Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G03740g5.526ON63163126740.0
Kwal_47.186465.526ON63563518010.0
SAKL0G04906g5.526ON60856711561e-150
TDEL0A039005.526ON6716067335e-87
KLLA0A01782g5.526ON5285616502e-76
Smik_13.1455.526ON7743094731e-49
YML006C (GIS4)5.526ON7741884581e-47
Skud_13.1485.526ON7791544553e-47
Suva_13.1565.526ON7723094544e-47
KNAG0B037105.526ON7112114349e-45
NCAS0H025505.526ON7431624278e-44
NDAI0C010705.526ON7571564233e-43
CAGL0K07271g5.526ON7761764093e-41
KAFR0C053905.526ON4551303861e-39
TBLA0D016605.526ON8661393802e-37
ZYRO0D12540g5.526ON5481343396e-33
Ecym_40615.526ON6632113382e-32
Kpol_1023.995.526ON551812633e-23
ADR198C5.526ON5491252223e-18
NDAI0H015905.526ON371801999e-16
NCAS0F010805.526ON379821972e-15
TPHA0K005405.526ON675821957e-15
KNAG0C032405.526ON32460930.010
TBLA0G009405.526ON78255870.072
Skud_15.4518.750ON32161732.9
NCAS0E026607.384ON67296724.8
YNL329C (PEX6)3.9ON103059725.0
Skud_14.123.9ON105497707.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G03740g
         (631 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...  1034   0.0  
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   698   0.0  
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   449   e-150
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   286   5e-87
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...   254   2e-76
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...   186   1e-49
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   181   1e-47
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...   179   3e-47
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...   179   4e-47
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...   171   9e-45
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   169   8e-44
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...   167   3e-43
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   162   3e-41
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...   153   1e-39
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...   150   2e-37
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   135   6e-33
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...   134   2e-32
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...   105   3e-23
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...    90   3e-18
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               81   9e-16
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    80   2e-15
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    80   7e-15
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      40   0.010
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    38   0.072
Skud_15.451 Chr15 complement(790983..791948) [966 bp, 321 aa] {O...    33   2.9  
NCAS0E02660 Chr5 (533776..535794) [2019 bp, 672 aa] {ON} Anc_7.3...    32   4.8  
YNL329C Chr14 complement(19541..22633) [3093 bp, 1030 aa] {ON}  ...    32   5.0  
Skud_14.12 Chr14 complement(12962..16126) [3165 bp, 1054 aa] {ON...    32   7.0  

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score = 1034 bits (2674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/631 (82%), Positives = 521/631 (82%)

Query: 1   MLESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLF 60
           MLESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLF
Sbjct: 1   MLESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLF 60

Query: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLS 120
           NKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLS
Sbjct: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLS 120

Query: 121 NFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETEADPALPAAISSESPASVHLS 180
           NFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETEADPALPAAISSESPASVHLS
Sbjct: 121 NFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETEADPALPAAISSESPASVHLS 180

Query: 181 KVVQEDVPLRTHNSSSRLLIVDNQECXXXXXXXXXXXXXLVLKFEHRGMLGKQRLHPEVR 240
           KVVQEDVPLRTHNSSSRLLIVDNQEC             LVLKFEHRGMLGKQRLHPEVR
Sbjct: 181 KVVQEDVPLRTHNSSSRLLIVDNQECASSTDESDDASTELVLKFEHRGMLGKQRLHPEVR 240

Query: 241 KMASTEEAIDTPSTGVSLRSDDVSSYDGEVLTQTITRDEDSVSLMIEDDSISELSSVDHS 300
           KMASTEEAIDTPSTGVSLRSDDVSSYDGEVLTQTITRDEDSVSLMIEDDSISELSSVDHS
Sbjct: 241 KMASTEEAIDTPSTGVSLRSDDVSSYDGEVLTQTITRDEDSVSLMIEDDSISELSSVDHS 300

Query: 301 LKXXXXXXXXXXXXXXXXXXXXXXXXXEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNND 360
           LK                         EKFGRFRLVLQSILVHQPDTRQLFTAVRQSNND
Sbjct: 301 LKSLSYDSEYSQGSSSLTSIFPSISISEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNND 360

Query: 361 PTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEEVAADAQDXX 420
           PTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEEVAADAQD  
Sbjct: 361 PTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEEVAADAQDYY 420

Query: 421 XXXXXXXXQPTASNSTISENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHE 480
                   QPTASNSTISENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHE
Sbjct: 421 PSKPSKSPQPTASNSTISENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHE 480

Query: 481 QGXXXXXXXXXKNSEGVVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSRKLSP 540
           QG         KNSEGVVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSRKLSP
Sbjct: 481 QGEEDDYYDDDKNSEGVVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSRKLSP 540

Query: 541 NDSTLEDSYQSVEGNLMKVRXXXXXXXXXXXXXXXXXXXXXERXXXXXXXXXXXXXXNFD 600
           NDSTLEDSYQSVEGNLMKVR                     ER              NFD
Sbjct: 541 NDSTLEDSYQSVEGNLMKVRSKSSVKSGLTKTLTLGSLSTVERSKSVPLPSVLKSLSNFD 600

Query: 601 EEALYXXXXXXXXXXXXXXXXXXNEPNCLLM 631
           EEALY                  NEPNCLLM
Sbjct: 601 EEALYLKKKVEKFKRKRLTKRKKNEPNCLLM 631

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/635 (58%), Positives = 433/635 (68%), Gaps = 4/635 (0%)

Query: 1   MLESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLF 60
           M E+SVKVDDYF NDENGLWSWYLCNLRHGNFEELNNNQLK ALLRRFLNEQL+S++V F
Sbjct: 1   MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPF 60

Query: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLS 120
           NKKLLLVSIPDAIHENTNLLENFLRDYF+LDDLQ+IQI+KLTQ++CYNHENHYLI D+LS
Sbjct: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLS 120

Query: 121 NFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETEADPALPAAISSESPASVHLS 180
           NFNDKSFLEFG K     +  E+ G+ SNNQYSIISGET  D    +     SP  +  S
Sbjct: 121 NFNDKSFLEFGIKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRDS 180

Query: 181 KVVQEDVPLRTHNSSSRLLIVDNQECXXXXXXXXXXXXXLVLKFEHRGMLGKQRLHPEVR 240
           KV QED  L+T ++SSR L ++N                +VL+F+ RG +GK++L+ EV+
Sbjct: 181 KVTQEDPALQTQSTSSRSLRIENSGSLNSSDESDDTESEIVLRFKPRGTVGKRQLYSEVK 240

