKR ++KNK +GAS  S E + + GLKKLKPLE   D+ +LP F AMH RP+E++
Sbjct: 230 ENAMKRKRSSRKNKALGASCSSRETMPHSGLKKLKPLEPASDRINLPSFSAMHARPTEND 289

Query: 300 VGPDSAAIPRLITDSLNRIDSFEKGTVEHYEGANESGFSSQNLTXXXXXXXXXXXXXRGP 359
             PDSAA+PRL+ D+ +RI SFE GTVEHYEG N+S FSSQ +                 
Sbjct: 290 YDPDSAAVPRLVPDTFDRIGSFENGTVEHYEGTNQSDFSSQGVNSSDSGSSDDTNSSIQ- 348

Query: 360 GTHVILNWKDNIVDPKTCKMSIVSKDI 386
            THVIL WKDNIVDPK+CKMSIVSKDI
Sbjct: 349 DTHVILKWKDNIVDPKSCKMSIVSKDI 375

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score =  416 bits (1070), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 279/699 (39%), Positives = 356/699 (50%), Gaps = 165/699 (23%)

Query: 154 SPGPSTPVVKYTKHDA-----------------ISDQISS------ITSLKKMLVEGRVG 190
           SPGP++P V+ T+H+A                   DQ  S      I +LK+ LVEGR+G
Sbjct: 203 SPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSYLHRPSIVALKRSLVEGRIG 262

Query: 191 DNIHPPPT--------------------------------------------SIDIPRRP 206
             +H   +                                            SIDIP R 
Sbjct: 263 SKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSIDIPGRG 322

Query: 207 SAALSD-------AYFSDDGDDEES---------LLQG---TNDVVINNSVLENA----M 243
            AA +           SDD D   S         L +G    NDV++NN+VLE+A    M
Sbjct: 323 HAATATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSEGFLEDNDVLLNNAVLESAIRKDM 382

Query: 244 KRKRGTKK-----NKGVGASSESHEHISYPGLKKLKPL---------EHGGDKRD-LPHF 288
           KRKR  KK      K   +S ES E  +  G+KKLKPL         + G D ++ LP F
Sbjct: 383 KRKRQEKKRPEDQEKSFSSSLESAEPSAISGVKKLKPLTPNEQERQRQVGEDYKNFLPSF 442

Query: 289 RAMHPRPSEDNVGPDSAAIPRLITDSLN--RIDSFEKGTVEHYE---------------- 330
           + +            + A P+L   S N  RIDSFE GTVEH+E                
Sbjct: 443 QPIR-----------TGATPKLFQVSGNGGRIDSFELGTVEHFESIGDDHRTVSGGSNAP 491

Query: 331 --GANESGFSSQNLTXXXXXXXXXXXXXRGPG--THVILNWKDNIVDPKTCKMSIVSKDI 386
             G   +   +                  G     +V+L W+D IVDPKTCK+S++S DI
Sbjct: 492 NGGGKTTSMRANKEAEEEEEEEAAAGARYGEDDLVNVVLKWRDCIVDPKTCKISVISSDI 551

Query: 387 SSTLNPHKKFSKIPMVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFG 446
           S+ L   +   KIPM ++     W   +L LP GVYK QFLINGELRHS++LPTATDSFG
Sbjct: 552 SAVL-ALQSSKKIPMEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFG 610

Query: 447 NCVNWFEVVEGHDSIEPSRDV------------ISSEDVKLSKDQIAVEQPAPERPALXX 494
           N VNWFEV+ G+  IEP RDV            +S ++         +  P P  P L  
Sbjct: 611 NFVNWFEVLPGYYEIEPLRDVPVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLL-- 668

Query: 495 XXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPELRHNNTSSYDLLAPVPRPKYEY 554
                       +++ERS TP+SDYTG+ SRS   +P L    +SSYD+ AP+P  KYEY
Sbjct: 669 -SQATSSSYRSSKYIERSTTPYSDYTGILSRSNSARPLLNQKKSSSYDVFAPLPPKKYEY 727

Query: 555 TDEIPELFKAN------FDGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQDVLFADLQ 608
           + +IPELFK N       D    PP Y    L K    + PSF  RVQDCNQD LF+DLQ
Sbjct: 728 STDIPELFKVNDEEDHDHDIPEDPPSYS--SLLKGSEAEQPSFHCRVQDCNQDRLFSDLQ 785

Query: 609 QNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQ---DKTDSKTRVNHIVPHVN 665
           Q+ +ID+QAAEE FLQ+YP PDLP+YL+SS+LN VF+  Q   +  ++K  VN ++PHVN
Sbjct: 786 QHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVN 845

Query: 666 LNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYYSN 704
           LNHLLTSSIR+EIISVGCTTRYEGKFIT ++Y PCYY N
Sbjct: 846 LNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYEN 884

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 51/99 (51%), Gaps = 20/99 (20%)

Query: 1  MGNNPSTANMQNKRV-SQLAQEPRGRQDSITSQLFPSR-TSGRNPESKVG---------- 48
          MGN  ST N+Q KR  S L   PR RQ SITSQLFP R T     +S V           
Sbjct: 1  MGNTASTVNLQEKRHHSHLL--PRDRQHSITSQLFPGRNTRNAQDDSPVSAAAAAAAPGK 58

Query: 49 WKSRVLHGNRPSASPASTPPVQSP-FRKNYTLEVTTESA 86
          WK R+   + P+    STP   SP F+ NY++  ++ ++
Sbjct: 59 WKRRLSLNHAPAV--VSTP---SPLFKPNYSMNESSNAS 92

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  376 bits (965), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 299/813 (36%), Positives = 399/813 (49%), Gaps = 183/813 (22%)

Query: 1   MGNNPSTANMQNK-----------RVSQLAQEPR-GRQDSITSQLFPSRTSGRNPESKVG 48
           MGN+PS    Q +           R +QL  E   GRQ SITSQLFPSR +       VG
Sbjct: 1   MGNSPSVQEHQQQPHGVLDANHPFRRAQLGNEMNSGRQQSITSQLFPSRNT-----RHVG 55

Query: 49  WKSRVLHGNRPSASPASTPPVQSPFRKNYTLEVTTESAPYNL--KKSISGNPAPPMCTTT 106
             S     NR    P   PP  S F+ +Y+L  T E  P N    ++I  N A       
Sbjct: 56  PHSMNAKRNR---HPHPQPP--SLFKSDYSLRSTAEETPANTGSTENIRDNMA------- 103

Query: 107 XXXXXXXXXXXXXXXXXXLSLQNSESQPNRKTSPGLGXXXXXXXVLRSPGPSTPVVKYTK 166
                             LSL++S       +               +PG STP V+ T+
Sbjct: 104 -----------------GLSLKSSNENAQVPS-------------FLTPGHSTPTVQPTR 133

Query: 167 HDAI---------------SDQIS-------SITSLKKMLVEGRVGDNIHPPPTSIDIPR 204
             A+                 +IS       S+ +LKK L++     +     TS D+  
Sbjct: 134 QAAVPAADLKNKLQNGLNQQKEISSHRFQRPSVVALKKTLLDDGELHSTSSRSTSGDVVS 193

Query: 205 RPSAALSDAYFSD-------------------DGDD--EESLLQGTNDVVINNSVLENA- 242
             S  +  A   D                   D DD  ++  LQ + DVV+N S+L+N  
Sbjct: 194 SASLDIYSALNLDSPTQSGSKAKDTDADPDTSDFDDISDDGYLQ-SEDVVLNQSLLQNVL 252

Query: 243 ---MKRKRGTKKNK--------GVGASS-----ESHEHISYPGLKKLKPLEHGGDKRDLP 286
              MKRKR  KK+K         + ASS     ES E+ + P  KKLK L + G    LP
Sbjct: 253 RRDMKRKRPAKKSKVPNTSHVSNLKASSNSVSYESLENGNVPDAKKLKSLSYDG---SLP 309

Query: 287 HFRAMHPRPSEDNVGPDSAAIPRLITDS-LNRIDSFEKGTVEHYEGANESGFSSQNLTXX 345
            F     +P+  N    +  +  L  D+  NRIDSFEKG+VEH E   E+  + +N +  
Sbjct: 310 SF-----QPTAQN----NDRLNGLAHDNGFNRIDSFEKGSVEHREV--ETSPTMRNSSSA 358

Query: 346 XXXXXXXXXXXRGPGTHVILNWKDNIVDPKTCKMSIVSKDISSTLN-------PHKKFSK 398
                           HVIL W+D I DP  CK++I+S DI+S LN        H  FS 
Sbjct: 359 SPSSSSIISNTEPEKVHVILKWRDQIEDPSKCKITIISTDIASALNFDPSDKSFHGTFS- 417

Query: 399 IPMVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGH 458
             M +D + N +   +L LP G+YKFQF+INGE+RHS+ LP+ATDS GN VNWFEV+ G+
Sbjct: 418 --MKYDEKENNFYVPNLSLPPGIYKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGY 475

Query: 459 DSIEPSRDVIS-SEDVKL-----------------SKDQIAVEQPAPERPALXXXXXXXX 500
           +S+EP R+ I   E++ +                 S  ++ + QP P RP L        
Sbjct: 476 ESVEPFRNEIDYHENMGIDPPQSDSSTSTGKHHDESPGKVPLVQPVPGRPPLAARHTSSY 535

Query: 501 XXXXXXRHVERSGTPFSDYTGLC-SRSELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIP 559
                    ERSGTP+SDYTG+    S + K  L H   SS DL+  +   KYEY++EIP
Sbjct: 536 SNKQ-----ERSGTPYSDYTGVSRCNSAVRKSPLIHQTLSSIDLVTALQPKKYEYSNEIP 590

Query: 560 ELFKANFDGSLVPPPYEER------ELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQI 613
           ELFKA   G+++    E +            S   PSFL  V DCNQD LF  LQQ G +
Sbjct: 591 ELFKA---GNVLGQSDENQFPTPPPPPMNPPSYDQPSFLENVVDCNQDNLFVSLQQGGLL 647

Query: 614 DSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKT---DSKTRVNHIVPHVNLNHLL 670
           D++ AE+ FL++Y  PDLPVYL+S++LN +F+ FQ       + + +NHI+PHVNLNHLL
Sbjct: 648 DAETAEQLFLEKYTVPDLPVYLNSTYLNKIFNEFQKHNSLGSNSSGLNHIIPHVNLNHLL 707

Query: 671 TSSIRDEIISVGCTTRYEGKFITQIIYTPCYYS 703
           TSSIRDE+ISVGCTTRYEGKFITQ++Y PCYY+
Sbjct: 708 TSSIRDEMISVGCTTRYEGKFITQVVYAPCYYA 740

