Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G03718g5.525ON85785744710.0
SAKL0G04884g5.525ON93092222130.0
ZYRO0D12518g5.525ON88189317610.0
TDEL0A038905.525ON83184517470.0
NCAS0F010705.525ON90489117520.0
KLLA0A01804g5.525ON94578117360.0
NDAI0H015805.525ON90990517140.0
KAFR0E033105.525ON93879316280.0
Skud_4.6955.525ON95478516240.0
YDR421W (ARO80)5.525ON95078716230.0
Smik_4.6965.525ON94977916170.0
Suva_2.5985.525ON96578615940.0
ADR199C5.525ON94493515790.0
Kpol_1028.825.525ON92592715720.0
TPHA0L003505.525ON85987815370.0
KNAG0C032505.525ON93678713891e-178
TBLA0D016705.525ON101881113651e-173
CAGL0F03025g5.525ON92893012661e-160
KLLA0E02663gna 1ON1109581146e-05
TPHA0B015854.344ON8123591121e-04
CAGL0H00396g7.512ON9403131112e-04
KNAG0F037207.512ON7663111093e-04
TBLA0E034803.109ON1046581084e-04
SAKL0D03586g3.264ON801931066e-04
KLLA0A06039g1.199ON657621058e-04
Ecym_1146na 2ON6652471040.001
Kpol_1008.137.512ON9023031040.001
KAFR0F010406.279ON8343341030.001
YBR150C (TBS1)3.109ON10941391020.002
SAKL0G17622gna 2ON6762501010.002
Kpol_455.108.879ON830811000.003
Kwal_27.96888.879ON8411121000.003
CAGL0I07755g3.109ON1053521000.004
Ecym_4635na 1ON856821000.004
KNAG0E041004.344ON903551000.004
SAKL0D02596gna 3ON75080990.004
Smik_17.27singletonON68842990.004
CAGL0K11902g3.264ON831144980.005
KNAG0D052407.512ON86957980.005
CAGL0F07909g3.109ON104954980.006
SAKL0E08998g2.231ON82352980.006
Kwal_56.230583.264ON77591970.006
CAGL0F07865g8.423ON84481970.007
ZYRO0A03058g3.264ON73691970.007
TPHA0B004104.344ON94556970.008
KLLA0F19602g8.283ON60360960.010
NCAS0C002208.879ON839191960.010
TDEL0D051503.109ON99665960.010
CAGL0H06875g8.879ON70266950.010
TBLA0F012003.109ON108671950.012
TDEL0H005907.512ON817299950.013
Kwal_26.81092.547ON97038950.014
Kwal_55.218847.512ON882317940.015
SAKL0D00264g8.879ON84839940.015
SAKL0A01386gna 4ON77065940.016
KLTH0E16500g8.879ON833111940.016
KNAG0J002108.879ON86139940.016
CAGL0H04367g4.344ON94561940.017
Suva_15.773.109ON102971930.020
KAFR0E012503.264ON73658930.022
NDAI0K001508.879ON95339930.023
KNAG0G021308.283ON63263920.023
TBLA0E047504.344ON128372930.024
KNAG0A025508.423ON73059920.027
KLLA0B04620g4.344ON91944920.028
KLLA0F04213g3.264ON76856920.028
Ecym_8404na 5ON885237920.030
TBLA0H006808.423ON880106920.030
KAFR0A03060singletonON86045920.030
TDEL0D00820na 2ON685323910.032
Kwal_23.6425na 6ON73552910.034
KLTH0D16852g4.344ON81160910.034
KAFR0C039002.654ON81852910.034
KNAG0C011601.199ON83562910.035
KNAG0A02300singletonON72951910.039
Kpol_1061.113.264ON73360900.043
KLTH0D16456gna 2ON661244900.043
SAKL0C09944g3.109ON106150910.043
KLTH0F18392g7.512ON87362900.044
TDEL0H007901.199ON82793900.047
TBLA0C062306.60ON79546900.054
Smik_13.644.344ON944109900.056
NCAS0E023107.56ON71862890.057
TPHA0M010403.264ON77091890.059
KLLA0F18084gna 7ON86094890.059
NDAI0A069903.109ON97866890.064
CAGL0M12298g7.17ON99446890.064
YKR064W (OAF3)1.199ON86359890.064
KLLA0C14212gna 8ON104078890.066
KLTH0C07480g3.264ON77555890.066
TBLA0I025408.423ON125944890.068
ABL099W3.264ON80068890.069
ZYRO0G17512gsingletonON52336880.080
NCAS0H00780singletonON90950880.083
Kwal_23.47542.231ON81250880.085
ZYRO0D08316gna 4ON68044880.086
Smik_4.4608.423ON91883880.088
KLTH0G09108g2.231ON78250880.089
KLLA0C17050gna 5ON95571880.089
KLLA0C16489gna 9ON728164870.092
Skud_13.664.344ON939105870.099
NDAI0D00900singletonON86576870.100
Skud_12.5447.512ON888346870.10
ACL096W2.654ON83548870.10
SAKL0G02992gna 1ON106163870.10
SAKL0A00704gna 6ON71848870.10
ZYRO0A00440g8.879ON85053870.10
NDAI0C002602.654ON104147870.11
CAGL0J07150g7.17ON102293870.11
KLTH0D07260g2.547ON97948870.11
Kpol_1001.34.344ON85656870.11
KAFR0C03660singletonON84754870.12
TDEL0E00300singletonON63764860.12
KAFR0A031807.512ON84661870.12
KNAG0M00120singletonON88144870.12
KAFR0J017102.231ON84850860.13
Kpol_538.528.879ON90735860.13
TDEL0C044802.231ON85255860.13
NDAI0G041403.109ON100150860.13
YOR172W (YRM1)6.61ON78649860.13
YLR098C (CHA4)8.283ON64868860.13
TPHA0G003807.512ON87362860.14
NCAS0I002707.17ON94452860.14
ADR365W7.56ON70188860.14
Skud_15.3346.61ON79048860.14
Ecym_81598.879ON90851860.14
Smik_12.1578.283ON64451860.15
SAKL0F15444g7.512ON964327860.15
TBLA0A04280singletonON89241860.15
KLLA0A02585gna 10ON37042850.15
KNAG0M010406.60ON84156860.15
Ecym_33922.654ON84751860.16
KAFR0G005701.199ON862136860.16
TBLA0G011308.879ON113274860.16
KAFR0B063408.423ON86444860.16
Skud_15.643.109ON103271860.16
NDAI0A034204.113ON110844860.16
NCAS0B065502.231ON90651860.16
KLTH0B00352gsingletonON93467860.17
Kwal_47.168624.344ON74347850.17
Suva_2.1873.264ON78455850.17
NDAI0E038507.56ON76851850.17
SAKL0D01342g8.845ON127054850.18
NDAI0J004407.512ON82352850.18
KAFR0B014502.547ON108899850.19
Ecym_53972.231ON82658850.19
Suva_9.592.231ON92652850.19
Smik_9.392.231ON101252850.19
YIL130W (ASG1)2.231ON96452850.19
Kwal_47.16939na 2ON669250850.20
NCAS0H002707.512ON90659850.20
Smik_15.3506.61ON78449850.20
NCAS0A105503.264ON74159850.20
ZYRO0D14080g6.61ON92150850.20
Kwal_26.7095na 11ON83859850.20
KAFR0F014901.128ON65863840.21
Skud_20.3singletonON47050840.22
TBLA0G005206.61ON87862840.22
Skud_11.2142.654ON98157850.22
NDAI0B038502.231ON93051840.22
SAKL0H13024g8.423ON75459840.22
KLLA0E19603g7.360ON68148840.23
AGL091W8.423ON86667840.23
ACR241C1.199ON79556840.23
Ecym_72037.512ON88456840.23
NDAI0F00110singletonON50839840.23
Skud_9.372.231ON95452840.23
YKL015W (PUT3)2.654ON97951840.24
Smik_16.15singletonON46350830.24
TBLA0G026102.231ON100059840.25
KLLA0A10329gna 12ON63957840.25
KLLA0F00572gna 13ON59796830.27
Kwal_23.6529na 12ON59858830.27
TDEL0B004808.879ON83546840.27
ZYRO0E00572g2.654ON83848840.28
YML076C (WAR1)4.344ON94469840.28
KLLA0D00484g6.0ON100451840.28
Kpol_1039.112.231ON99252840.28
KLLA0C03201g1.128ON65065830.28
KNAG0E004507.56ON71046830.28
YPR196WsingletonON47050830.29
Suva_2.3818.423ON918137830.29
Kpol_1049.19na 14ON94341830.30
Ecym_51313.264ON77052830.31
YMR019W (STB4)2.565ON94953830.31
NCAS0A047502.547ON114148830.32
Ecym_11354.344ON82247830.32
KNAG0A044808.423ON101347830.32
KLLA0A03421gna 15ON88047830.32
Smik_11.2402.654ON97648830.33
KLTH0D00594gna 13ON63155830.33
KAFR0I002804.344ON93655830.33
Suva_11.2132.654ON98551830.35
NDAI0D031804.344ON98971830.36
YDR034C (LYS14)3.264ON79055820.39
NDAI0D002207.512ON94449820.39
TBLA0I018903.264ON82558820.41
KAFR0L021308.879ON88239820.41
KLLA0F04609g2.231ON91650820.41
Suva_13.1862.565ON89441820.41
Skud_4.4758.423ON91352820.42
TPHA0L010608.423ON97343820.42
TBLA0C040504.113ON120738820.43
Skud_13.438.879ON88039820.44
Skud_15.5327.17ON1000155820.44
Skud_4.2873.264ON78455820.44
KLLA0C19228gsingletonON59147820.45
Kpol_1042.66.60ON78066820.46
CAGL0M05907g1.199ON89156820.47
NCAS0A150207.512ON80952810.50
Smik_13.1832.565ON91163810.50
TBLA0C019105.577ON114844810.51
AAL175W8.879ON88339810.52
KNAG0E017602.231ON90250810.53
ZYRO0D01650g7.512ON860297810.53
Kwal_56.226053.109ON86557810.53
AGR061C8.283ON61252810.53
Kwal_55.20722singletonON82758810.54
TBLA0A007302.654ON103750810.54
TDEL0D007304.344ON80644810.55
ZYRO0G12584gna 3ON68649810.55
KLLA0C10923g5.235ON77553810.55
SAKL0B10538g7.56ON70146810.57
KAFR0B039508.845ON124645810.57
Smik_13.368.879ON88039810.58
SAKL0H00682gna 8ON92245810.59
KAFR0A066904.113ON99746810.59
ZYRO0G10252g4.113ON103664810.59
KNAG0E041507.17ON113689810.60
Kwal_33.131181.26ON779135810.60
ACL058Wna 5ON81770810.61
YML099C (ARG81)8.879ON88039810.62
KLLA0E19779g7.367ON56798800.64
KNAG0H012603.264ON74151800.66