Query: 241 KMASTEEAIDTPSTGVSLRSDDVSSYDGEVLTQTITRDEDSVSLMIEDDSISELSSVDHS 300
           +     + IDTPSTG+SLRS+DVSSYDGE L    +RDEDS SL  ++D+ISELSSVDHS
Sbjct: 241 RSPLANDYIDTPSTGMSLRSEDVSSYDGEELAHIASRDEDSASLSADEDNISELSSVDHS 300

Query: 301 LKXXXXXXXXXXXXXXXXXXXXXXXXXEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNND 360
           L                          EKFGRFRLVLQSIL+ Q DTRQL+TAVRQSNND
Sbjct: 301 LNSLSYDSECTPGSSSMTSIFPSISISEKFGRFRLVLQSILIQQTDTRQLYTAVRQSNND 360

Query: 361 PTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEEVAADAQDXX 420
           PTVAHVNDDWLLYDDKFSMNNLQILALHDVLE+NKFFPK+LFYSL+++++EVA DAQ+  
Sbjct: 361 PTVAHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYY 420

Query: 421 XXXXXXXXQPTASNSTISENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHE 480
                   + T S S +SENTLK+Q TLT SLTNTNS+LS G  +SSL+PFY++ Q + +
Sbjct: 421 PSASHQSPERTVSTSLLSENTLKLQTTLTPSLTNTNSFLSMGVNSSSLTPFYATAQGSPD 480

Query: 481 QGXXX----XXXXXXKNSEGVVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSR 536
           +              K  +G V  LYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDS+SR
Sbjct: 481 RANDEDDYFDDERDGKTDDGEVFQLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSTSR 540

Query: 537 KLSPNDSTLEDSYQSVEGNLMKVRXXXXXXXXXXXXXXXXXXXXXERXXXXXXXXXXXXX 596
           + S   S LED     EGNLMK++                     ER             
Sbjct: 541 RTSSAASFLEDPRLDDEGNLMKIKSKSSVKSGLTKTFTLGSLSTVERSKSVPLPSILKTL 600

Query: 597 XNFDEEALYXXXXXXXXXXXXXXXXXXNEPNCLLM 631
            NFDEEALY                  NEPNCLLM
Sbjct: 601 SNFDEEALYLKKKVEKFKRKRLAKRKKNEPNCLLM 635

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  449 bits (1156), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 261/567 (46%), Positives = 339/567 (59%), Gaps = 42/567 (7%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFN 61
           + S VKV DYF+ND NGLWSWYL NLR G+FEEL NN LKF LL+RFLNE L+ D V FN
Sbjct: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFN 60

Query: 62  KKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLSN 121
           KK+LLVSIPD IH++  +LENFLR YF+LDDLQ+IQI+KLT  + YNHENHYLISD+L+N
Sbjct: 61  KKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNN 120

Query: 122 FNDKSFLEFGAKSR---RPRDDTEILGQDSNNQYSIISGETEADPALPAAISSESPASVH 178
           F+D+SFL FG K     RP        Q S N YS++SGET       +  ++E     H
Sbjct: 121 FHDRSFLGFGQKKHDNVRP--------QLSYNGYSVLSGET----GYASLRTTEEQNGTH 168

Query: 179 LSKVVQEDVPLRTHNSSSRLLIVDNQECXXXXXXXXXXXXXLVLKFEHRGMLGKQRLHPE 238
               V E     +  +   +  V  +               +VL F H+         P 
Sbjct: 169 RPSGVVEQCNGNSPATPRDVTAV--EPVKSSEDEEDQESGEIVLNFPHK---------PP 217

Query: 239 VRKMASTEEAIDTPSTGVSLRSDDVSSYDGEVLTQTITRDEDSVSLMIEDDSISELSSVD 298
              +   E+ + T S  VS+ S+D SSYDGE L QTITRDED+ S   ++ +ISELSSVD
Sbjct: 218 KNIINQREQEVVTTSEDVSINSEDASSYDGEALIQTITRDEDASSADEDNSNISELSSVD 277

Query: 299 HSLKXXXXXXXXXXXXXXXXXXXXXXXXXEKFGRFRLVLQSILVHQPDTRQLFTAVRQSN 358
           HSL                          + FG FRLVLQSIL+  PDTR++FTAVRQSN
Sbjct: 278 HSLNSLSYNSDISSDDYSMASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSN 337

Query: 359 NDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEEVAADAQD 418
           NDP VAH+NDDWLLYD+KFSM+NLQ+L+LHDVLE+N+FFPKILFY++VM+  E  AD   
Sbjct: 338 NDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAH 397

Query: 419 XXXXXXXXXXQPT---ASNSTISENTLKVQPTLTHSLTNT--NSYLSTGAYNSSLSP-FY 472
                      P+   AS ST+S+NTL++ PT T ++T T  N  L+  A ++  +  ++
Sbjct: 398 AYIPNDPHLPPPSQGIASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYF 457

Query: 473 SSVQHNHEQGXXXXXXXXXKNSEGVVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHD 532
               H+ E                 V+PLY+ TRTNSN +TAHRSI T+ SIG+WAFHH+
Sbjct: 458 PEDNHDDEDDQEVNG----------VMPLYAPTRTNSNSTTAHRSILTVNSIGEWAFHHN 507

Query: 533 SSSRKLSPNDSTLEDSYQSVEGNLMKV 559
               + + ++ +  D   S  G + +V
Sbjct: 508 EPYPQNNHSNISFADQNTSTAGKMKRV 534

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  286 bits (733), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 202/606 (33%), Positives = 299/606 (49%), Gaps = 104/606 (17%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLF- 60
           ++ S+KVDDYFDND+NGLWSWYL ++R G+FEE + N+LK  LLRRFLN    S+   + 
Sbjct: 1   MQKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHFDSNRSHYG 60

Query: 61  -NKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSL 119
            N K+L VSIPD +H + +LLENFLRDYF+L+ L+ I+I KLTQ   YNHENHY++ D L
Sbjct: 61  QNTKILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKLTQSPVYNHENHYILIDKL 120

Query: 120 SNFNDKSFLEFGAKSR-------------RPRDDTEILGQDSNNQYSIISGETEADPALP 166
           +NF+D +FL+F A +R               R    I   DS+ +++     T  + +  
Sbjct: 121 NNFDDPTFLQF-ASTRWQQQLSNQQSNRLSDRQSGSIPNNDSSVEFNKKPCGTVTERSRA 179

Query: 167 AAISSES----PASVHLSKVVQEDVPLRTHNSSSRLLIVDNQECXXXXXXXXXXXXXLVL 222
            ++SS S    P+ +       +++ +R+  S S      NQ               +VL
Sbjct: 180 GSLSSFSANSGPSDLGSDTGGLQNIEVRSIQSESTAGQF-NQIPINSINDQDDENESIVL 238