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  335 bits (860), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 280/860 (32%), Positives = 385/860 (44%), Gaps = 193/860 (22%)

Query: 1   MGNNPST--------------ANMQNKRVSQ---LAQEPRGRQDSITSQLFPSRTSGRNP 43
           MGN PS               +N  + R SQ   L +  +GRQ SITSQLFPSR +   P
Sbjct: 1   MGNTPSAHQRVGRKGSENFQESNNSSNRYSQTKYLLEVDKGRQSSITSQLFPSRKTRHAP 60

Query: 44  ESKVGWKSRVLHGNRPSASPASTPPVQSPFRKNYTLEVTTESAPYNLKKSISGNPAPPMC 103
                 K       R + +    PP  S F+KNY+LE  +  A              P  
Sbjct: 61  SGLGNLK-------RKTQNVVPHPP--SLFKKNYSLEEASAGA------------QGPNN 99

Query: 104 TTTXXXXXXXXXXXXXXXXXXLSLQNSESQPNRKTSPGLGXXXXXXXVLRSPGPSTPVVK 163
                                 +  ++ES         +        +  SPGP+TP V+
Sbjct: 100 NNNDNHNVTLMAADDDPRDFNDTKTSTESVRENMAGLSIKSSNETGPMFFSPGPATPTVQ 159

Query: 164 YTKHDAI---SDQI-----SSITSLKKMLVEG-----RVGD--NIHPPPTSID------I 202
            TK +AI    D +      S+ +LKK L E      R G   N+    T ID      +
Sbjct: 160 PTKEEAIPPMDDNMIFHNRQSVVALKKNLEESEQPSSRSGSSANMETRTTPIDNRRLKPL 219

Query: 203 PR--------------------RPSAALSDAYFSDDGDDEESLLQGTNDVVINNSVLENA 242
           PR                    RPS   +D   SD  +  +     + D+V+N S+L N 
Sbjct: 220 PRQAVAAAITATATTAPATPNGRPSID-TDPESSDIDNISDDGYLHSKDIVLNQSLLHNV 278

Query: 243 MKRKRGTKKNKGV----------------GASSESHEHISYPGLKKLKPLEHGG------ 280
           +KR    K++K                  G ++ +  +        L+PL + G      
Sbjct: 279 IKRDMKRKRDKETNDSNNNLVATKTLEQDGGTNNTSTNAFISKNSTLEPLGNHGNPKVHD 338

Query: 281 ------------------DKRDLPHFRAMHPRPS--EDNVGPDSAAIPRLITDSLNR--- 317
                             D  +L H + +    S   D + P ++A+ ++  + L +   
Sbjct: 339 VTINLESESPRGQSGLSYDSLELGHLQDVKKLKSIPHDMIMPHASAVGKIRPEVLQQHGK 398

Query: 318 ---IDSFEKGTVEHYEGANESGFSSQNLTXXXXXXXXXXXXXRGPGTHVILNWKDNIVDP 374
              +DSFEKG+VEH E         +N                    HV + W+D++   
Sbjct: 399 FYSMDSFEKGSVEHRE------VEDRNRNSSLSSLSSSPVSGSSQDVHVAIKWRDHLPVD 452

Query: 375 KTCKMSIVSKDISSTLN----PHKKFSKIPMVFDMERNCWTAHDLYLPSGVYKFQFLING 430
            T +MS+VS+DI+STL+     H   +  PM ++ E   W   DL LP GVY+ QFLING
Sbjct: 453 GTNRMSMVSEDIASTLSFERQKHGARNTFPMRYEEETKEWVVPDLVLPVGVYRLQFLING 512

Query: 431 ELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVI---SSEDVKLSKDQIA------ 481
           EL HS+YLPTATDS GN VNWFEV+ G++ +EP RD +   S + +    + IA      
Sbjct: 513 ELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPYRDEVELDSGQPLNAGNNGIAGSVLSL 572

Query: 482 ---------VEQPAPE----RPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSEL 528
                    + +P P     RP L                V RS TP+SDYTG+   S  
Sbjct: 573 ENQGSEGTVLMEPVPGKVNVRPPLASMHHSS-------NRVIRSNTPYSDYTGISRSSSA 625

Query: 529 TKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKA---------NFD---GSLVPPPYE 576
            +    +  TSS DL   +   KY+Y++EIPELFK          N D   G + PP Y 
Sbjct: 626 LRKSPINCTTSSLDLHTALQPKKYKYSNEIPELFKTAPITKANDENEDFTFGHMEPPTY- 684

Query: 577 ERELTKDGSQKPPS----FLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLP 632
                 D ++  PS    F ++V DCNQD LF +LQQ G +D++ AE+ FL++YP PDLP
Sbjct: 685 ------DWARGHPSSNAGFGNQVVDCNQDELFTELQQGGLLDAETAEQLFLEKYPVPDLP 738

Query: 633 VYLDSSFLNAVFSGFQDKT---DSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEG 689
           +YL+S +LN + S FQ           +NHI+PHVNLNHLLTSSIRDE+ISVGCTTRYEG
Sbjct: 739 IYLNSYYLNRIISEFQKNNYPGGGSGGINHIIPHVNLNHLLTSSIRDEMISVGCTTRYEG 798

Query: 690 KFITQIIYTPCYYSNKDGAH 709
           KFITQ+IY PCYY N    H
Sbjct: 799 KFITQVIYAPCYYENGRTLH 818

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score =  330 bits (846), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 257/759 (33%), Positives = 369/759 (48%), Gaps = 152/759 (20%)

Query: 17  QLAQEPRGRQDSITSQLFPSRTSGRNPESKVGWKSRVLHGNRPSASPASTPPVQSPFRKN 76
           Q   + R RQ SITSQLFP R   R+      WKS+    N    + +    V   F+++
Sbjct: 42  QHGTKERVRQQSITSQLFPGRHQARSK-----WKSQ---RNVAPGAVSGVGGVDHLFKRD 93

Query: 77  YTLEVTTESAPYNLKKSISGNPAPPMCTTTXXXXXXXXXXXXXXXXXXLSLQNSESQPNR 136
           Y+L   + +      +   G     M                               PN 
Sbjct: 94  YSLSDDSSAVGMEGVQEEGGVDLIGM-------------------------------PN- 121

Query: 137 KTSPGLGXXXXXXXVLRSPGPSTPVVKYTKHDA-ISDQIS------SITSLKKMLVEGRV 189
               GL        ++ SPGPS+  V+++K +A IS +++      SI +LK+ L++G +
Sbjct: 122 --VAGLKLDSRAQAIM-SPGPSSATVEHSKLEASISPELAAQVHRPSIVALKQNLIQGHM 178

Query: 190 GDNIHPP---------------PTS-------IDIP-RRPSAALSDAYFSDDGDDEESL- 225
           G  +H P               P+S       IDIP   PS   + +  +   +D  +  
Sbjct: 179 GHPLHSPLRDDYDGDDDDGDTAPSSSYVPSATIDIPYSNPSTMNTLSIIAQHQEDYSTRS 238

Query: 226 ---------LQG---TNDVVIN----NSVLENAMKRKRGTKKNKGVGASS---ESHEHIS 266
                    L G    +DVV++    +SV++N M+RKR  +K     + +     +E   
Sbjct: 239 SAVSISTQDLDGYIENSDVVLSEALVDSVVKNDMRRKRQLQKQSAEASEAINENKNEANQ 298

Query: 267 YPGLKKLKPLEHGGDKRDLPHFRAMHPRPSEDNVGPDSAAIPRLITDSLNRIDSFEKGTV 326
            P +KK K          +P    + P      V      +P+     L    SFE G+V
Sbjct: 299 QPDVKKAK----------VPMSNLLKPSKQMGTV--TGTFLPQ---SELKDSGSFEYGSV 343

Query: 327 EHYEGANESGFSSQNLTXXXXXXXXXXXXXRGPGTHVILNWKDNIVDPKTCKMSIVSKDI 386
           +H E A +  +S                        VI+ W+D  VDP+T K+SI+S DI
Sbjct: 344 QHVEVAADDNYSDDCPER----------------VQVIIKWRDTNVDPRTSKISIISSDI 387

Query: 387 SSTLNPHKKFSKIPMVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFG 446
           +S + P +K  KIPMV+  +  CW A DL LP+G+YK  F ING++RHS+YLPTATDS  
Sbjct: 388 ASVVQPTRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLS 447

Query: 447 NCVNWFEVVEGHDSIEPSRDVISSEDVKLSKDQIAV----------EQPAPE--RPALXX 494
           N VNWFEVV G+D IEP RD      ++ S +++A           E P+P   RP L  
Sbjct: 448 NIVNWFEVVPGYDQIEPYRDAA----IERSPNELAAYNETSLLLTNETPSPANIRPPL-- 501

Query: 495 XXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPEL-RHNNTSSYDLLAPVPRPKYE 553
                       R +ER+ TP SDYTG+ +R+  + P + RH + +S D+     +P   
Sbjct: 502 -INRGTSSSSRARVIERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLI 560

Query: 554 YTDEIPELFK---ANFDGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQDVLFADLQQN 610
           Y+ ++PELFK   A+  GS       + +      Q  P+F+  VQDCNQD LF  LQ+ 
Sbjct: 561 YSSDVPELFKVGNASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEK 620

Query: 611 GQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTD-----SKTRVNHIVPHVN 665
             +++Q AEE FL++Y  PDLP+YL+S+ LN +F+  Q  +       +  + HI+PHVN
Sbjct: 621 WNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVN 680

Query: 666 LNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYYSN 704
           LNHLLTS+IRDEIISVGCTTRYEGKFITQI+Y PCYY N
Sbjct: 681 LNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPCYYEN 719

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  323 bits (828), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 171/344 (49%), Positives = 222/344 (64%), Gaps = 23/344 (6%)

Query: 363 VILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFSKIPMVFDMERNCWTAHDLYLPSGVY 422
           VI+ W+D ++DP+  K+SIVS DI+S ++ + K  K+ MVF  +   W A DL LP G+Y
Sbjct: 308 VIIKWRDCLLDPQRTKLSIVSPDIASVIHKNSK-RKVAMVFSKDEQFWVAPDLRLPPGIY 366

Query: 423 KFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVKLSKDQIAV 482
           K QFLING LRHS++LPTATDS  N VNWFEVV  +D  EP RD  + E+V +  +   +
Sbjct: 367 KLQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRDP-APEEVAMPPESPQL 425