Smik_16.20na 16ON47350800.67
Suva_13.498.879ON88239800.70
KLLA0D10593g7.512ON925307800.71
Skud_7.2744.113ON108048800.71
Kpol_1057.32.651ON102746800.72
Smik_10.251.128ON77296800.74
KLLA0D10197g8.879ON85667800.74
TPHA0A045403.109ON117845800.74
NCAS0H034202.654ON90252800.75
SAKL0B04620gna 10ON36246790.75
NDAI0A010401.199ON99539800.76
KAFR0C049807.17ON95145800.78
SAKL0C03938g1.128ON78076800.78
YGL013C (PDR1)4.113ON106851800.80
Kwal_23.6537na 17ON55236790.81
NDAI0A057503.264ON75949800.82
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G03718g
         (857 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...  1726   0.0  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...   857   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   682   0.0  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...   677   0.0  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...   679   0.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   673   0.0  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...   664   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   631   0.0  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...   630   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...   629   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...   627   0.0  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...   618   0.0  
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   612   0.0  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...   610   0.0  
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}     596   0.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   539   e-178
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...   530   e-173
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...   492   e-160
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    49   6e-05
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     48   1e-04
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    47   2e-04
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    47   3e-04
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    46   4e-04
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    45   6e-04
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    45   8e-04
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    45   0.001
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    45   0.001
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    44   0.001
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    44   0.002
SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]...    44   0.002
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    43   0.003
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    43   0.003
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    43   0.004
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    43   0.004
KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.3...    43   0.004
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    43   0.004
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    43   0.004
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    42   0.005
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    42   0.005
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    42   0.006
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    42   0.006
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    42   0.006
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    42   0.007
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    42   0.007
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    42   0.008
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    42   0.010
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       42   0.010
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    42   0.010
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    41   0.010
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    41   0.012
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    41   0.013
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    41   0.014
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    41   0.015
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    41   0.015
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    41   0.016
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    41   0.016
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    41   0.016
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    41   0.017
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    40   0.020
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    40   0.022
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    40   0.023
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    40   0.023
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    40   0.024
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    40   0.027
KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {...    40   0.028
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    40   0.028
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    40   0.030
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    40   0.030
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    40   0.030
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               40   0.032
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    40   0.034
KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} simi...    40   0.034
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    40   0.034
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    40   0.035
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    40   0.039
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    39   0.043
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    39   0.043
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    40   0.043
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    39   0.044
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    39   0.047
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    39   0.054
Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {O...    39   0.056
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      39   0.057
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    39   0.059
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    39   0.059
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    39   0.064
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    39   0.064
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    39   0.064
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    39   0.066
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    39   0.066
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    39   0.068
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    39   0.069
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    39   0.080
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    39   0.083
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    39   0.085
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    39   0.086
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    39   0.088
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    39   0.089
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    39   0.089