Query: 223 KFEHRGMLGKQ--RLHPEVRKMASTEEAIDTPSTGVSLRSDDVS---------------- 264
            F H  +L KQ      + +++   E + DT  T  +L ++D                  
Sbjct: 239 DFSH-SLLRKQMEEKKSQAQRIRQQEYSADTNQTITNLHTNDKDTNASDIYSPAISENVS 297

Query: 265 --------------------SYDGEVLTQTITRDEDSVSLMIED---DSISELSSVDHSL 301
                               SY G+ L  T T  +D      +D   ++ISELSSV  S+
Sbjct: 298 INSYEDESMRDGSDSITAKDSYSGQPLALTTTHYKDDTQGSSDDSQEENISELSSVSRSM 357

Query: 302 KXXXXXXXXXXXXXXXXXXXXXXXXXEKF----------GRFRLVLQSILVHQPDTRQLF 351
           K                                      G +RLV+QS L+  P+T++++
Sbjct: 358 KSLGSQTSLGDNNDYENNSDSSDYSVVSILPSISISDARGHYRLVMQSSLLQDPETKEIY 417

Query: 352 TAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEE 411
           TA+RQSNN PTVA V+DDWLLYD +FSMNNLQ+L L ++L+MN+ FPKI+FYS++++S+E
Sbjct: 418 TAIRQSNNQPTVADVDDDWLLYDSQFSMNNLQMLTLQELLDMNRSFPKIIFYSMIVVSDE 477

Query: 412 VAADAQDXXXXXXXXXXQPTASNSTISENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPF 471
                Q              ++  T  E+T     ++  + +                  
Sbjct: 478 QQELLQ-------------WSNGMTQKEDTADASSSIPRADS------------------ 506

Query: 472 YSSVQHNHEQGXXXXXXXXXKNSEGVVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHH 531
           Y+S+  + +Q            SE     +Y+ TR  SN STAHRSIRT+ SIGDWAF H
Sbjct: 507 YASMSRDPQQFYANMDDDDTSLSEQSGPMMYAPTRLQSNTSTAHRSIRTVNSIGDWAFVH 566

Query: 532 DSSSRK 537
            + +++
Sbjct: 567 KNETKR 572

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 188/561 (33%), Positives = 270/561 (48%), Gaps = 87/561 (15%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFN 61
           + +SV+V DY++ND NGLWSWYL NLR+G FEEL  N+LK  LL+RFL +Q  +   L N
Sbjct: 1   MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQATGPL-N 59

Query: 62  KKLLLVSIPDAIHENTNLLENFLRDYFNL-DDLQFIQIQKLTQDRCYNHENHYLISDSLS 120
           KKLLLVSIPD IH++  +LE FL +YF+L DD   I I KLT+   Y HENHYLI D L+
Sbjct: 60  KKLLLVSIPDEIHQDIKVLEEFLSEYFHLKDDHTNIVIDKLTRGTVYKHENHYLIQDKLT 119

Query: 121 NFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETEADPALPAAISSESPASVHLS 180
           NFND+ FLE        + D  I G  S +     S E         +   +S +S   S
Sbjct: 120 NFNDEWFLEM-------KKDVSISGNSSKDATD--SAENCGQEMEDDSPRRDSDSSDSYS 170

Query: 181 KVVQEDVPLRTHNSSSRLLIVDNQECXXXXXXXXXXXXXLVLKFEHRGMLGKQRLHPEVR 240
            +  +     +H+                          +VL F+H  ++ K       R
Sbjct: 171 ILTGDTFDTESHS--------------------------IVLNFKHPEVMVKPITKTTQR 204

Query: 241 KM-ASTEEAIDTPS---TGVSLRSDDVSSYDGEVLTQTITRDEDSVSLMIEDDSISELSS 296
            +  S    I +P+     +    DD+ SY GE L QT+TR            +I E   
Sbjct: 205 IVRISPGNNIGSPAESQVSIVTHGDDLESYRGEALVQTVTR------------AIDEDEE 252

Query: 297 VDHSLKXXXXXXXXXXXXXXXXXXXXXXXXXEKFGRFRLVLQSILVHQPDTRQLFTAVRQ 356
            +                             + FG FRLVLQSIL+   +T Q+FT +RQ
Sbjct: 253 DEDDDDHHHDVESADDMKSKDISIPPSISISDNFGTFRLVLQSILITNKETEQIFTGIRQ 312

Query: 357 SNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEEVAADA 416
           S ND + A +NDDWLLYD  F++ NLQ+L+L+D+L+ +KF PKILFYS++ + + V  + 
Sbjct: 313 SENDRSNADINDDWLLYDTDFNLGNLQMLSLYDILDFSKFLPKILFYSMIHVKDSVDDN- 371

Query: 417 QDXXXXXXXXXXQPTASNSTISENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQ 476
                                +E +L+   T+ ++LTN N Y S    + S+S   S   
Sbjct: 372 ---------------------TELSLQHLITVNNTLTNGNMY-SPHEVDDSMSELSSDNS 409

Query: 477 HNHEQGXXXXXXXXXKNSEGVVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSR 536
                G           ++  V+ LYS     +  +  HRSIRT++SIG WA +  ++ +
Sbjct: 410 IECYTGNSNDSI-----ADEPVIGLYSPA---TAATAGHRSIRTVESIGAWALNRSNTKK 461

Query: 537 KLSPNDSTLEDSYQSVEGNLM 557
            +    +T+    +   GN M
Sbjct: 462 SMETVQNTVS---RDSRGNFM 479

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score =  186 bits (473), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 173/309 (55%), Gaps = 33/309 (10%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSD---SV 58
           ++ SV+V DYFDND+NGLWSWYL NLR G+FEEL  NQLK+ LL+RFLN     D   SV
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60

Query: 59  LFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDS 118
             NKK+LLVSIP+ +HE+ ++LE FL+DYF+L+ L+ IQI KLT   CYNHENHYL++D+
Sbjct: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 119 LSNFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSI-----ISGETEADPALPAAISSES 173
           L+NF D +FLEF + S + + +++ L    NN  S+     IS    ++  L ++ S E 
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKALN---NNNRSLIHPPTISSSKTSNGQLKSSTSDEQ 177

Query: 174 PASVHLSKVVQE---------------DVPLRTHNSSSRLLIV--DNQECXXXXXXXXXX 216
            ++++                      D+ L + N  S    V  D++            
Sbjct: 178 WSNINTQTPTGTRTNTNTRTITSPNTADICLTSANRQSNNYAVPQDSENRNDGEDAADDT 237

Query: 217 XXXLVLKFEH-RGMLGKQRLHPEVRKMASTEEAIDTPSTGVSLRS---DDVSS-YDGEVL 271
              +VL F H R +  K    P++    + EE   + S  VS+ S   +DVSS Y G+ L
Sbjct: 238 TSSIVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQDL 297