Query: 483 EQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPELRHNNTSSYD 542
             PA  RP L              R VERS TP SDYTG+ SRS   +P L H+ +++  
Sbjct: 426 TAPAAGRPPL---LKRGTSSSSRARVVERSNTPISDYTGI-SRSGSARPLLAHHKSANSI 481

Query: 543 LLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQDV 602
            L+P+PR   +Y+ EIPELFK        PP         D +  P SF   +QDCNQD 
Sbjct: 482 ELSPIPRCVLQYSTEIPELFKPEG----CPP---------DPNTAPGSFNENIQDCNQDE 528

Query: 603 LFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDS----KTRVN 658
           LF  LQ++ ++ +Q AEE  +++YP PDLPVYL+SS+LN +F+  Q  + +    ++   
Sbjct: 529 LFRFLQEDWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLNEIFTKLQRSSVTGDVKRSSFT 588

Query: 659 HIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYY 702
           HI+PHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQI+Y PCYY
Sbjct: 589 HIIPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIMYAPCYY 632

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 113/288 (39%), Gaps = 86/288 (29%)

Query: 23  RGRQDSITSQLFPSRTSGRNPESKVGWKSRVLHGNRPSASPASTPPVQSPFRKNYTLEVT 82
           RGRQ SITSQLF  R   R+      WK     G   SA+  S+  + S F+ +YTL   
Sbjct: 37  RGRQQSITSQLFSGRHHARS-----KWK---FQGAGDSAT-GSSGGIASMFKCDYTLNAD 87

Query: 83  TESAPYNLKKSISGNPAPPMCTTTXXXXXXXXXXXXXXXXXXLSLQNSESQPNRKTSPGL 142
             S      ++  G P                                          GL
Sbjct: 88  ARSISSEQGETCQGMP---------------------------------------NLAGL 108

Query: 143 GXXXXXXXVLRSPGPSTPVVKYTKHDA-ISDQIS------SITSLKKMLVEGRVGDNI-- 193
                   + RSPGPST  V++T  +A +S +++      SI++LK+ L++ +   N   
Sbjct: 109 VLDACTQGI-RSPGPSTATVEHTNLEASMSPELASQTHRPSISALKQSLIQVQGQTNSRH 167

Query: 194 ---------HPPPTSIDIP-RRPSA-ALSDAYFSDDG-----------DDEESLLQGTND 231
                    + P  +IDIP   PS    S  + +DD             D E  ++ + +
Sbjct: 168 RAEDIDTAQYVPSATIDIPCSNPSTNTASVTHRADDSSTRSSLLSLFTQDVEEYIEAS-E 226

Query: 232 VVIN----NSVLENAMKRKRGTKKNKGVG-ASSESHEHISYPGLKKLK 274
           VV+N    +SV+   ++RKR  ++  G   A+ ++ E    P  KK K
Sbjct: 227 VVLNESLVDSVVRKDLRRKRQLQQQCGATRAAEQAAETAKQPDAKKKK 274

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  311 bits (798), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 270/851 (31%), Positives = 375/851 (44%), Gaps = 219/851 (25%)

Query: 1   MGNNPSTAN--------------------MQNKRVSQLAQEPRGRQDSITSQLFPSRTSG 40
           MGNNPS++                     + NK +  L  E +G   SI+S LF ++ S 
Sbjct: 3   MGNNPSSSEHTQKDKEEEEEEEAIKDTIILHNKHLDHLQDERKG---SISSNLFTNKNSS 59

Query: 41  RNPESKVGWKSRVLHGNRPSASPASTPPVQSPFRKNYTL--------EVTTESAPYNLKK 92
           +   + +  +S+V + N         PP    F+K Y++        ++ TE        
Sbjct: 60  KRHATSIMSQSKVTNDN------IQNPPETVFFKKGYSISRSMQDDSDIKTEGQA----T 109

Query: 93  SISGNPAPPMCTTTXXXXXXXXXXXXXXXXXXLSLQNS-ESQPNRKTSPGLGXXXXXXXV 151
             S N   PM +                    LSL+ S E+  NRK+   +         
Sbjct: 110 VDSENIHEPMAS--------------------LSLKTSMENDENRKSFSFM--------- 140

Query: 152 LRSPGPSTPVVKYTKHDAISDQIS-----SITSLKKMLVEGRVGDN-------------- 192
             SPGP+ P V+ TKHD  + + S     SI +LK+ L   +V ++              
Sbjct: 141 --SPGPANPTVEQTKHDVTNKENSFEHRPSIVTLKQTLSGTKVTNDNNIDKLNKTISSSS 198

Query: 193 ------------IHPPPTSIDIPRRPSAALSDA----------------YF--------- 215
                       I     SIDIP+       DA                YF         
Sbjct: 199 NSQSVSTASSSSIANRTGSIDIPKENRYNFKDAMDTIPKQHSVHAYQHDYFTINDENARN 258

Query: 216 ------SDDGDDEESLLQGTNDVVINNSVLENAMKRKRGTKKNKGVGASSESHEHISYPG 269
                 S  GD+ E  +    D+V+N S L++AMKR    +K    GAS+ + + I  P 
Sbjct: 259 GSDGRLSTSGDNSEPGVLQNVDIVLNQSFLKDAMKRDMK-RKRTDTGASTATPD-IEKPT 316

Query: 270 LKKLKP--------LEHGGDK-----------------------------RDLPHFRAMH 292
            KK KP        L+  GDK                             R++   + + 
Sbjct: 317 EKK-KPISATAAMMLKLYGDKNQMEKEEKKSSGSYSYADQYEHSTSQINLREVKKIKHIE 375

Query: 293 PRPSEDNVGPDSAAIPRLITDSLNRIDSFEKGTVEHYEGANESGFSSQNLTXXXXXXXXX 352
               EDN G                I S ++  ++H +    +  SS + +         
Sbjct: 376 NDFVEDNFG----------------ISSPKEIKIQHIDDVKNAPPSSLSSSMSSSSFGPS 419

Query: 353 XXXXRGPGTHVILNWKDNIVDPKTCKMSIVSKDISSTLNPHK--KFSKIPMVFDMERNCW 410
                     V+L W+D I +PK CK+SIVS DISS + P K  K  K+PM+F+     W
Sbjct: 420 SDEQTNDNVQVVLKWRDQIDNPKHCKISIVSDDISSAI-PAKATKAGKLPMLFNPMIKEW 478

Query: 411 TAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISS 470
              +L LP G+Y+ +F ING+L HS++LPTATDS GN VNWFEV+ G+D++EP RD I  
Sbjct: 479 YVPNLLLPPGIYRLKFSINGDLTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRDEIIE 538

Query: 471 EDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTK 530
                +  Q  +    P                        S TP+SDYTG+ SRS    
Sbjct: 539 TTFHTNGSQGTLRDNNPTTIRSRRSSSFVSANGDLA-----SMTPYSDYTGI-SRSNSAL 592

Query: 531 PELRHNNTS-----SYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGS 585
              R +  S       DL  P+   K EY++EIPELFK     S+     +E +   + +
Sbjct: 593 NSKRTSLVSLRGVGKLDLFTPMEPKKIEYSNEIPELFK--ISNSIEDEDDDEGDYGHNET 650

Query: 586 QKP---PSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNA 642
             P   PSF +RV DCNQD LF+DLQ+NG ID++ AE  FL +Y  PDLP+YL+SS+LN 
Sbjct: 651 LSPFEEPSFTNRVVDCNQDKLFSDLQKNGNIDAETAEMLFLNKYQVPDLPIYLNSSYLNK 710

Query: 643 VFSGFQDK---------TDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFIT 693
           +F  FQ +         T S   + HI+PHVNLNHLLTSSIRDEIISV CTTRY+GKFIT
Sbjct: 711 IFLQFQKQHNDPTPSANTASTIGITHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFIT 770

Query: 694 QIIYTPCYYSN 704
           Q++Y PC Y N
Sbjct: 771 QVMYAPCNYGN 781

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score =  303 bits (777), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 166/364 (45%), Positives = 219/364 (60%), Gaps = 29/364 (7%)

Query: 360 GTHVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFS---------------KIPMVFD 404
            T V+L WKD+     T ++ IVS DI+S L   ++ +               +I MV+D
Sbjct: 451 NTLVVLKWKDDGTVAATTEVFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVYD 510

Query: 405 MERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPS 464
                W   DL+LP+G+Y+ QF ING L HS++LPTATDS GN VNWFEV+ G+ +IEP 
Sbjct: 511 DVHKEWFVPDLFLPAGIYRLQFSINGILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPF 570

Query: 465 RDVISSEDVKLSKDQIAVEQPAPERPALXXX-XXXXXXXXXXXRHVERSGTPFSDYTGLC 523
           R+     D+  S+ +  +++  P+RP L               + VER  TPFSDY GL 
Sbjct: 571 RN---EADID-SQVEPTLDEELPKRPELKRFPSSSRKSSYYSAKGVERPSTPFSDYRGLS 626

Query: 524 SRSELT-KPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTK 582
             S +  +        SS DL+A V   +  Y++EIP LF    DGS +    +  ++  
Sbjct: 627 RSSSINMRDSFVRLKASSLDLMAEVKPERLVYSNEIPNLFNIG-DGSTISVKGDSDDV-- 683

Query: 583 DGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNA 642
              Q+PPSF HRV DCNQD LFA LQQ G ID++ AE  FL +YP PDLP+YL+SS+LN 
Sbjct: 684 -HPQEPPSFTHRVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPVPDLPIYLNSSYLNR 742

Query: 643 VFSGFQDKTDSKTR----VNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYT 698
           + +     ++S  R    +NHI+PHVNLNHLLTSSIRDEIISV CTTRYEGKFITQ++Y 
Sbjct: 743 ILNQSNQNSESHERDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVVYA 802

Query: 699 PCYY 702
           PCYY
Sbjct: 803 PCYY 806

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score =  301 bits (771), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 167/364 (45%), Positives = 214/364 (58%), Gaps = 32/364 (8%)

Query: 361 THVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKF---------------SKIPMVFDM 405
           T V+L WK +     T ++SIVS DI+S L   ++                S+I M++D 
Sbjct: 449 TLVVLKWKSDTNMTATTEVSIVSNDIASALKEQREVNLDDDASLDSEKPLNSRIRMIYDS 508

Query: 406 ERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSR 465
               W   DL+LP+G+Y+ QF ING L HS++LPTATDS GN VNWFEV+ G+ +IEP R
Sbjct: 509 VHREWFVPDLFLPAGIYRLQFSINGLLTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFR 568

Query: 466 DVISSEDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLC-S 524
           D  +  D ++   +  +++ AP RP                +  ER GTPFSDY GL  S
Sbjct: 569 DE-ADMDFQM---RSTLDEEAPIRPEPKRLSSSRKSSYYSAKDGERPGTPFSDYRGLSRS 624