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    38   0.092
Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {O...    38   0.099
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               38   0.100
Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451...    38   0.10 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    38   0.10 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    38   0.10 
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    38   0.10 
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    38   0.10 
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    38   0.11 
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    38   0.11 
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    38   0.11 
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    38   0.11 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    38   0.12 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 38   0.12 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    38   0.12 
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      38   0.12 
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    38   0.13 
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    38   0.13 
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    38   0.13 
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    38   0.13 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    38   0.13 
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    38   0.13 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       38   0.14 
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    38   0.14 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    38   0.14 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    38   0.14 
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    38   0.14 
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    38   0.15 
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    38   0.15 
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    38   0.15 
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    37   0.15 
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    38   0.15 
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    38   0.16 
KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {O...    38   0.16 
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    38   0.16 
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    38   0.16 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    38   0.16 
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    38   0.16 
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    38   0.16 
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    38   0.17 
Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {...    37   0.17 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    37   0.17 
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      37   0.17 
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...    37   0.18 
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    37   0.18 
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    37   0.19 
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    37   0.19 
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    37   0.19 
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    37   0.19 
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    37   0.19 
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    37   0.20 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    37   0.20 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    37   0.20 
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    37   0.20 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    37   0.20 
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    37   0.20 
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    37   0.21 
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     37   0.22 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    37   0.22 
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    37   0.22 
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    37   0.22 
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    37   0.22 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    37   0.23 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    37   0.23 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    37   0.23 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    37   0.23 
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 37   0.23 
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    37   0.23 
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    37   0.24 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    37   0.24 
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    37   0.25 
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    37   0.25 
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    37   0.27 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    37   0.27 
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    37   0.27 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    37   0.28 
YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON} ...    37   0.28 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    37   0.28 
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    37   0.28 
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    37   0.28 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    37   0.28 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    37   0.29 
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    37   0.29 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    37   0.30 
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    37   0.31 
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    37   0.31 
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    37   0.32 
Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}...    37   0.32 
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    37   0.32 
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    37   0.32 
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    37   0.33 
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    37   0.33 
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    37   0.33 
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    37   0.35 
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    37   0.36 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    36   0.39 
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    36   0.39 
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    36   0.41 
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    36   0.41 
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    36   0.41 
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    36   0.41 
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    36   0.42 
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    36   0.42 
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    36   0.43 
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    36   0.44 
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    36   0.44 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    36   0.44 