Query: 272 TQTITRDED 280
           + T  R ED
Sbjct: 298 SLTTARCED 306

 Score =  150 bits (380), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 125/225 (55%), Gaps = 30/225 (13%)

Query: 328 EKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQSIL+  PDT+++FTA+RQSNN PT+A V DDWLLYD  FSMNNLQIL L
Sbjct: 447 DSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMNNLQILTL 506

Query: 388 HDVLEMNKFFPKILFYSLVMISEEVAADAQDXXXXXXXXXXQPTASNSTISENTLKVQP- 446
            D+L++ + FPKILFY++V+++E                  +P   N    E+ LK QP 
Sbjct: 507 QDLLDIKRSFPKILFYTMVIVTE-----------SGQQIEEEPKNPNYGTREDMLKEQPL 555

Query: 447 ----TLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGXXXXXXXXXKNSEGVVVPLY 502
                L+H   +   Y    AYN+    +      + +             SE     +Y
Sbjct: 556 NSDLLLSH---DPKQYFP-NAYNNDYDEYIDDEDDDDDASL----------SEQSGPQMY 601

Query: 503 SATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSRKLSPNDSTLED 547
             TR  SN +TAHRSIRT+ SIG+WAF+  +S  K++ ++S   D
Sbjct: 602 IPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSNSNESD 646

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  181 bits (458), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 128/188 (68%), Gaps = 15/188 (7%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSD---SV 58
           ++ SV+V DYFDND+NGLWSWYL NLR G+FEEL  NQLK+ LL+RFLN     D   S 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISA 60

Query: 59  LFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDS 118
             NKK+LLVSIP+ +HE+ ++LE FL+DYF+L+ L+ IQI KLT   CYNHENHYL++D+
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 119 LSNFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETEADPALPAAISSESPASVH 178
           L+NF D +FLEF + S + + +++ L  ++NN+ SI           P  ISS   ++  
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKAL--NNNNRNSIP----------PPTISSSKASNGK 168

Query: 179 LSKVVQED 186
           L   V +D
Sbjct: 169 LESNVSDD 176

 Score =  149 bits (377), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 127/231 (54%), Gaps = 19/231 (8%)

Query: 328 EKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQSIL+  PDT+++FTA+RQSNN PT+A V DDWLLYD  FSMNNLQIL L
Sbjct: 444 DSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTL 503

Query: 388 HDVLEMNKFFPKILFYSLVMISEEVAADAQDXXXXXXXXXXQPTASNSTISENTLKVQPT 447
            D+L++ + FPKILFY++V+++        +           P   N    E   K QP 
Sbjct: 504 QDLLDIKRSFPKILFYTMVIVT--------NSGKQVEEEFKNPNYDN---REGISKEQPL 552

Query: 448 LTH-SLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGXXXXXXXXXKNSEGVVVPLYSATR 506
            +  SLTN        AYN+  + +        +             SE     +Y  TR
Sbjct: 553 DSELSLTNDPQQYFPTAYNNGYNDYIDDEDDEDDGDDASL-------SEQSGPQMYIPTR 605

Query: 507 TNSNKSTAHRSIRTIKSIGDWAFHHDSSSRKLSPNDSTLEDSYQSVEGNLM 557
             SN +TAHRSIRT+ SIG+WAF+  +S  K+  ++S   D+ ++ E  ++
Sbjct: 606 MESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKTGESTVL 656

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score =  179 bits (455), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 86/154 (55%), Positives = 117/154 (75%), Gaps = 5/154 (3%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSD---SV 58
           ++ SV+V DYFDND+NGLWSWYL NLR G+FEEL  NQLK+ LL+RFLN     D   S 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60

Query: 59  LFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDS 118
             NKK+LLVSIP+ +HE+ ++LE FL+DYF+L+ L+ IQI KLT   CYNHENHYL++D+
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 119 LSNFNDKSFLEFGAKSRRPRDDTEILGQDSNNQY 152
           L+NF D +FLEF + S + + +++ L  ++NN+Y
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKTL--NNNNRY 152

 Score =  149 bits (375), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 128/229 (55%), Gaps = 20/229 (8%)

Query: 328 EKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQSIL+  PDT+++FTA+RQSNN PT+A V DDWLLYD  FSMNNLQIL L
Sbjct: 451 DSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTL 510

Query: 388 HDVLEMNKFFPKILFYSLVMISEEVAADAQDXXXXXXXXXXQPTASNSTISENTLKVQPT 447
            D+L++ + FPKILFY++V+++     D+                +  T  E  L  + +
Sbjct: 511 QDLLDIKRSFPKILFYTMVIVT-----DSGHQQIEEEHKSSSHRGTVDTSKEEPLNSELS 565

Query: 448 LTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGXXXXXXXXXKNSEGVVVPLYSATRT 507
           L+H   +   Y  T AYN     +        +             SE     +Y  TR 
Sbjct: 566 LSH---DPQQYFPT-AYNIDYDEYTDDEDEGDDASL----------SEQSGPQMYLPTRM 611

Query: 508 NSNKSTAHRSIRTIKSIGDWAFHHDSSSRKLSPNDST-LEDSYQSVEGN 555
            SN +TAHRSIRT+ SIG+WAF+  +S  K++ +DS  L++S + V  N
Sbjct: 612 ASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRN 660

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score =  179 bits (454), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 119/309 (38%), Positives = 167/309 (54%), Gaps = 31/309 (10%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSD---SV 58
           ++ SV+V DYFDND+NGLWSWYL NLR G+FEEL  NQLK+ LL+RFLN     D   S+
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60

Query: 59  LFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDS 118
             NKK+LLVSIP+ +HE+ ++LE FL+DYF+L+ L+ IQI KLT   CYNHENHYL++D 
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120

Query: 119 LSNFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETEADPALPAAISSESPASVH 178
           L+NF D SFLEF + S + + + + L  ++N      S  + + P+  A +   +     
Sbjct: 121 LNNFQDPSFLEFASTSWQVQKNPKSLNNNNNRHLIHASTASSSKPS-NAQLKPNTLDDQL 179

Query: 179 LSKVVQEDVPLRTHNSSSRLLIVDNQ-------ECXXX---------------XXXXXXX 216
           L    Q  +  RT+ ++  L   D         EC                         
Sbjct: 180 LDINTQTSMTARTNTNTKTLTYTDTADPSLTQPECNNKGDNDMPQNNENENEEEDAGDDA 239

Query: 217 XXXLVLKFEH-RGMLGKQRLHPEVRKMASTEEAIDTPSTGVSLRS---DDVSS-YDGEVL 271
              +VL F H R +  K    P++    + E+   + S  VS+ S   +DVSS Y G+ L
Sbjct: 240 ASSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNPSHSEIVSIDSFAGEDVSSTYPGQDL 299