Query: 525 RSELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDG 584
            S   +        SS DL+A +   K EY++EIP LF      +     + ER   +D 
Sbjct: 625 NSVFLRGSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIGEASTTTSKDHFERLSPQDR 684

Query: 585 SQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVF 644
               PSF H+V DCNQD LFA LQQ G ID++ AE  FL +YP PDLP+YL+SS+LN + 
Sbjct: 685 ----PSFTHKVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPIPDLPIYLNSSYLNRIL 740

Query: 645 ------SGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYT 698
                 S F D  +    +NHI+PHVNLNHLLTSSIRDEIISV CTTRYEGKFITQ+IY 
Sbjct: 741 NQSNPNSEFHDGDEGG--INHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYA 798

Query: 699 PCYY 702
           PCYY
Sbjct: 799 PCYY 802

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 63/155 (40%), Gaps = 64/155 (41%)

Query: 154 SPGPSTPVVKYTKHD---------AISDQI---------------SSITSLKKMLVEGRV 189
           SPGPS   VK TK D          + D+                SSI +LKK L+E   
Sbjct: 136 SPGPSMATVKQTKSDLDDLSTVNCTVVDETMENERSGHPHHERHRSSIIALKKTLMENSA 195

Query: 190 --------GDNIH----PPPT---SIDIP------RRPSA-ALSDAYFS----------- 216
                     ++H    PP T   SIDIP      ++PS  A    Y S           
Sbjct: 196 TASPSPTRSSSVHSASLPPLTKTGSIDIPVKQTYSKKPSVHAYQYQYLSPDPTFSGNSHT 255

Query: 217 ------DDGDDEESLLQGTNDVVINNSVLENAMKR 245
                 D+ D E  +LQ + D+V+N S+L+NA+K+
Sbjct: 256 GKEANGDNIDAEAGVLQ-SEDMVLNQSLLQNALKK 289

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score =  295 bits (756), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 213/364 (58%), Gaps = 29/364 (7%)

Query: 360 GTHVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFS---------------KIPMVFD 404
            T VIL WK+      T ++SIVS DI+S L   ++                 +I MV+D
Sbjct: 451 STLVILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYD 510

Query: 405 MERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPS 464
                W   DL+LP G+Y+ QF ING L HS+YLPTATDS GN VNWFEV+ G+ +IEP 
Sbjct: 511 NVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPF 570

Query: 465 RDVISSEDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXX-XRHVERSGTPFSDYTGLC 523
           R+    E    S+ +  +E+ +P RP L               + VER  TPFSDY GL 
Sbjct: 571 RN----EADLGSQVEPVLEEESPIRPELKRFSSSSRKSSYYSAKGVERPSTPFSDYRGLS 626

Query: 524 SRSELT-KPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTK 582
             S +  +        SS DL+A +   K EY++EIP LF    DG       E R+   
Sbjct: 627 RSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNI-ADGGTTSVIRESRD--- 682

Query: 583 DGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNA 642
              Q+ PSF ++V DCNQD LFA LQQ G ID++ AE  FL +YP PDLP+YL+SS+LN 
Sbjct: 683 SSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNK 742

Query: 643 VFSGFQDKTDSKTR----VNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYT 698
           + +     ++   R    +NHI+PHVNLNHLLTSSIRDEIISV CTTRYEGKFITQ+IY 
Sbjct: 743 ILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYA 802

Query: 699 PCYY 702
           PCYY
Sbjct: 803 PCYY 806

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score =  293 bits (751), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 167/362 (46%), Positives = 214/362 (59%), Gaps = 34/362 (9%)

Query: 363 VILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFS---------------KIPMVFDMER 407
           VIL WK+N   P T ++SI+S DI+STL    + +               +I M++D   
Sbjct: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528

Query: 408 NCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDV 467
             W   +L+LP G+Y+ QF ING L HS++LPTATDS G  VNWFEV+ G+ +IEP RD 
Sbjct: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588

Query: 468 ISSEDVKLSKDQIAVEQPAPERPA-LXXXXXXXXXXXXXXRHVERSGTPFSDYTGLC-SR 525
             +E    S+    ++  AP RP                 + VER  TPFSDY GL  S 
Sbjct: 589 ADTE----SQVGSTIDVEAPIRPEPKRLSSSSRKSSYYSAKGVERPSTPFSDYRGLSRSN 644

Query: 526 SELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDG- 584
           S   +        SS DL+A +     EY++EIP LF    +GS  P       + +D  
Sbjct: 645 SANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIG-NGSATP-------IQEDLP 696

Query: 585 SQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVF 644
           SQ  PSF H+V DCNQD LFA LQQ G ID++ AE  FL +YP PDLP+YL+SS+LN + 
Sbjct: 697 SQDLPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKIL 756

Query: 645 SGFQDKTDSKTR----VNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           +     ++S  +    +NHI+PHVNLNHLLTSSIRDEIISV CTTRYEGKFITQ+IY PC
Sbjct: 757 NQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816

Query: 701 YY 702
           YY
Sbjct: 817 YY 818

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score =  292 bits (747), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 160/376 (42%), Positives = 214/376 (56%), Gaps = 47/376 (12%)

Query: 362 HVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFSK----------IPMVFDMERNCWT 411
           HV+L W+D I +PK CK++I+S DI + L       K          +PMVF+     W 
Sbjct: 478 HVVLKWRDQIDNPKKCKIAIISDDIVNALESSSSKRKSNTNNNDNNTLPMVFNPMIKEWY 537

Query: 412 AHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSE 471
             +L LP G+Y+ +F IN ++ HS++LPTATDS GN VNWFEV+ G+D++EP RD I   
Sbjct: 538 MPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEIIET 597

Query: 472 DVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVE-----RSGTPFSDYTGLCSRS 526
                         AP +  L                V       S TP+SDY G+   S
Sbjct: 598 TF----------HTAPSQGTLSVHDLTMIRSRRSSSFVSAKSDLSSFTPYSDYAGISRSS 647

Query: 527 ELTKPELRH------NNTSSYDLLAPVPRPKYEYTDEIPELFK-ANFDGSLVPPPYEERE 579
                  +         T+  DL  P+   K  Y+ EIPELFK AN + +       + E
Sbjct: 648 SSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDT------NKME 701

Query: 580 LTKDGSQ--KPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDS 637
           +  DGS   + PSF H+V DCNQD LFADLQ++G ID++ AE  FL +YP PDLP+YL+S
Sbjct: 702 IDDDGSSPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNS 761

Query: 638 SFLNAVFSGFQDK-------TDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGK 690
           ++LN +F+ FQ +         S   + HI+PHVNLNHLLTSSIRDEIISV CTTRY+GK
Sbjct: 762 TYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGK 821

Query: 691 FITQIIYTPCYYSNKD 706
           FITQ++Y PC YS+++
Sbjct: 822 FITQVMYAPCNYSSQE 837

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 88/359 (24%), Positives = 117/359 (32%), Gaps = 149/359 (41%)

Query: 1   MGNNPST-------ANMQNKRVS---------QLAQEPRGRQDSITSQLFPSRTSGRNPE 44
           MGNNPST       A++Q K+           Q  + P+ R+ SITS LF S+  G +  
Sbjct: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSK--GSSKR 58

Query: 45  SKVGWKSRVLHGNRPSASPASTPPVQSPFRKNYTLEVTTESAPYNLKKSISGNPAPPMCT 104
             +  K     GN  S          + F+K+Y+++      P   K  I  N       
Sbjct: 59  HALMPKPIEAQGNIKS---------HNVFKKDYSMD-----EPLTNKGGIKNN------- 97

Query: 105 TTXXXXXXXXXXXXXXXXXXLSLQNSESQPNRKTSPGLGXXXXXXXVLRSPGPSTPVVKY 164
                               LSL  S S   RK S               PGPSTP V+ 
Sbjct: 98  -------DFNDENIHETMASLSLVTS-SDNERKKSMSFAR----------PGPSTPTVQP 139

Query: 165 TKHDAISDQIS---------------------SITSLKKMLVEGRVGDNIHPPP------ 197
           TKHD  S + S                     SI +LK  L E     +IHPP       
Sbjct: 140 TKHDITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAES----SIHPPSDLSKTV 195

Query: 198 ---------------------TSIDIPRRPSAALSDAY---------------------- 214
                                 SIDIPRR S   ++ Y                      
Sbjct: 196 STSSNCQSFSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNEN 255

Query: 215 ------------------FSDDGDDEESLLQGTNDVVINNSVLENAMKRKRGTKKNKGV 255
                              S   DDEES +  + D+V+N S L+NA+KR    K+   +
Sbjct: 256 TNNDGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKRKRTDTI 314

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  274 bits (700), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 160/401 (39%), Positives = 213/401 (53%), Gaps = 76/401 (18%)

Query: 361 THVILNWKD--NIVDPKTCKMSIVSKDISSTLNPHKK--------------FSKIPMVFD 404
           T+VIL W+D  N  + K  K+ +VS +I ++L    K              F+KIP+ +D
Sbjct: 350 TNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYD 409

Query: 405 MERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPS 464
              N W   DLYLP G+Y+ QFL+NG L HSD+LPTATD  GN +NWFEV+ G+D IEP 
Sbjct: 410 SHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPY 469

Query: 465 RD-------VISSEDVKL----------SKDQ------------IAVEQPAPERPALXXX 495
           RD         SS D  L          S D             + ++ PAP +      
Sbjct: 470 RDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSK-----A 524

Query: 496 XXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPELRHNNTSSYD----LLAPVPRPK 551
                      +  E+S T FSDYTG+   + +       NN ++ D       P+    
Sbjct: 525 QASRNSSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKV 584

Query: 552 YEYTDEIPELFKANFDGSLV---------PPPYEERELTKDGSQKPPSFLHRVQDCNQDV 602
           YEY++ IP LF+ + D   V         P  + +R          PSF +RV DCNQD 
Sbjct: 585 YEYSNNIPALFRISCDMEDVDDDNGTENNPRAFYDR----------PSFTNRVVDCNQDA 634

Query: 603 LFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTR---VNH 659
           LF DLQ+ G++D++ AE  FL++Y  PDLPVYL+S++LN +F  F       T+   +NH
Sbjct: 635 LFGDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINH 694

Query: 660 IVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           I+PHVNL HLLTSSIRD I+SV CTTRY GKFITQ+IY PC
Sbjct: 695 IIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 219 GDDEESLLQGTNDVVINNSVLENAMKRKRGTKKNKGVGASS 259
           GD +  +LQGT DVV+N  +LE A+KR    K+   + +S+
Sbjct: 184 GDPDGGMLQGT-DVVLNQELLEQALKRDMKRKRADTMQSST 223