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    36   0.45 
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    36   0.46 
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    36   0.47 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    36   0.50 
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    36   0.50 
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    36   0.51 
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    36   0.52 
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    36   0.53 
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    36   0.53 
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    36   0.53 
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    36   0.53 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    36   0.54 
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    36   0.54 
TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {O...    36   0.55 
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    36   0.55 
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    36   0.55 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    36   0.57 
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...    36   0.57 
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    36   0.58 
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    36   0.59 
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    36   0.59 
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    36   0.59 
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    36   0.60 
Kwal_33.13118 s33 (80421..82760) [2340 bp, 779 aa] {ON} YDR520C ...    36   0.60 
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    36   0.61 
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    36   0.62 
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    35   0.64 
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    35   0.66 
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    35   0.67 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    35   0.70 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    35   0.71 
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    35   0.71 
Kpol_1057.3 s1057 (3619..6702) [3084 bp, 1027 aa] {ON} (3619..67...    35   0.72 
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    35   0.74 
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    35   0.74 
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    35   0.74 
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    35   0.75 
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    35   0.75 
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    35   0.76 
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    35   0.78 
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    35   0.78 
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    35   0.80 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    35   0.81 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    35   0.82 
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    35   0.82 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    35   0.82 
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               35   0.84 
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    35   0.84 
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    35   0.86 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    35   0.88 
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    35   0.90 
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    35   0.90 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    35   0.91 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    35   0.91 
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    35   0.91 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    35   0.94 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    35   0.94 
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    35   0.95 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    35   0.95 
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    35   0.96 
KLLA0C08657g Chr3 (757100..759268) [2169 bp, 722 aa] {ON} some s...    35   0.96 
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    35   0.96 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    35   0.97 
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    35   0.98 
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    35   0.99 
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    35   1.00 
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     35   1.0  
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    35   1.0  
Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451...    35   1.0  
KAFR0B07080 Chr2 complement(1480370..1482397) [2028 bp, 675 aa] ...    35   1.1  
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    35   1.1  
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    35   1.1  
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    35   1.1  
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    35   1.1  
KAFR0B00100 Chr2 (2110..4137) [2028 bp, 675 aa] {ON}                   35   1.1  
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    35   1.1  
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      35   1.1  
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    35   1.2  
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    35   1.2  
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    35   1.2  
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    35   1.2  
ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON} sim...    35   1.2  
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    35   1.2  
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    35   1.3  
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               35   1.3  
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    35   1.3  
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    35   1.3  
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    35   1.3  
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    35   1.3  
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    35   1.3  
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    35   1.3  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    34   1.4  
Suva_10.569 Chr10 (990917..992962,992995..993603) [2655 bp, 884 ...    35   1.4  
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    35   1.4  
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    34   1.4  
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    33   1.5  
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    34   1.5  
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    34   1.5  
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    34   1.6  
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    34   1.6  
Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {O...    34   1.6  
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    34   1.6  
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    34   1.6  
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    34   1.6  
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    34   1.7  
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    34   1.7  
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    34   1.7  