Query: 272 TQTITRDED 280
           + T  R ED
Sbjct: 300 SLTTARRED 308

 Score =  142 bits (359), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 121/227 (53%), Gaps = 32/227 (14%)

Query: 328 EKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQSIL+  PDT+++FTA+RQSNN+PTVA V DDWLLYD  FSMNNLQIL L
Sbjct: 443 DSLGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMNNLQILTL 502

Query: 388 HDVLEMNKFFPKILFYSLVMIS-------EEVAADAQDXXXXXXXXXXQPTASNSTISEN 440
            D+L++ + FPKIL Y++V+++       EE   +             +P  S  ++S +
Sbjct: 503 QDLLDIKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQHREVDLTEEKPPNSELSLSND 562

Query: 441 TLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGXXXXXXXXXKNSEGVVVP 500
             +  P+      +       G  ++SL                         SE     
Sbjct: 563 PQRYFPSTFDDDYDEYIDDDDGGDDASL-------------------------SEQSGPQ 597

Query: 501 LYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSRKLSPNDSTLED 547
           +Y  TR  SN +TAHRSIRT+ SIG+WAF+  +S  K++ + S   D
Sbjct: 598 MYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESD 644

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score =  171 bits (434), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 135/211 (63%), Gaps = 10/211 (4%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFN 61
           ++ S++V+DY+DND+NGLWSWYL N+R G+FEEL +N+LK+ LL+RFL     S   + N
Sbjct: 1   MQKSIRVNDYYDNDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHFTSLEGI-N 59

Query: 62  KKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLSN 121
            K+L +SIPD +H + ++LE FL+DYF+L+DLQ I+IQKLT   CYNHENHYL++D+L+N
Sbjct: 60  SKILFISIPDKVHSDISVLETFLKDYFHLEDLQNIKIQKLTTSNCYNHENHYLLTDTLNN 119

Query: 122 FNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETEADPA-----LPAAISSE---- 172
           FND+ FL +    R+  +  ++   D  +    I G T +         P  +++E    
Sbjct: 120 FNDRKFLRYLNPGRKFENSGDMAKLDGVSGPLSIYGTTTSTTVKNEDDFPEEVTAEPATT 179

Query: 173 SPASVHLSKVVQEDVPLRTHNSSSRLLIVDN 203
           +  S + S +V    P++  + S  LLI+ N
Sbjct: 180 TSTSTNASSLVSNHAPIQNLDKSHDLLIIQN 210

 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 100/207 (48%), Gaps = 55/207 (26%)

Query: 331 GRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390
           G FRLVLQS+L+ + D + +FTA+RQSNN    A V DDW+LYD  FSMNNL ++ L  +
Sbjct: 472 GHFRLVLQSVLLQRED-KAIFTAIRQSNNKVDRATVQDDWILYDSDFSMNNLMMMTLRGL 530

Query: 391 LEMNKFFPKILFYSLVMISE-EVAADAQDXXXXXXXXXXQPTASNSTISENTLKVQPTLT 449
              ++   KILFYS++++ + E A D  D                +T S +    QP L 
Sbjct: 531 FNFSENMSKILFYSMIIVDDAETADDMLDEE--------------ATHSGDVSDTQPQLM 576

Query: 450 HSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGXXXXXXXXXKNSEGVVVP-LYSATRTN 508
               +++S                                      GV  P +Y   +T 
Sbjct: 577 FDEEDSDS--------------------------------------GVQEPQMYLPQKTA 598

Query: 509 SNKSTAHRSIRTIKSIGDWAFHHDSSS 535
           S+ +TAHRSIRT+ SIG+WA+   S++
Sbjct: 599 SHATTAHRSIRTVNSIGEWAYKKKSNA 625

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  169 bits (427), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 79/162 (48%), Positives = 109/162 (67%), Gaps = 25/162 (15%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFN 61
           ++ SV+V DYFDND+NGLWSWYL N+R G+FEE+  NQLK+ LL+RFLN    S+S +  
Sbjct: 1   MQKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTA 60

Query: 62  -------------------------KKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFI 96
                                    +K+LLVSIPD +H + ++LE FLRDYF+L+ L+ I
Sbjct: 61  TESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGI 120

Query: 97  QIQKLTQDRCYNHENHYLISDSLSNFNDKSFLEFGAKSRRPR 138
           QIQ+LTQ +CYNHENHYL++D+++NF+D  FLEF   + + R
Sbjct: 121 QIQRLTQSKCYNHENHYLLTDTINNFDDPVFLEFAGSNWQAR 162

 Score =  135 bits (341), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 114/207 (55%), Gaps = 13/207 (6%)

Query: 331 GRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390
           G FRLVLQSIL+  P T++++TA+RQSNN+PT+A + DDWLLYD +FSM+NLQIL L D+
Sbjct: 434 GHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDSQFSMDNLQILTLQDL 493

Query: 391 LEMNKFFPKILFYSLVMISEEVAADAQDXXXXXXXXXXQPTASNSTISENTLKVQPTLTH 450
           L+ N+ FPKILFYS+V+++     DA             P  + S +S     +    T+
Sbjct: 494 LDTNRSFPKILFYSMVIVT-----DAHHQPIQGPTSTAGPDLTTSYLSNKLESIAGDETN 548

Query: 451 SLTNTNSY-LSTGAYNSSLSPFYSSVQHNHEQGXXXXXXXXXKNS--EGVVVPLYSATRT 507
                  Y ++          F+       E            +S  E     +Y  TR 
Sbjct: 549 QRFENRYYPMADDQVEDQPQQFFP-----QEDDHDDDNMYDTDDSLMEEAGPEMYLPTRM 603

Query: 508 NSNKSTAHRSIRTIKSIGDWAFHHDSS 534
            +N +TAHRSIRT+ SIG+WAF+ +++
Sbjct: 604 ETNNTTAHRSIRTVNSIGEWAFNRNNT 630

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score =  167 bits (423), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 108/156 (69%), Gaps = 19/156 (12%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFN 61
           +++SV+V DY++ND+NGLWSWYL N+R G+FEEL  NQLK+ LL+RFLN    S++   +
Sbjct: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTD 60

Query: 62  -------------------KKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLT 102
                              KK+LLVSIPD +H + +LLE FLRDYF+L+DL+ IQI KLT
Sbjct: 61  TAIDDNNNTNSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120

Query: 103 QDRCYNHENHYLISDSLSNFNDKSFLEFGAKSRRPR 138
           Q  CYNHENHYL++D ++NF+D  FLEF   + + R
Sbjct: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGR 156

 Score =  143 bits (360), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 85/215 (39%), Positives = 114/215 (53%), Gaps = 20/215 (9%)