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  254 bits (650), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 140/359 (38%), Positives = 210/359 (58%), Gaps = 31/359 (8%)

Query: 362  HVILNWKDNIVDPKT--CKMSIVSKDISSTL-----NPHKKFSKIPMVFDMERNCWTAHD 414
            +VI+ ++D + + +    K+ ++SKDI++TL     +   + +K+ +V++ +   W   +
Sbjct: 663  NVIIKYRDPMEESEIPETKIQLISKDINTTLHYDTTDLLTENNKMELVYNKDEKAWILPN 722

Query: 415  LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDV-ISSEDV 473
            L LP G+Y+ QFL+N +L+HSD+LPTATD FGN VNWFEV+ G+D IEP RD  ISS D 
Sbjct: 723  LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENISSAD- 781

Query: 474  KLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPEL 533
              + D   ++   PE+                  +  +  TP S+YTG+   + L+    
Sbjct: 782  --NSDGTLMQNIIPEK-------LKTISMTKMAGNGSKGSTPRSNYTGVSRSNSLSASSS 832

Query: 534  RHNNTS-SYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFL 592
                 S + +L  P+   K EY+ EIPE+FK   + +    P +         +K P  L
Sbjct: 833  SSVWKSVNVNLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQYHP-----ERKRPGLL 887

Query: 593  HRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTD 652
            H V DC+Q+ LF DL  +G +D++ AE+ FL +YP P+LP+YL+S ++  +       + 
Sbjct: 888  HNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQPSG 947

Query: 653  S-------KTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYYSN 704
            S          +NHI+PHVNL HLLTSSIR+E+ISV CTTRYEGKF+TQI+YTPC+Y N
Sbjct: 948  SGPPSSLNNNDLNHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYEN 1006

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score =  229 bits (583), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 146/381 (38%), Positives = 201/381 (52%), Gaps = 80/381 (20%)

Query: 363 VILNWKDNIVDP-KTCKMSIVSKDISSTLNPHK----------KFSKIPMVFDMERNCWT 411
           VIL W+D  + P +    +I S DI STL   K          K   + + +D ++  W 
Sbjct: 217 VILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAKKKDWF 276

Query: 412 AHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSE 471
             DLYLP G+Y+ +FLING L HS++LPTATD+ G  VNWFEV+ G+++IEP RD    E
Sbjct: 277 VPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD----E 332

Query: 472 DVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGL--------- 522
            +    D+    QP                         +S T  +DY G+         
Sbjct: 333 SMIGQDDESIDSQPY------------------------KSTTDVTDYAGISRSSSVVSK 368

Query: 523 CSRSELTKPEL--------------RHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDG 568
            S+S L  P L                N T+  + +  +P PKYEY+ EIPELF+  FD 
Sbjct: 369 HSKSNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPELFQ--FDD 426

Query: 569 SLVPPPYEERELTKDG-------SQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEA 621
                  + +E+ K+        + K    L RV + NQD LFA +Q+ G++ ++ AEE 
Sbjct: 427 VNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEY 486

Query: 622 FLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISV 681
           FL ++   DLP+YL+S++LN  FSG          VNHI+PHVNL HLLT+SI+++II V
Sbjct: 487 FLTKFKVSDLPIYLNSTYLNKNFSG---------EVNHIIPHVNLRHLLTTSIKEDIICV 537

Query: 682 GCTTRYEGKFITQIIYTPCYY 702
           GCTTRY GKFITQ+IY PC Y
Sbjct: 538 GCTTRYAGKFITQVIYAPCSY 558

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score =  225 bits (574), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 142/371 (38%), Positives = 196/371 (52%), Gaps = 38/371 (10%)

Query: 363 VILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFSK----IPMVFDMERNCWTAHDLYLP 418
           V L W+D I D +   +SIVS +I S +  +   S+      MV+  + + W    L+LP
Sbjct: 396 VFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEWVTKYLFLP 455

Query: 419 SGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVKLSKD 478
            G+YK QF +NG LRHSDYLPTATD+ GN VNWFEV  G++SIEP RD     D   ++ 
Sbjct: 456 PGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD----NDYVKNEI 511

Query: 479 QIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSEL----TKPELR 534
              + QP P    +               H  R  TP+SD+ G+   S L      P+++
Sbjct: 512 SGGILQPIPNTLGIPSVSSQLSSFSF---HASRPTTPYSDFAGINRSSPLPLREKSPDVK 568

Query: 535 HNNTSSYDL--LAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFL 592
             N   +DL     VP PKY+YT EIPE++KA  D  L      E     +   KPP +L
Sbjct: 569 STN---FDLEFSTAVPEPKYDYTTEIPEIYKA-VDLDLTTAKATETTTDDEDITKPPLYL 624

Query: 593 --------HRVQDCNQDVLFADLQQN--GQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNA 642
                   + V  C+Q  LF  L +N    +++   E+ FL +YP  DLP+YL++ ++N 
Sbjct: 625 GTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNTDYMNK 684

Query: 643 VFS------GFQDKTDSKTR-VNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQI 695
                    G  D    +   VNHIVPHVN+ HLLT +I+D +I+V CT RY GKFITQ+
Sbjct: 685 ALEQHRNIVGVDDVMQEEINVVNHIVPHVNIKHLLTHNIQDSVIAVACTVRYGGKFITQV 744

Query: 696 IYTPCYYSNKD 706
           +Y+PC   N D
Sbjct: 745 VYSPCSVENDD 755

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  199 bits (506), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 190/353 (53%), Gaps = 67/353 (18%)

Query: 364 ILNWKDNIVDPKTCKMSIVSKDISSTL----NPHK----------KFSKIPMVFDMERNC 409
           IL W++ I       ++IVSKDI STL      HK          KF KI +++D+  N 
Sbjct: 157 ILKWREPI--DHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKF-KINLLYDIVTNE 213

Query: 410 WTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVIS 469
           W   +L+LP G+YK QFLING L HS+YLPTAT++ GN VNWFEV+ G+ +IEP RD   
Sbjct: 214 WYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRD--- 270

Query: 470 SEDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELT 529
                  +++I   + +    ++                   S    +DY G+   S + 
Sbjct: 271 -------EERIIHREKSTANESI-------------------SSNSLTDYAGISRSSSIV 304

Query: 530 KPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPP 589
             +    ++S       +   + +YT+EIPE+FK  FD             T + +    
Sbjct: 305 SNKSSLISSSLKLTNLNLNDDEIKYTNEIPEIFK--FDS------------TANSNVNNQ 350

Query: 590 SF---LHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSG 646
           +F   L +V D NQD +FA LQ+  ++++  AE  FL ++   DLP+YL+S+FLN +F  
Sbjct: 351 AFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFI- 409

Query: 647 FQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTP 699
              + ++    N+ VPHVNLNHLLT+SI+D+ + V CTTRY GKFITQI+Y P
Sbjct: 410 ---RDNNNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  201 bits (512), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 128/379 (33%), Positives = 194/379 (51%), Gaps = 61/379 (16%)

Query: 361 THVILNWKDNIVDPKTCK-MSIVSKDISSTLNPHKK----FSKIPMVFDMERNCWTAHDL 415
            +V+L W+D+ +  +TCK +SI+S+DI +++          S   M +D   N W   DL
Sbjct: 310 VNVVLRWRDSYIQNETCKSVSIISEDILTSVQAQNSGVLLISNFSMTYDKNENNWVLPDL 369

Query: 416 YLPSGVYKFQFLING-ELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEP---------SR 465
           +LP G Y+ +FLI+  + R+S+YLP   D  G  +N  E++ G+ S+EP           
Sbjct: 370 FLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFEHNNHIMIQE 429

Query: 466 DVISSEDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSR 525
           ++I+SE + L+  +    +P P  P L                 E   +P      + S 
Sbjct: 430 NIINSE-LSLNNSRQLQSEP-PSYPELE----------------ENFSSPIE---SIISE 468

Query: 526 SELTKPEL-----RHNNTSSYDLLAPVPRP---KYEYTDEIPELFKANFDGSLVPPPYEE 577
            EL   +      + NN+      +   +P   +  YT+EIP+LFK   +  +V   YE 
Sbjct: 469 DELDNDQYSKVYGKRNNSIGQSKTSLSIKPCISEVTYTNEIPQLFKITDNNCIVNENYER 528

Query: 578 RELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDS 637
               +  S   P   +RV DCNQD+LFA  QQNG +D + AE+ FL++YP PDLPV+LDS
Sbjct: 529 YGFVEPPSYGEPGLENRVIDCNQDILFATFQQNGAVDVELAEQLFLEKYPVPDLPVFLDS 588

Query: 638 SFLNAVFSGFQDKTDSKTRVNHI-------------VPHVNLNHLLTSSIRDEIISVGCT 684
            F   +F    D  DS   +N +             +PHVNLNH+LT+ I + +ISV CT
Sbjct: 589 HFSEKLF----DNNDSSKNLNDMNGEDIQIKNNGQDIPHVNLNHVLTNKISNGMISVACT 644

Query: 685 TRYEGKFITQIIYTPCYYS 703
           TRY+ KF+T I+Y+P  +S
Sbjct: 645 TRYKRKFVTHILYSPSTHS 663

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score =  157 bits (397), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 116/363 (31%), Positives = 179/363 (49%), Gaps = 54/363 (14%)

Query: 361 THVILNWKDNIVDPKTCK-MSIVSKDISSTLNPHK----KFSKIPMVFDMERNCWTAHDL 415
           T V L W D+   P   + +SI+S+DI   +N ++    K  ++P+ +D   + W   DL
Sbjct: 312 TRVTLRWIDSKFKPNNYQSVSIISEDIIDVINFYRSNNDKIKRLPLKYDSLTHEWKISDL 371

Query: 416 YLPSGVYKFQFLIN-GELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVK 474
           +LP+G Y+F FLIN  ++ HS ++ T  D FG  VN+FEV +   + EP         ++
Sbjct: 372 FLPAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVRTFEP---------LQ 422

Query: 475 LSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPELR 534
           LS     V Q A +R                 RH+E S T  S++  L    ++ +    
Sbjct: 423 LSSALYTVTQ-ADDR-----------------RHIECSKTS-SEFLNLLDNYDI-RTRYN 462

Query: 535 HNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELT--KDGSQKPPSFL 592
            N  S  +          +YT++IPELFK  F    +     E E+T  +  S   PSF 
Sbjct: 463 ANFYSHNESGTGNNFNNNKYTNQIPELFK--FSEKNIRELSTETEITFLEPPSYGEPSFY 520