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    34   1.7  
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    34   1.7  
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    34   1.8  
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    34   1.8  
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    34   1.8  
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    34   1.8  
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    34   1.8  
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    34   1.9  
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    34   1.9  
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    34   2.0  
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    34   2.0  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    34   2.0  
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    34   2.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...    34   2.0  
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    34   2.1  
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    34   2.1  
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    34   2.2  
AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic ho...    34   2.2  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    34   2.2  
TBLA0A07480 Chr1 (1852023..1854782) [2760 bp, 919 aa] {ON} Anc_1...    34   2.3  
YLR213C Chr12 complement(566654..567922) [1269 bp, 422 aa] {ON} ...    33   2.3  
ACR028C Chr3 complement(408701..410506) [1806 bp, 601 aa] {ON} N...    33   2.5  
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    34   2.5  
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    33   2.5  
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    33   2.6  
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    33   2.6  
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    33   2.6  
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    33   2.6  
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    33   2.6  
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    33   2.7  
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    33   2.7  
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    33   2.7  
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    33   2.7  
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    33   2.8  
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    33   2.9  
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    33   2.9  
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    33   2.9  
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    33   3.0  
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    33   3.0  
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    33   3.0  
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    33   3.0  
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    33   3.1  
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    33   3.2  
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    33   3.2  
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    33   3.2  
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    33   3.2  
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    33   3.2  
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    33   3.3  
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    33   3.4  
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    33   3.4  
NCAS0I02410 Chr9 (451205..453964) [2760 bp, 919 aa] {ON} Anc_3.1...    33   3.5  
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    33   3.5  
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    33   3.5  
Smik_9.227 Chr9 (373211..376084) [2874 bp, 957 aa] {ON} YIR023W ...    33   3.6  
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    33   3.6  
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    33   3.7  
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    33   3.7  
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    33   3.7  
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    33   3.8  
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               33   3.8  
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    33   3.9  
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    33   3.9  
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    33   4.0  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    33   4.0  
KNAG0G03000 Chr7 (651063..651752) [690 bp, 229 aa] {ON} Anc_8.75...    32   4.1  
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    33   4.2  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...    33   4.2  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...    33   4.4  
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    33   4.4  
Kwal_33.13934 s33 complement(456687..459080) [2394 bp, 797 aa] {...    33   4.5  
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    33   4.5  
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               33   4.6  
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    33   4.7  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    33   4.8  
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    33   4.9  
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    33   5.0  
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    33   5.1  
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                33   5.1  
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    32   5.1  
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    33   5.2  
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    33   5.3  
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    33   5.4  
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    33   5.6  
TPHA0J00190 Chr10 (44450..45142) [693 bp, 230 aa] {ON}                 32   5.6  
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    33   5.6  
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    32   5.6  
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    32   5.8  
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    32   6.4  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    32   6.5  
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    32   6.7  
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    32   6.9  
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    32   7.0  
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    32   7.3  
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    32   7.4  
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    32   7.5  
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    32   7.6  
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    32   7.7  
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    32   8.0  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    32   8.5  
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    32   8.5  
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    32   8.6  
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    32   8.9  
NCAS0D01290 Chr4 complement(233978..236194) [2217 bp, 738 aa] {O...    32   9.4  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    32   10.0 
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    32   10.0 