Query: 331 GRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390
           G FRLVLQS L+  P T+++FTA+RQSNN+PT+AH+ DDWLLYD KF+M+NLQIL L D+
Sbjct: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532

Query: 391 LEMNKFFPKILFYSLVMISEEVAADAQDXXX------------XXXXXXXQPTASNSTIS 438
           L+ N+ FPKILFYS+V+++E       D                      + T+S    S
Sbjct: 533 LDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMTALNSEYLSNKLESLEKTSSEEGKS 592

Query: 439 ENTLKVQPTLTHS-LTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGXXXXXXXXXKNS--- 494
            N  K  PTL  + +T  N  +           F+     + E G          +    
Sbjct: 593 INRYKYYPTLPKAGITAKNGEMIADV----PEQFFPGPPSDDENGKGEDYDDDYDDESLM 648

Query: 495 EGVVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAF 529
           E     +Y  TR  +N +TAHRSIRT  SIG+WAF
Sbjct: 649 EQHGPEMYLPTRMQTNVTTAHRSIRTANSIGEWAF 683

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  162 bits (409), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 113/176 (64%), Gaps = 6/176 (3%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLL------S 55
           +  SV+V DY+ NDENG+WSWYL NLR G+FEE+  N+LK+ LL+RFLN  LL      S
Sbjct: 1   MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPES 60

Query: 56  DSVLFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLI 115
            +   NKKL+ VSIP+ +H++ ++LE FLRDYF+L  L   QI KLTQD+ Y+HENHY +
Sbjct: 61  PTRFINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIHKLTQDKVYHHENHYFL 120

Query: 116 SDSLSNFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETEADPALPAAISS 171
            D L+NF D +FLEFG  + +       +    N + +  +  TEA   +   ISS
Sbjct: 121 MDELNNFEDPTFLEFGKSNWKMEGTAGTVYDPQNKENTTDALVTEATAKIDHKISS 176

 Score =  144 bits (364), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/233 (36%), Positives = 126/233 (54%), Gaps = 35/233 (15%)

Query: 328 EKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQSIL+  P T+++FTAVRQSNN PT+A + DDWLLYD +FSM+NLQIL L
Sbjct: 462 DTLGYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQILTL 521

Query: 388 HDVLEMNKFFPKILFYSLVMISE--EVAADAQDXXXXXXXXXXQPTASNSTISENTLKVQ 445
            D++ + K +PKILFY++V+I++  E+A +             Q T + S I+  + +V+
Sbjct: 522 QDIMTIKKDYPKILFYTMVVINDRSEIACE-------FPYNGAQFTKAPSPITNKSHEVE 574

Query: 446 PTLTHSLTNTNSYLSTG--AYNSSLSPFYSSVQHNHEQGXXXXXXXXXKNSEGVVVPLYS 503
                  T   +Y      A   S+ P                      N + +   L  
Sbjct: 575 KEELDQPTEVQAYFPGNGQAIKDSIKP---------------------NNRDSLTFDLCQ 613

Query: 504 ATRTNSNKSTAHRSIRTIKSIGDWAFHHDS---SSRKLSPNDSTLEDSYQSVE 553
           A RT SN +T HRSIRT+ SIGDW+   D+   ++R  +      +D YQ+++
Sbjct: 614 AERTKSNMTTTHRSIRTVNSIGDWSISRDTTGIATRAATNTSGQYDDHYQALK 666

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score =  153 bits (386), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 102/130 (78%), Gaps = 4/130 (3%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQL-LSDSVLF 60
           + +SV++ DYFDNDENGLWSWYL NLR GNFEEL NN+LK +LL+RFL  Q+ ++D +  
Sbjct: 1   MPNSVQIHDYFDNDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQVDINDQI-- 58

Query: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLS 120
            KK+LL+SIPD I  + N+LE FL DYF+L+DL  I+I KLT+   YNHENHYL+ DS++
Sbjct: 59  -KKILLISIPDHIFSDINVLEIFLSDYFHLNDLSNIKIIKLTKFNVYNHENHYLLIDSVN 117

Query: 121 NFNDKSFLEF 130
           NF D++FL +
Sbjct: 118 NFKDETFLNY 127

 Score = 79.0 bits (193), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 55/80 (68%), Gaps = 1/80 (1%)

Query: 328 EKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           E  G +RLVLQS+L+   +   L T VRQSNN    A++NDDW+LYD+KFSM NL IL+L
Sbjct: 261 EAIGHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKFSMRNLNILSL 320

Query: 388 HDV-LEMNKFFPKILFYSLV 406
            D+ +  N    KILFYS++
Sbjct: 321 KDLSIIGNVDSIKILFYSMI 340

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score =  150 bits (380), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 96/139 (69%), Gaps = 7/139 (5%)

Query: 6   VKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFNK--- 62
           V+V+DY+DND NGLWSWYL N+R+G FEEL  N LK  LL+RFL E    D    ++   
Sbjct: 9   VQVNDYYDNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHST 68

Query: 63  ---KLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSL 119
              K+L  SIPD IH++  +LEN L+DYF+LD+L  IQI KLTQ+RCYNHENHY++ D L
Sbjct: 69  NCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKDIL 128

Query: 120 SNFNDKS-FLEFGAKSRRP 137
            NF + S F+  G K + P
Sbjct: 129 DNFGNTSFFIHDGTKQKIP 147

 Score =  123 bits (308), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 116/212 (54%), Gaps = 19/212 (8%)

Query: 328 EKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQ IL++ P   + +TA+RQS+++  VA + DDWLLYD KFSM+NL+IL L
Sbjct: 507 DSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTL 566

Query: 388 HDVLEMNKFFPKILFYSLVMISEEVA--------ADAQDXXXXXXXXXXQPTASNSTISE 439
            ++L+ N+ +PKILFY+LV I++  +        ++  +          +P+  +    +
Sbjct: 567 QELLDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKD 626

Query: 440 NTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGXXXXXXXXXKNSEGVVV 499
           N  K+      +  ++N  +   +        Y+++  + E G            EG  +
Sbjct: 627 NQ-KINTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEY-------PEG--L 676

Query: 500 PLYSATRTNSNKST-AHRSIRTIKSIGDWAFH 530
            +Y  ++  SN +T AHRSIRT+ SIG+WAFH
Sbjct: 677 EMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFH 708

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  135 bits (339), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 92/134 (68%), Gaps = 8/134 (5%)

Query: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLN---EQLLSDSV 58
           +  SV+V DYF ND+NGLWSWYL N+R+G+FEEL  NQLK +L +RFL    E  L++  
Sbjct: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK 60

Query: 59  LFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDS 118
             + K+L+VSIP+ +  +  LLE FL DY NLD++   +I KLT  R YNHENHY++ D 
Sbjct: 61  --DTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNM---EITKLTTSRIYNHENHYVVMDK 115