Query: 593 HRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTD 652
           + + DC+Q+ LF  LQQNG +DS  AE+  LQ+YP  +LP++ ++  +  + S   +   
Sbjct: 521 NNIVDCSQEKLFLSLQQNGAVDSYVAEQVILQRYPVSELPIFFENISMEKLASHNNNLNK 580

Query: 653 SKTRVNHIV---------------PHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIY 697
           S T  + +                PHV LNHL+T  I   ++SV  TTRY+ K+ITQI+Y
Sbjct: 581 SHTNKHWLEGLTPNESDNITPKEPPHVILNHLVTQKISRNVVSVAVTTRYKQKYITQILY 640

Query: 698 TPC 700
           +P 
Sbjct: 641 SPI 643

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 116/287 (40%), Gaps = 75/287 (26%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVK 474
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ EV    D     +  ++     
Sbjct: 205 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVSAPPDWTNEPQQQVTDNKAY 264

Query: 475 LSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSD-YTGLCSRSELTKPEL 533
            + D  + ++P   R  +                +E+      D YT             
Sbjct: 265 HADDNQSTKRPMSARSRIAL-------------EIEKEPDDMGDGYTRF----------- 300

Query: 534 RHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLH 593
            H+ T S        +P  EYT +IP +F         P   E+  LT            
Sbjct: 301 -HDETPS--------KPNLEYTQDIPAVFTD-------PNVMEQYYLT------------ 332

Query: 594 RVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDS 653
                              +D Q      +     P LP +L++  LN+ +S  Q  TD+
Sbjct: 333 -------------------LDQQQNNHQNMAWLTPPQLPPHLENVILNS-YSNAQ--TDN 370

Query: 654 KTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
            +    I  HV LNHL TSSI+   + V    RY+ K++TQI+YTP 
Sbjct: 371 TSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 417

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 114/286 (39%), Gaps = 70/286 (24%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVK 474
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ EV    D     +   S     
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSNEPQQQASDNKSN 266

Query: 475 LSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPELR 534
            + D  + ++P   R  +                +E+                  +P+  
Sbjct: 267 HADDSQSAKRPMSARSRIAL-------------EIEK------------------EPDDM 295

Query: 535 HNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLHR 594
            +  + +   AP P+P  EYT +IP +F         P   E+  LT             
Sbjct: 296 GDGYTRFHDEAP-PKPDLEYTQDIPAVFTD-------PNVMEQYYLT------------- 334

Query: 595 VQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSK 654
                             +D Q      +     P LP +L++  LN   +   D  ++ 
Sbjct: 335 ------------------LDQQQNNHQNMAWLTPPQLPPHLENVILNNYSNAQTDNNENT 376

Query: 655 TRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           +    I  HV LNHL TSSI+   + V    RY+ K++TQI+YTP 
Sbjct: 377 SGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 422

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 114/289 (39%), Gaps = 61/289 (21%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSI--EPSRDVISSED 472
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ EV+     +   P+     + D
Sbjct: 178 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVIAPATEVTGAPTTTTFGTWD 237

Query: 473 VKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPE 532
                 Q   +       ++                +ER      D  G  SR     P+
Sbjct: 238 SSAQSQQAQQQNLQQNEASIKVENQPLSARSRIALQIEREPDEMGD--GF-SRFHDEMPQ 294

Query: 533 LRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFL 592
                           +P+Y+YT +IP +F         P   E+  LT           
Sbjct: 295 ----------------KPQYDYTQDIPAVFTD-------PTVMEQYYLT----------- 320

Query: 593 HRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTD 652
                               +D Q      +     P LP +L++  LN+ +S  Q +++
Sbjct: 321 --------------------LDQQQNNHQNMAWLTPPQLPPHLENVILNS-YSNSQGESN 359

Query: 653 SKTRVNHIVP-HVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
             T     +P HV LNHL TSSI+   + V    RY  K++TQI+Y P 
Sbjct: 360 ENTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYRQKYVTQILYAPL 408

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 85.1 bits (209), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 119/291 (40%), Gaps = 79/291 (27%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVV-----EGHDSIEPSRDVIS 469
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ EV+     E   + +  RD  +
Sbjct: 187 LQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVIAPPSQEKPQTKDKQRDNEN 246

Query: 470 SEDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELT 529
             DV   K    V   A  R AL              +  +  G  F+ +     R ELT
Sbjct: 247 KNDVARRKTTDPVS--ARSRIAL-----------EIEKEPDEIGNGFTRF-----REELT 288

Query: 530 KPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPP 589
                               P  EYT +IP +F                          P
Sbjct: 289 L------------------GPSLEYTQDIPAVFTD------------------------P 306

Query: 590 SFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQD 649
           + +       Q  L  D QQN   +      A+L     P LP +L++  LN+  +   D
Sbjct: 307 TVME------QYYLTLDQQQNNHQNM-----AWLT---PPQLPPHLENVPLNSYTNSQND 352

Query: 650 KTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
             ++ +    I  HV LNHL TSSI+   + V    RY+ K++TQI+Y P 
Sbjct: 353 SNENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 403

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 85.1 bits (209), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 116/288 (40%), Gaps = 77/288 (26%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEV--VEGHDSIEPSRDVISSED 472
           L LP G ++F+F+++ ELR SD+LPTATD  GN VN+ E+  V G D             
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIAPVAGTD------------- 248

Query: 473 VKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPE 532
                     E+P P  P +              +  +    P S  + +    E  +P+
Sbjct: 249 ----------EKPPPLTPQV------------SGKSGDERKEPMSARSRIALEIE-REPD 285

Query: 533 LRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFL 592
              N  S +   +P+   KYEYT +IP +F         P   E+  LT           
Sbjct: 286 DLGNGYSRFHDTSPL-ETKYEYTQDIPAVFTD-------PNVMEQYYLT----------- 326

Query: 593 HRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTD 652
                               +D Q      +     P LP +L++  LN+  +   +  +
Sbjct: 327 --------------------LDQQKNNHQNMAWLTPPQLPPHLENVILNSYSNAQGESNE 366

Query: 653 SKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           + +    I  HV LNHL TSSI+   + V    RY+ K++TQI+Y P 
Sbjct: 367 NNSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 414

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 85.1 bits (209), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 86/293 (29%), Positives = 121/293 (41%), Gaps = 87/293 (29%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHD-SIEPSRDVISS--- 470
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ EV    D   EP + +      
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVSAPPDWGNEPQQHLAEKKAN 263

Query: 471 --EDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSD-YTGLCSRSE 527
             +D KLSK  ++    A  R AL                +E+      D YT       
Sbjct: 264 HVDDSKLSKRPMS----ARSRIAL---------------EIEKEPDDMGDGYTRF----- 299

Query: 528 LTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQK 587
                  H+ T +        +P  EYT +IP +F         P   E+  LT      
Sbjct: 300 -------HDETPA--------KPNLEYTQDIPAVFTD-------PNVMEQYYLT------ 331

Query: 588 PPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGF 647
                                    +D Q      +     P LP +L++  LN+ +S  
Sbjct: 332 -------------------------LDQQQNNHQNMAWLTPPQLPPHLENVILNS-YSNA 365

Query: 648 QDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           Q  TD+ +    I  HV LNHL TSSI+   + V    RY+ K++TQI+YTP 
Sbjct: 366 Q--TDNTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 85.1 bits (209), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 86/293 (29%), Positives = 122/293 (41%), Gaps = 87/293 (29%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHD-SIEPSRD-----VI 468
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ EV    D S EP +        
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSSEPQQQGSDNKAN 263

Query: 469 SSEDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSD-YTGLCSRSE 527
            ++D KL+K  ++    A  R AL                +E+      D YT       
Sbjct: 264 YADDDKLNKRPMS----ARSRIAL---------------EIEKEPDDMGDGYTRF----- 299

Query: 528 LTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQK 587
                  H+ T +        +P  EYT +IP +F         P   E+  LT      
Sbjct: 300 -------HDETPA--------KPNLEYTQDIPAVFTD-------PNVMEQYYLT------ 331

Query: 588 PPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGF 647
                                    +D Q      +     P LP +L++  LN+ +S  
Sbjct: 332 -------------------------LDQQQNNHQNMAWLTPPQLPPHLENVILNS-YSNA 365

Query: 648 QDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           Q  TD+ +    I  HV LNHL TSSI+   + V    RY+ K++TQI+YTP 
Sbjct: 366 Q--TDNTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 90/301 (29%), Positives = 129/301 (42%), Gaps = 55/301 (18%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVV---EGHDSIEPSRDVISSE 471
           L LP G ++F+F+++ ELR SD+LPTATD  GN VN+ E+V   E  D I+  +     +
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIVSPTESEDHIQQQQPQQQQQ 227

Query: 472 DVKLSKDQIAVEQPA-PERPALXXXXXXXXXXXXXXRHVERSGT--PFSDYTGLCSRSEL 528
             +  + Q   +Q    + PA                H    GT  P S    L +RS+L
Sbjct: 228 QQQQQQQQQQQKQALDSQYPAQIGSDDKSQVSAQVPDHKRHRGTRPPDSKSEPLSARSKL 287

Query: 529 T-----KPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKD 583
                 +P+   +  S +   A    P Y YT +IP +F    D S++            
Sbjct: 288 ALQIEEEPDDMGDGYSRFHGAAEA-SPDYSYTTDIPAVFT---DSSVM------------ 331

Query: 584 GSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAV 643
                           Q  L  D QQN Q        A+L     P LP +L++  LN  
Sbjct: 332 ---------------EQYYLTLDQQQNNQ-----QSMAWLT---PPQLPPHLENVILNN- 367

Query: 644 FSGFQDKTDSKTRVNH----IVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTP 699
           +S   +  DS +  N     I  HV LNHL TSSI+   + V    RY+ K+ TQI+Y+P
Sbjct: 368 YSSQSEPGDSGSENNSGALPIPNHVVLNHLATSSIKHSTLCVASIVRYKRKYATQILYSP 427

Query: 700 C 700
            
Sbjct: 428 L 428

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 124/300 (41%), Gaps = 79/300 (26%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVK 474
           L LP G ++F+F+++ ELR SD+LPTATD  GN VN+ E+V    +  PS++   + D++
Sbjct: 217 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIV----ASPPSQEQQPASDLQ 272

Query: 475 LSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVE--RSG------TPFSDYTGLCSRS 526
              D+  +                        +HVE  R G          +  G+ SRS
Sbjct: 273 YVSDEGPI-----------------------SKHVENIREGRSDAASAAVDEERGMSSRS 309