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score = 1726 bits (4471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 827/857 (96%), Positives = 827/857 (96%)

Query: 1   MKRLATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60
           MKRLATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL
Sbjct: 1   MKRLATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60

Query: 61  ENSKRGGRKRIEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNA 120
           ENSKRGGRKRIEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNA
Sbjct: 61  ENSKRGGRKRIEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNA 120

Query: 121 LEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLI 180
           LEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLI
Sbjct: 121 LEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLI 180

Query: 181 EKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELK 240
           EKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELK
Sbjct: 181 EKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELK 240

Query: 241 RYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTRS 300
           RYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTRS
Sbjct: 241 RYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTRS 300

Query: 301 VGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRSDNTSLTGMGAMRRS 360
           VGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRSDNTSLTGMGAMRRS
Sbjct: 301 VGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRSDNTSLTGMGAMRRS 360

Query: 361 DRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSILSQSLAEVSLNGH 420
           DRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSILSQSLAEVSLNGH
Sbjct: 361 DRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSILSQSLAEVSLNGH 420

Query: 421 DGDSGLSSACIEEIFRNEDSKRRWKSYTQQRDSVEGKSVGFCDNEKEFLIDEYAFFHNED 480
           DGDSGLSSACIEEIFRNEDSKRRWKSYTQQRDSVEGKSVGFCDNEKEFLIDEYAFFHNED
Sbjct: 421 DGDSGLSSACIEEIFRNEDSKRRWKSYTQQRDSVEGKSVGFCDNEKEFLIDEYAFFHNED 480

Query: 481 SDAYRDLSNLGTHEKSKLSAADKLLFTPRQRAKVELLRIMSIGYEAIYYKDTKLTLIDHK 540
           SDAYRDLSNLGTHEKSKLSAADKLLFTPRQRAKVELLRIMSIGYEAIYYKDTKLTLIDHK
Sbjct: 481 SDAYRDLSNLGTHEKSKLSAADKLLFTPRQRAKVELLRIMSIGYEAIYYKDTKLTLIDHK 540

Query: 541 HKLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYF 600
           HKLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYF
Sbjct: 541 HKLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYF 600

Query: 601 YCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKY 660
           YCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKY
Sbjct: 601 YCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKY 660

Query: 661 MPXXXXXXXXXXXXXXXXCYMTLTGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLR 720
           MP                CYMTLTGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLR
Sbjct: 661 MPVRWAARIIRAVAFVVRCYMTLTGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLR 720

Query: 721 EASPDELHLCSRFSTVLMFLCTEMKRKQHSEPQXXXXXXXXXXXXXXPTDAPARMPTTPA 780
           EASPDELHLCSRFSTVLMFLCTEMKRKQHSEPQ              PTDAPARMPTTPA
Sbjct: 721 EASPDELHLCSRFSTVLMFLCTEMKRKQHSEPQNSELRRSSSHSLHNPTDAPARMPTTPA 780

Query: 781 ENYAATDFAIPAFLETPHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINNDKNMT 840
           ENYAATDFAIPAFLETPHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINNDKNMT
Sbjct: 781 ENYAATDFAIPAFLETPHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINNDKNMT 840

Query: 841 FENLYNEAMGYEHLPKQ 857
           FENLYNEAMGYEHLPKQ
Sbjct: 841 FENLYNEAMGYEHLPKQ 857

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/922 (49%), Positives = 584/922 (63%), Gaps = 82/922 (8%)

Query: 11  EVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70
           ++   K+RR Y+ACLNCR+RK +CDLGP D+P DPPCVRCKRERKEC+F E++KRGG + 
Sbjct: 13  QIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRV 72

Query: 71  IEWTVDGNTDVNATARFE-----------AEDKYIPVATLKDTTSIKEGSLTPELNSMHN 119
              +       NATA              +E    P    K   SI    +  EL +M +
Sbjct: 73  ANVSAIAENTANATASMSKAITSVFQGNTSEGSQQP--DFKRENSIDPLPINSELTTMQD 130

Query: 120 ALEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESP--NQHASGSKRAS----- 172
           ALEFLAKAAGS AKEDSR  + +  + ++ +  ++  R ++P  +  A  S R S     
Sbjct: 131 ALEFLAKAAGSVAKEDSRDLVDASTKYEE-LESQSNSRTDTPISSGSAQDSTRNSNSANI 189

Query: 173 --------------LATPG-KLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDL 217
                         L  P   LIEKLS  +P     L D+EYIG  K+L+E+EA +LIDL
Sbjct: 190 PDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDL 249

Query: 218 FFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVH 277
           FFL MHPFFP++P QL+   EL +YPILLCAILTIS+RYH+F E  +  GE ++RN+E+H
Sbjct: 250 FFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIH 309