Query: 119 LSNFNDKSFLEFGA 132
            +NF + +FL F +
Sbjct: 116 ENNFKNSNFLHFAS 129

 Score =  115 bits (287), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 126/287 (43%), Gaps = 55/287 (19%)

Query: 263 VSSYDGEVLTQTITRDEDSVSLMIEDDSISELSSVDHSLKXXXXXXXXXXXXXXXXXXXX 322
           V S+ GE LT T+TR ED  S    D   S  SS D  L                     
Sbjct: 249 VESFKGEPLTLTMTRTEDFSSSDEYDSLASSPSSSDTDLSSFESCSLMSILPSISIA--- 305

Query: 323 XXXXXEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNL 382
                + FG FRLVLQS+L   P + ++FTA+RQSNN PT A V+DDWLLYD +FSM+NL
Sbjct: 306 -----DSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNL 360

Query: 383 QILALHDVLEMNKFFPKILFYSLVMISEEVAADAQDXXXXXXXXXXQPTASNSTISENTL 442
           Q+L L D+ E+NK  PK+LFYSLV + +  + +  D             A+ S  +  +L
Sbjct: 361 QMLTLQDLSELNKGCPKVLFYSLVEVVDTPSLEDADTE----------CATISNTASTSL 410

Query: 443 KVQPTLTHSLTNTNSYLSTGAYNSSLSP--FYSSVQHNHEQGXXXXXXXXXKNSEGVVVP 500
              PT T               + S  P  F+ S  +    G                  
Sbjct: 411 SSAPTST---------------SVSCEPRVFFPSNVNGDNSGCRL--------------- 440

Query: 501 LYSATRTNSNKST-AHRSIRTIKSIGDWAFHHDSSSRKLSPNDSTLE 546
                + N+N ST  HRSI T  S  DW      S+  +   DST E
Sbjct: 441 ----AKGNTNSSTLGHRSIVTTNSAADWRRQSVESNASIRKYDSTAE 483

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score =  134 bits (338), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 110/211 (52%), Gaps = 28/211 (13%)

Query: 256 VSLRSDD-VSSYDGEVLTQTITRDEDSVS-----------LMIEDDSISELSSVDHSLKX 303
           VS+RS +   SYDGEVL +T+TR+E               L  E DS SELSS  +S+  
Sbjct: 265 VSIRSSESYQSYDGEVLARTLTREEHIQGSCCPTEHRHEELYNEGDSTSELSSACNSVSS 324

Query: 304 XXXXXXXXXXXXXXXXXXXXXXXXEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTV 363
                                      G FR+VLQSIL++     QL TAVRQSNND TV
Sbjct: 325 DCSIFPSISISGDE-------------GDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTV 371

Query: 364 AHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEEVAADAQDXXXXX 423
           A +NDDWLLYD++FSMNN+Q+++L D+ EMN  FPKILFYS+V I     A  +      
Sbjct: 372 ADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAIPCNNTASKEANSCAE 431

Query: 424 XXXXXQPTASN---STISENTLKVQPTLTHS 451
                    SN   S IS+NTL  Q T   S
Sbjct: 432 IGKKNASNISNWIYSCISQNTLSQQATTADS 462

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 14  NDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFNKKLLLVSIPDAI 73
           +D NGLWSWYL NLR G FEEL+++ +K  L++R + E     ++  + ++LLVS+PD I
Sbjct: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKE-YSGGTMSASNRVLLVSVPDDI 68

Query: 74  HENTNLLENFLRDYF-NLDDLQFIQIQKLTQDR-CYNHENHYLISDS 118
            +  ++LE FLR     + +++   I KLT  +   N E+HYLI+D+
Sbjct: 69  RQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDT 115

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 65/81 (80%)

Query: 328 EKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           + +  F+LVLQSIL++  D+ +L TA+RQSNN+   A ++DDWLLYD KFSM NLQIL+L
Sbjct: 255 DPYANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFSMTNLQILSL 314

Query: 388 HDVLEMNKFFPKILFYSLVMI 408
           +++L +NK +PKILFYSLV I
Sbjct: 315 NELLHINKDYPKILFYSLVSI 335

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 51/97 (52%), Gaps = 12/97 (12%)

Query: 19  LWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFNKKLLLVSIPDAIHENTN 78
           +W+WYLC++R+G+FEE+  N+  + LL+  L + + +     NK   L+SI         
Sbjct: 15  VWTWYLCHVRNGSFEEILGNEDYYKLLKNNLVDDVFNIDK-GNKIFKLISI-------NY 66

Query: 79  LLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLI 115
           L  N L DY+N      ++   L  ++  + E HYL+
Sbjct: 67  LNNNILLDYYN----NIVKKTLLLLNKSNSIELHYLV 99

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 77/125 (61%), Gaps = 5/125 (4%)

Query: 330 FGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHD 389
           F +FR+VLQSILV+  +  ++ TAVRQ NN+P +A+ +DD LLYD+K S+   +IL+L D
Sbjct: 246 FSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLVD 305

Query: 390 VLEMNKFFPKILFYSLVMI-----SEEVAADAQDXXXXXXXXXXQPTASNSTISENTLKV 444
           ++E+N+  PK+LFYS+  I         A               + + S ST+S ++L++
Sbjct: 306 LMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQLLQRNSFSASTLSRHSLRL 365

Query: 445 QPTLT 449
            PT+T
Sbjct: 366 LPTVT 370

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 56/101 (55%), Gaps = 8/101 (7%)

Query: 15  DENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFNKKLLLVSIPDAIH 74
           D +GLWSWYL NLR G FE+L  ++ +++ L+ FL +   + S    ++L L+S P ++ 
Sbjct: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRD-CFAHSTGQERRLQLLSFPASVP 62

Query: 75  ENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLI 115
            +  +LE F+R   N+     + I ++        E HYL+
Sbjct: 63  CDYKILEEFIRQQGNIS----VAIPRV---HATGTEKHYLV 96

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 55/80 (68%)

Query: 330 FGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHD 389
           +G+ R VLQSI+     T +L TA+RQS+ D  VA  +D+WLLYD  FS+NNL+I  L D
Sbjct: 292 YGQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSLNNLEISTLQD 351

Query: 390 VLEMNKFFPKILFYSLVMIS 409
           +L  N   P+ILFY++ ++S
Sbjct: 352 ILYPNYENPRILFYTMSVVS 371

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 64/116 (55%)

Query: 9   DDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFNKKLLLVS 68
           +D    D+N + SWYL NLR G FE +  ++ K   L   L+ QL  +        +LVS
Sbjct: 3   EDNIKKDDNEVLSWYLRNLREGRFENIIEDRAKNYHLNTILDRQLFDNKQYGATNKILVS 62