Query: 527 ELT-----KPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELT 581
           +L       P+   +  + +   +    P YE+T +IP +F                   
Sbjct: 310 KLALQIEDDPDDMGDGYTRFREESK-EIPVYEFTQDIPAVF------------------- 349

Query: 582 KDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLN 641
                  PS +       Q  L  D Q+N Q +        L     P LP +L+   LN
Sbjct: 350 -----TDPSVM------GQYYLTLDQQKNNQQN--------LAWLTPPQLPPHLEHVILN 390

Query: 642 AVFSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCY 701
                    +++ +    I  HV LNHL TSSI+   + V    RY+ K+ TQI+Y P +
Sbjct: 391 HYNKSADGASENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKSKYATQILYAPLH 450

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 119/303 (39%), Gaps = 81/303 (26%)

Query: 399 IPMVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGH 458
           I ++ D  +N      L L  G ++F+F+++ ELR SD+LPTATD  GN VN+ EV +  
Sbjct: 216 IGLIPDANKNGLFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQPQ 275

Query: 459 DSIEPSRDVISSEDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSD 518
             +        ++D K  K    ++ P  +R ++                + +    F D
Sbjct: 276 KKL--------TDDKKRFKKAYLMQPPTSDRSSIAL-------------QIGKDPDDFGD 314

Query: 519 -YTGLCSRSELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEE 577
            YT              H + S        P+P  EYT  IP +F               
Sbjct: 315 GYTRF------------HEDLS--------PKPSLEYTTNIPAVFTD------------- 341

Query: 578 RELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDS 637
                      PS + R           D +QN    S             P LP  L++
Sbjct: 342 -----------PSVMERY------YYTLDREQNQNDTSWLT---------PPQLPPQLEN 375

Query: 638 SFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIY 697
             LN  ++      ++ +    I  HV LNHL+TSSI+   + V    RY+ K++TQI+Y
Sbjct: 376 VILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILY 435

Query: 698 TPC 700
           TP 
Sbjct: 436 TPI 438

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 125/302 (41%), Gaps = 81/302 (26%)

Query: 399 IPMVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGH 458
           I ++ D + N      L L  G ++F+F+++ ELR SD+LPTATD  GN VN+ EV +  
Sbjct: 190 IGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQPE 249

Query: 459 DSIEPSRDVISSEDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSD 518
            +  P+ + I S      K+  ++  P  +R ++                + +    F D
Sbjct: 250 KN--PTNEKIRS------KEADSMRPPTSDRSSIAL-------------QIGKDPDDFGD 288

Query: 519 -YTGLCSRSELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEE 577
            YT              H + S        PRP  EYT +IP +F               
Sbjct: 289 GYTRF------------HEDLS--------PRPPLEYTTDIPAVFTD------------- 315

Query: 578 RELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDS 637
                      PS + R           D QQ+        + ++L     P LP  L++
Sbjct: 316 -----------PSVMERY------YYTLDRQQSN------TDTSWLT---PPQLPPQLEN 349

Query: 638 SFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIY 697
             LN  ++      ++ +    I  HV LNHL+TSSI+   + V    RY+ K++TQI+Y
Sbjct: 350 VILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILY 409

Query: 698 TP 699
           TP
Sbjct: 410 TP 411

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 124/304 (40%), Gaps = 83/304 (27%)

Query: 399 IPMVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGH 458
           I +V D +++      L L  G ++F+F+++ ELR SD+LPTATD  GN VN+ EV    
Sbjct: 189 IGLVPDSDKSGSFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEVRH-- 246

Query: 459 DSIEPSRDVISSEDVKLSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSD 518
               P +  I   ++  SK + +V+ P  +R ++                + +    F D
Sbjct: 247 ----PDKKSIDGTNI--SKTKYSVKPPISDRSSIAL-------------QIGKDPDDFGD 287

Query: 519 -YTGLCSRSELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEE 577
            YT              H + S        P+P  EYT +IP +F               
Sbjct: 288 GYTRF------------HEDLS--------PKPPAEYTTDIPAVFTD------------- 314

Query: 578 RELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDS 637
                      PS + R           D ++N    S             P LP  L++
Sbjct: 315 -----------PSVMERY------YYTLDREKNKNDTSWLTP---------PQLPPQLEN 348

Query: 638 SFLNAVFSGFQDKTDSKTRVNHIVP-HVNLNHLLTSSIRDEIISVGCTTRYEGKFITQII 696
             LN  +   QD+ +        +P HV LNHL+TSSI+   + V    RY+ K++TQI+
Sbjct: 349 VILNK-YCTTQDQVNENNSGALPIPNHVVLNHLITSSIKHNTLCVSSIVRYKQKYVTQIL 407

Query: 697 YTPC 700
           YTP 
Sbjct: 408 YTPI 411

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 117/294 (39%), Gaps = 52/294 (17%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVK 474
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ E+V    S + S    + +   
Sbjct: 253 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEIVPPQPSHQVSEPQEAQQQEH 312

Query: 475 LSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPELR 534
             + Q   +                            S  P S  + L  + E    ++ 
Sbjct: 313 EQQQQEQPQPQPQHDQQQQQQQQYQKPEPQIKYKASGSSAPTSARSTLALQIEEDPDDMG 372

Query: 535 HNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLHR 594
           +  T  ++ +     PKYE+T +IP +F         P   E+  LT             
Sbjct: 373 NGYTRFHEEIQ--SGPKYEFTQDIPAVFTD-------PSVMEQYYLT------------- 410

Query: 595 VQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLN--------AVFSG 646
                             +D Q   +  L     P LP +L++  LN        A  SG
Sbjct: 411 ------------------LDQQQNNQQSLSWLTPPQLPPHLENVILNNYSANSAQAEESG 452

Query: 647 FQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
            ++ + +    NH+V    LNHL TSSI+   + V    RY+ K+ TQI+Y P 
Sbjct: 453 GENNSGALPIPNHVV----LNHLATSSIKHNTLCVASIVRYKSKYATQILYAPL 502

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 122/290 (42%), Gaps = 46/290 (15%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVK 474
           L LP G ++F+F+++ ELR SDYL TATD  GN VN+ E +   DS +  +     +  +
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLE-ISPQDSQQQLQLQQQQQQQQ 226

Query: 475 LSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTKPELR 534
             + Q       P++P                R  E +  P S  + L  + E  +P+  
Sbjct: 227 QQQPQQLQPLQQPQQPQPQEQPQHPANYPPRSRRAEAAAEPLSARSKLALQIE-EEPDDM 285

Query: 535 HNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLHR 594
            +  S +   A    P Y YT +IP +F    D S++                       
Sbjct: 286 GDGYSRFHGGAEA-TPAYSYTTDIPAVFT---DSSVM----------------------- 318

Query: 595 VQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSK 654
                Q  L  D QQN Q        A+L     P LP +L++  LN  +S   D   S 
Sbjct: 319 ----EQYYLTLDQQQNNQ-----QSMAWLT---PPQLPPHLENVILNN-YSNSSDPGGSG 365

Query: 655 TRVNH----IVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           +  N     I  HV LNHL TSSI+   + V    RY+ K+ TQI+Y+P 
Sbjct: 366 SENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKRKYATQILYSPL 415

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 114/289 (39%), Gaps = 72/289 (24%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVK 474
           L L  G ++F+F+++ +LR SD LPTATD  GN VN+ EV     S  P  D  SS   K
Sbjct: 213 LQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV-----SAVPKSDSTSSRTGK 267

Query: 475 LSKD--QIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSDYTGLCSRSELTK-P 531
             KD  + +V + + +R  +                      P S  +  C   E+ K P
Sbjct: 268 ERKDKNKKSVSKVSKDRSTVG---------------------PLSARS--CIALEIEKEP 304

Query: 532 ELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSF 591
           +   +  + Y    P   PKYE++ EIP +F    D S++     ER+  K  +      
Sbjct: 305 DDFGDGYTRYHEELP-QEPKYEFSSEIPAIF---VDQSIIEQLTMERQRKKSNN------ 354

Query: 592 LHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKT 651
                                          +     P LP  L++  LN         T
Sbjct: 355 -------------------------------MSWLTPPQLPPQLENVILNKFGEPLSQST 383

Query: 652 DSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           ++      I  H  LNHL+T+SI+   + V    RY  K+++QI Y P 
Sbjct: 384 ENNAGALPIPNHSVLNHLVTTSIKHNTLCVATNNRYRQKYVSQIYYVPL 432

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 120/304 (39%), Gaps = 51/304 (16%)

Query: 399 IPMVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGH 458
           I +V D  R       L LP G ++F+F+++ ELR SD+L TATD  GN VN+ E+V   
Sbjct: 220 IGLVADPARPGVFQIKLQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIVSPQ 279

Query: 459 DSIEPSRDVISSEDVKLSKDQIAVEQ--PAPERPALXXXXXXXXXXXXXXRHVERSGTPF 516
            + +       +  ++   DQ       P+  RP                    R+    
Sbjct: 280 PAGQQHIQAPHAPRLQAPFDQAQSTHTNPSDLRP---------DDARIDGDAYSRTEKQM 330

Query: 517 SDYTGLCSRSELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYE 576
           S  + L  + E    ++    T  ++ +    +P YE+T +IP +F              
Sbjct: 331 SARSKLALQIEEEPDDMGDGYTRFHEEIK--TKPAYEFTQDIPAVFTD------------ 376

Query: 577 ERELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLD 636
                       PS +       Q  L  D QQ+ Q +        L     P LP +L+
Sbjct: 377 ------------PSVM------GQYYLTLDQQQHNQQN--------LAWLTPPQLPPHLE 410

Query: 637 SSFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQII 696
              LN         +++ +    I  HV LNHL TSSI+   + V    RY+ K+ TQI+
Sbjct: 411 HVILNHYNKSADGVSENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKQKYATQIL 470

Query: 697 YTPC 700
           Y P 
Sbjct: 471 YAPL 474

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 114/287 (39%), Gaps = 81/287 (28%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVK 474
           L L  G ++F+F+++ ELR SD+LPTATD  GN VN+ EV       EP +   +++  +
Sbjct: 206 LRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEVR------EPEKK--ATDGKR 257

Query: 475 LSKDQIAVEQPAPERPALXXXXXXXXXXXXXXRHVERSGTPFSD-YTGLCSRSELTKPEL 533
            SK + +++ P  +R ++                + +    F D YT             
Sbjct: 258 KSKKEYSIQAPTSDRSSIAL-------------QIGKDPDDFGDGYTRF----------- 293