Query: 278 DRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRR 337
           +RLWIYCQRLISQ+VWAEASTRS+GT+LAFLLFTEWNPRAIHW W+DYAN+  L+D+S+R
Sbjct: 310 ERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLNDVSKR 369

Query: 338 DYHSEA----------KRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKI 387
           D  + A           +     LTG+ AMRRSDRMAWMLTGTAVRLAQDMGFMN S KI
Sbjct: 370 DLSNVACSSSSSTACNSQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKI 429

Query: 388 FTALHITETQTAMNMNQRSILSQSLAEVSLNGHDGDSGLSSACIEEIFRNEDSKRRWKSY 447
           FTA HI+ET TAMNMNQRSILSQSLAE++LNG++ D    S  + +I +++ SK RW  +
Sbjct: 430 FTATHISETHTAMNMNQRSILSQSLAEINLNGYEDDVENESYYLGQILKSDGSKERWSKF 489

Query: 448 TQQRDSVEGKSVGFCDNEKEFLIDEYAFFHNED--SDAYRDLSNLGTHEKSKLSAADK-- 503
            ++  S   +     D E+EF+ DEY  ++++   + A+ D   +   +  K    ++  
Sbjct: 490 LKKLGSSSTRG-RMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRKKQIEEEPY 548

Query: 504 -LLFTPRQRAKVELLRIMSIGYEAIYYKDTKLTLIDHKHKLAVLGILAPMIKGWHNTYKH 562
            L F+  QRAK+ELLRIMSIGYE IY    KL      H LA+L IL+P+I+ W+NTYK 
Sbjct: 549 NLKFSFGQRAKIELLRIMSIGYETIYRGKLKLYSNSQYHNLALLSILSPLIESWYNTYKT 608

Query: 563 LLVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKK 622
           +L P +G  C       K   ++   K+D ESLISDY+YCQLYIYSLALQ++ GT KDKK
Sbjct: 609 ILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVDVGTPKDKK 668

Query: 623 PNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMT 682
             +NE+TK A+YVELAYNAAKE+L+SAIRVHKL+ LKYMP                CY+T
Sbjct: 669 LRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLT 728

Query: 683 LTGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCT 742
           LTGSG+ ++P A TIL + VI  EEII+ IQ+AAITLREASPDELHLC+R+ST+LM+LCT
Sbjct: 729 LTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYSTILMYLCT 788

Query: 743 EMKRKQHSEPQXXXXXXXXXXXXXXPTDA------------------------PARMPTT 778
           EMK +    PQ                +                         P RM + 
Sbjct: 789 EMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQRGPLPPPRMNSL 848

Query: 779 P-AENYA--ATDFAIPAFLETPHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINN 835
           P   N+A    +F  P   +T    HLP+++ DWF TSD++GLDFVEPW EM+EQQFI+N
Sbjct: 849 PETTNFAFNVDNFFSPQGAQT---HHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFISN 905

Query: 836 DKNMTFENLYNEAMGYEHLPKQ 857
           D N TFENLYN+A G +    Q
Sbjct: 906 DNNKTFENLYNQATGLDFQTSQ 927

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/893 (44%), Positives = 533/893 (59%), Gaps = 80/893 (8%)

Query: 1   MKRLATGNDLEVSS-QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
           MKR  T  +   S+  K+RR YKAC++CR++K +CD+GP D+P  PPC+RC+RE KEC+ 
Sbjct: 1   MKRSTTNPESSGSNPTKWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECIL 60

Query: 60  LENSKRGGRK------RIEWTVDGNTDVNATARFEAEDKYI-------PVATLKDTTSIK 106
            EN +RG         +IE     N  V    + E+E   +       P  +  +   + 
Sbjct: 61  PENKRRGNTDTEFKLGKIE-----NGLVGVMNKSESEQSLLSQTRAPPPNGSTSNNLDLV 115

Query: 107 EGSLTPELNSMHNALEFLAKAAGSAAKED--------SRSRIPSYERQDKTIREKTYHR- 157
           +     E+ +M+NALEFLAKAAGS +KE+        +RS +      D  +        
Sbjct: 116 DPKWKFEIGTMYNALEFLAKAAGSVSKEEPIEMKSPQNRSDLGVGNMPDTALNGVMSDNI 175

Query: 158 ------EES---PNQHASGSKRASLATPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTE 208
                 +ES   P   A+GS+RA+      LIEKLS  +P S   L DV+YIG  KLL+E
Sbjct: 176 GNLDISDESFLAPLTTANGSQRAA----APLIEKLSSMRPKSSKKLIDVDYIGPSKLLSE 231