Query: 69  IPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLSNFND 124
              +I E  ++ + FL   F+ + LQ+I++++L   +  N E HY ++D L++FND
Sbjct: 63  TLTSIDEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGDNKETHYFLTDHLNSFND 118

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 56/82 (68%)

Query: 329 KFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALH 388
           K G+ R VL S+L+    +++ FTA+RQ ++DP  A++ D+WLLYD KFS++NL++  L 
Sbjct: 298 KSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQ 357

Query: 389 DVLEMNKFFPKILFYSLVMISE 410
           D+L  NK    +L Y  ++IS+
Sbjct: 358 DILLSNKGNSMLLLYKTILISK 379

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 67/118 (56%), Gaps = 2/118 (1%)

Query: 12  FDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFNKKLLLVSIPD 71
           + +D + +WSWYL NL+ GNFE L N  ++   L  +   Q  S +     K +L+S+P 
Sbjct: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNE--GSKKILLSVPS 66

Query: 72  AIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLSNFNDKSFLE 129
            + +  ++   FL   FN + LQ+I + + ++      + HYL++D+LS FN+ +F+E
Sbjct: 67  MLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFIE 124

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 61/82 (74%)

Query: 330 FGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHD 389
           +G F+LVLQS+++   ++ + FTAVRQSN+    A  +D+WLLYD KFSM+NL+I+ L+ 
Sbjct: 336 YGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNY 395

Query: 390 VLEMNKFFPKILFYSLVMISEE 411
           ++++   F KI FYS+V+I+ E
Sbjct: 396 LMDIYADFVKIFFYSMVIINLE 417

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 85/174 (48%), Gaps = 20/174 (11%)

Query: 6   VKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLS---------- 55
           V  D+  D+  + LW+WYL  +R+G FEEL   + K+  +   + E L +          
Sbjct: 2   VLFDEIKDDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEE 61

Query: 56  DSVLFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRC------YNH 109
           D+ + +  +L +S+   + ++  ++++FL D F   DL  I I+++  +         +H
Sbjct: 62  DANISDGNILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDH 121

Query: 110 ENHYLISDSLSNFNDKSFLEFGAKSRRPRDDTEILG--QDSNNQYSIISGETEA 161
           E +Y++ DSL+     S  E        RDDT  +   ++ N+++  ++  T+A
Sbjct: 122 ETYYMVIDSLNKLLTTSIEEVSVSCH--RDDTSNIDRYKEQNSEFEYVNQSTQA 173

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 15 DENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLS-DSVLFNKKLLLVSIPDAI 73
          + N  W WY+ NL  GNFEELN+N +K   L  FL        +    ++LLLV+ P  +
Sbjct: 16 ESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSPYGL 75

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 339 SILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVL 391
           S+L     + +L+ AVRQ  +D        DW++YD  FS+NNL+   L D+L
Sbjct: 263 SLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDIL 307

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 350 LFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYS 404
            FTA+++ N       +   WL++D  F     Q+++   +LE+ K F KI FYS
Sbjct: 582 FFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYS 630

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 66/129 (51%), Gaps = 16/129 (12%)

Query: 13  DND-ENGLWSWYLCNLRHGNFEELN--NNQLKFALLRRFLNEQLLSDSVLFNKK---LLL 66
           DND E  LW+WYL N+    F E N   N+ K++ L++ ++++L + + +  KK   ++ 
Sbjct: 14  DNDIEYNLWTWYLNNIEEKTFHEFNEIENKEKYSKLKKLIDKKLFTVTNINTKKVKNIIF 73

Query: 67  VSIPDAIHENTN----LLENFLRDYFNLDDLQFIQIQK--LTQDRCYNHENHYLISDSLS 120
           +++P   +  T      L+ +L   F++  L   ++Q    T   C    N+ LI D + 
Sbjct: 74  LTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSC----NYCLIMDPIL 129

Query: 121 NFNDKSFLE 129
           NF + +F E
Sbjct: 130 NFQNTTFKE 138

>Skud_15.451 Chr15 complement(790983..791948) [966 bp, 321 aa] {ON}
           YOR288C (REAL)
          Length = 321

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%)

Query: 355 RQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEEVAA 414
           +Q    P    +  DWL     +S++N ++  L D    +K  PKIL Y   +I E+V +
Sbjct: 183 KQDKISPVYKSIALDWLGKFQFYSISNKKLKKLTDTRSSDKKIPKILRYVQEIIPEQVQS 242

Query: 415 D 415
           D
Sbjct: 243 D 243

>NCAS0E02660 Chr5 (533776..535794) [2019 bp, 672 aa] {ON} Anc_7.384
           YBL060W
          Length = 672

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 443 KVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGXXXXXXXXXKNSEGVVVPLY 502
           KVQP L H L    SY     Y SSL P +S    + E           ++   V +P+ 
Sbjct: 233 KVQPQLEHELL---SYYEALKY-SSL-PLFSRQNSSVETVATGKKSHTLRHGSQVSIPIE 287

Query: 503 SATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSRKL 538
                +++  + H  ++  ++  +W FHH+ +  KL
Sbjct: 288 RTPSRSTSMYSGHSLVKESQTTSNWKFHHNKTLPKL 323

>YNL329C Chr14 complement(19541..22633) [3093 bp, 1030 aa] {ON}
           PEX6AAA-peroxin that heterodimerizes with AAA-peroxin
           Pex1p and participates in the recycling of peroxisomal
           signal receptor Pex5p from the peroxisomal membrane to
           the cystosol
          Length = 1030

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%)

Query: 63  KLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLSN 121
           KLL + IPD   +  N+LE   R +   +D++ I++ KL        + + L SD++ N
Sbjct: 895 KLLYLGIPDTDTKQLNILEALTRKFVLDNDVKLIELAKLCPFNYTGADFYALCSDAMLN 953

>Skud_14.12 Chr14 complement(12962..16126) [3165 bp, 1054 aa] {ON}
           YNL329C (REAL)
          Length = 1054

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 15/97 (15%)

Query: 63  KLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLSNF 122
           KLL + IPD   +  N+LE   R +    D++ I++ KL        + + L SD++ N 
Sbjct: 913 KLLYLGIPDTDVKQLNILEALTRKFVLDSDVRLIELAKLCPFNYTGADFYALCSDAMLN- 971

Query: 123 NDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGET 159
                    A SR  R     L +   +QY+  SGE+
Sbjct: 972 ---------AMSRIAR-----LVETKVSQYNEASGES 994

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,549,541
Number of extensions: 2462603
Number of successful extensions: 7701
Number of sequences better than 10.0: 50
Number of HSP's gapped: 7954
Number of HSP's successfully gapped: 77
Length of query: 631
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 515
Effective length of database: 40,180,143
Effective search space: 20692773645
Effective search space used: 20692773645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)