Query: 534 RHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLH 593
            H + S        PRP  EYT +IP +F    D S++   Y                L 
Sbjct: 294 -HEDFS--------PRPPQEYTADIPAVFS---DPSVMERYYYT--------------LD 327

Query: 594 RVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDS 653
           R Q+ N                   E   L +Y       Y+     N   SG       
Sbjct: 328 REQNHNDTSWLTPPLL-----PPQLENVILNKY-------YMTQDQFNENNSG------- 368

Query: 654 KTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
                 I  HV LNHL+TSSI+   + V    RY+ K++TQI+Y P 
Sbjct: 369 ---ALPIPNHVVLNHLITSSIKHNTLCVASIVRYKQKYVTQILYAPI 412

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 61/109 (55%), Gaps = 5/109 (4%)

Query: 361 THVILNWKDNIVDP-KTCKMSIVSKDISSTLNPHKK---FSKIPMVFDMERNCWTAHDLY 416
           T V L ++D+   P +   ++I   DI+S L    K     +IP+ F+ + + W A DLY
Sbjct: 70  TKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDSSEWVAPDLY 129

Query: 417 LPSGVYKFQFLINGEL-RHSDYLPTATDSFGNCVNWFEVVEGHDSIEPS 464
           LP G YKF+F+IN     HS+YLP  T   G   N+F V+E  + +EP+
Sbjct: 130 LPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEPA 178

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 59/152 (38%), Gaps = 26/152 (17%)

Query: 551 KYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQDVLFADLQQN 610
           + EYT+EI  LF+   D          +++      KP + +      NQ   F    Q 
Sbjct: 194 RVEYTNEILPLFEGYCDS---------QQIDHTAQYKPKTHM------NQKTFFYYAFQE 238

Query: 611 GQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLL 670
               S   +  F ++Y  P +P Y  S  +           D+  +V   +   NLN  +
Sbjct: 239 QDAASGDYDAQFCERYTVPIIPPYFYSIDITP--------QDNTLKVPLPIQLANLNRTI 290

Query: 671 TSS---IRDEIISVGCTTRYEGKFITQIIYTP 699
             S   I ++ + +GC   Y GK++  + Y P
Sbjct: 291 FPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSE 471
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ E+  G      +R  I+ E
Sbjct: 155 LQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEIGRGQKDTLSARSRIAME 211

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 613 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHI-VP-HVNLNHLL 670
           +D Q      +     P LP +L+   LN+ ++G Q  ++++     + +P HV LNHL 
Sbjct: 259 LDQQQHNHQNMAWLTPPTLPPHLEDVPLNS-YNGIQGDSNNENNSGALPIPNHVVLNHLA 317

Query: 671 TSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           TSSI+   + V    RY+ K++TQI+Y P 
Sbjct: 318 TSSIKHNTLCVASIVRYKRKYVTQILYAPL 347

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVV 455
           L LP G +KF+F+++ ELR SDYLPTATD  GN VN+ EVV
Sbjct: 192 LQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEVV 232

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 613 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVP-HVNLNHLLT 671
           +D Q      +     P LP +L++  LN+ +S  Q +++        +P HV LNHL T
Sbjct: 335 LDQQQNNHQNMAWLTPPQLPPHLENVILNS-YSSLQGESNENNSGALPIPNHVILNHLAT 393

Query: 672 SSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           SSI+   + V    RY+ K+ TQI+Y P 
Sbjct: 394 SSIKHNTLCVASIVRYKQKYATQILYAPL 422

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (71%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDV 467
           L LP G +KF+F+++ ELR SD+LPTATD  GN VN+ EV    +++E  +D+
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLELEKDI 245

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 7/101 (6%)

Query: 602 VLFAD---LQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVN 658
           V+F D   ++Q  Q   Q   ++ +     P+LP  L+   LN       + TD+     
Sbjct: 291 VVFRDPKIMEQYYQTVEQNKNKSHMAWLLPPELPSQLERCILN----NKNEDTDNGPCEL 346

Query: 659 HIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTP 699
               +V LNHLLTSSI++ ++ +GC+ RY  K++TQ+ YTP
Sbjct: 347 TTPNYVTLNHLLTSSIKNNMLCLGCSVRYRQKYVTQVYYTP 387

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (77%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEV 454
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ EV
Sbjct: 280 LQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%)

Query: 663 HVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           HV LNHL+T+SI+   + V    RY+ K+ TQI+YTP 
Sbjct: 544 HVVLNHLVTTSIKHNTLCVASIIRYKHKYATQILYTPL 581

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVV 455
           L LP G ++F+F+++ ELR SD+LPTATD  GN VN+ E+V
Sbjct: 241 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 281

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%)

Query: 629 PDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYE 688
           P LP  L++  LN      +  +++ +    I  HV LNHL TSSI+   + V    RY+
Sbjct: 414 PQLPPQLENVILNNYNKNAEPGSENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYK 473

Query: 689 GKFITQIIYTPC 700
            K+ TQI+Y P 
Sbjct: 474 RKYATQILYAPL 485

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 32/41 (78%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVV 455
           L LP G ++F+F+++ ELR SD+LPTATD  GN VN+ EVV
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEVV 242

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 613 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTS 672
           +D Q      +     P LP +L++  LN+ +SG     ++ +    I  HV LNHL TS
Sbjct: 346 LDQQQNNHQNMAWLTPPQLPPHLENVILNS-YSGSGSDNENTSGALPIPNHVVLNHLATS 404

Query: 673 SIRDEIISVGCTTRYEGKFITQIIYTPC 700
           SI+   + V    RY+ K++TQI+Y P 
Sbjct: 405 SIKHNTLCVASIVRYKSKYVTQILYAPL 432

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVE 456
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ E+ E
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEINE 248

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%)

Query: 613 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTS 672
           +D Q      +     P LP +L++  LN+  +      ++ +    I  HV LNHL TS
Sbjct: 344 LDQQQNNHQNMAWLTPPQLPPHLENVILNSYSNSQGTNNENNSGALPIPNHVILNHLATS 403

Query: 673 SIRDEIISVGCTTRYEGKFITQIIYTPC 700
           SI+   + V    RY+ K++TQI+Y P 
Sbjct: 404 SIKHNTLCVASIVRYKRKYVTQILYAPL 431

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVE 456
           L LP G ++F+F+++ ELR SDYLPTATD  GN VN+ E+ E
Sbjct: 251 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEINE 292

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (65%)

Query: 663 HVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           HV LNHL TSSI+   + V    RY+ K++TQI+Y P 
Sbjct: 465 HVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 502

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 31/41 (75%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVV 455
           L LP G +KF+F+++ ELR SD+LPTATD  GN VN+ E V
Sbjct: 178 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 218

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 44/88 (50%)

Query: 613 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTS 672
           +D Q      L     P LP +L++  LN+  S   +   + +    I  HV LNHL TS
Sbjct: 347 LDQQQNNHQNLSWLTPPQLPPHLENVILNSYSSNSPETGQNNSGSLPIPNHVVLNHLATS 406

Query: 673 SIRDEIISVGCTTRYEGKFITQIIYTPC 700
           SI+   + V    RY+ K++TQI+Y P 
Sbjct: 407 SIKHNTLCVASIVRYKRKYVTQILYAPL 434

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 31/41 (75%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVV 455
           L LP G +KF+F+++ ELR SD+LPTATD  GN VN+ E V
Sbjct: 183 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 223

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 44/88 (50%)

Query: 613 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTS 672
           +D Q      L     P LP +L++  LN   S   D + + +    I  HV L+HL TS
Sbjct: 336 LDQQQNNHQNLAWLTPPQLPPHLENVILNNYSSSSSDNSQNTSGSLPIPNHVVLHHLATS 395

Query: 673 SIRDEIISVGCTTRYEGKFITQIIYTPC 700
           SI+   + V    RY+ K++TQI+Y P 
Sbjct: 396 SIKHNTLCVASIVRYKRKYVTQILYAPL 423

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 32/40 (80%)

Query: 415 LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEV 454
           L LP+G ++F+F+++ EL+ SD+LPTATD  GN VN+ EV
Sbjct: 271 LQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 66/152 (43%), Gaps = 42/152 (27%)

Query: 550 PKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQDVLFADLQQ 609
           P +EYT EIP +F         P   EE  LT          L R ++ N          
Sbjct: 389 PNFEYTQEIPTVFTD-------PKVMEEYYLT----------LDRKKNSNS--------- 422

Query: 610 NGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVP-HVNLNH 668
                      + LQ    P LP +L++  LN+     QD ++  T     +P HV LNH
Sbjct: 423 -----------SSLQWLTPPQLPPHLENIILNSS----QDTSNENTSGALPIPNHVVLNH 467

Query: 669 LLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
           L+T+SI+   + V    RY+ K++TQI+Y P 
Sbjct: 468 LVTTSIKHNTLCVASIIRYKHKYVTQILYAPL 499

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 58/117 (49%), Gaps = 7/117 (5%)

Query: 585 SQKPPSFLHRVQDCNQDVLFADLQQN-GQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAV 643
           SQK P+     +   Q  +  D+Q+  G+ DS       +     P +P + D   LN  
Sbjct: 237 SQKVPALSTDPKVMEQYYIILDVQKRRGRRDSNG-----ISWLMPPQIPPHFDVVILNDQ 291

Query: 644 FSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700
            S  Q   DS      I  HV LNHL+ +S++  ++++  TTRY+ KFITQ+ Y+P 
Sbjct: 292 NS-LQHTDDSNAGFLPIPNHVVLNHLIVNSVKSNMLAISTTTRYKEKFITQVCYSPI 347

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%)

Query: 410 WTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEV 454
           W    L LP G ++F+F+++ ELR SD +P+ATDS GN VN+ EV
Sbjct: 143 WARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEV 187

>KNAG0F01330 Chr6 complement(239604..241484) [1881 bp, 626 aa] {ON}
           Anc_2.81 YHR146W
          Length = 626

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 17/70 (24%)

Query: 393 HKKFSKI-PMVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNW 451
           H+KF  + P+ FD +             G + F+F+++GE   S      TD FGN  N+
Sbjct: 37  HQKFEAVLPVSFDSD-------------GRFVFKFVVDGEWAVSQDYKIETDEFGNQNNY 83

Query: 452 FEVVEGHDSI 461
              +EGHD I
Sbjct: 84  ---IEGHDMI 90

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,998,823
Number of extensions: 3497511
Number of successful extensions: 8333
Number of sequences better than 10.0: 65
Number of HSP's gapped: 8516
Number of HSP's successfully gapped: 113
Length of query: 709
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 592
Effective length of database: 40,065,477
Effective search space: 23718762384
Effective search space used: 23718762384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)