Query: 209 KEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGE 268
            EATRLID+FFL MHPFFP+IP QL+   EL RYPILLCAILTISARY+ F E    +GE
Sbjct: 232 DEATRLIDIFFLTMHPFFPHIPLQLQDPDELVRYPILLCAILTISARYNPFGELGFYDGE 291

Query: 269 RSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYAND 328
             +RNIEVH+RLWIYCQRLISQ++WAEASTRS+GT+LAFLLFTEWNPRAIHW W+DYAN+
Sbjct: 292 AHNRNIEVHERLWIYCQRLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANN 351

Query: 329 TSLSDISRRDYHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIF 388
             L+D+++R+ H      D  + TGM A+RRSDRMAWML G AVRLAQDM F++ S KIF
Sbjct: 352 PELNDVTKRETHGANTPRDTETFTGMAAVRRSDRMAWMLIGAAVRLAQDMSFIDTSSKIF 411

Query: 389 TALHITETQTAMNMNQRSILSQSLAEVSLNGHD--GDSGLSSACIEEIFRNEDSKRRWKS 446
            A HI E  TAMN+NQ+SILS+SL+EV+    +   D G  +  +E I + ++SK RW +
Sbjct: 412 VATHIAEAHTAMNLNQKSILSESLSEVNREVLERLDDIGNENFYLEHILQKDESKERWTN 471

Query: 447 YTQQ-RDSVEGKSVG-FCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKL 504
           + Q   +    K  G   D E+EFL DEY  ++    +A  D S+     KS L+    L
Sbjct: 472 FLQNVSEGRRAKGTGPLTDMEREFLNDEYVLYY---VNARNDASS-----KSSLTLPFPL 523

Query: 505 LFTPRQRAKVELLRIMSIGYEAIYYKD----TKLTLIDHKHKLAVLGILAPMIKGWHNTY 560
            F+  QRAK+ELLRI++IGYE+IYY+     T+L   + K  LA+L I++ +I+ WH TY
Sbjct: 524 KFSHPQRAKIELLRILTIGYESIYYESEKDKTQLINGNPKRNLALLEIISTLIEKWHATY 583

Query: 561 KHLLVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKD 620
           K LL+P     C      NK A ++   +ID ESL  DY YCQLYIYSLALQ +      
Sbjct: 584 KDLLIPANATPCSLDMARNKRAVHELTQQIDRESLSCDYNYCQLYIYSLALQNDVKNMDL 643

Query: 621 KKPNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCY 680
           K P   E+ KSA+YVELAY AA+ +L SA R+H L+ L+YMP                CY
Sbjct: 644 KMP---EIRKSARYVELAYRAAEGILDSAERIHSLKMLRYMPVRWVTRIVRAVAFLVKCY 700

Query: 681 MTLTGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFL 740
           + LT  GL ++P A TIL + VI +EE + +I++AA+TL+EA+PDE+HL  R+S +L FL
Sbjct: 701 LVLTKDGLAANPVAGTILRLTVIPSEETVPIIERAAVTLQEAAPDEVHLGMRYSKILKFL 760

Query: 741 CTEMK-RKQHSEPQXXXXXXXXXXXXXXPTDAPARMPTTPAENYA-----------ATDF 788
           C E+K R Q SE                  +   R P    + +A           +   
Sbjct: 761 CAEVKMRTQMSERDEEAEEERKQRQQ---LECYHRQPRERRQQHAQPVISQSHSPPSPSV 817

Query: 789 AIPAFLETPHPSHLPSELE-----DWFCTSDDVGLDFVEPWAEMLEQQFINND 836
            + + ++   PS  P++L      D F  SDD+GLDFV+ W EM+E +++ ++
Sbjct: 818 MLNSSMDPYSPSAPPADLPFEDPFDLFAASDDIGLDFVDTWTEMIENRYMQDE 870

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/845 (45%), Positives = 524/845 (62%), Gaps = 71/845 (8%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWT- 74
           K+RR YKACLNCR RK +CD+GP D P +PPC RCKRE K C FL++ K+   KR   T 
Sbjct: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTN 73

Query: 75  -VDGNTDVNATARFEAE-DKYIPVATLKDTTSIK-EGSLTPELNSMHNALEFLAKAAGSA 131
            ++   +V        E D   P   ++  +  K +G    E++SM NALEFLAKAAGS 
Sbjct: 74  GLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQNALEFLAKAAGSV 133

Query: 132 AKEDS-----RSRIPS-YERQDKTIREKTYHREES-------PNQHASGSKRASLATPGK 178
           AKED+     +   PS   R D + ++ T    E+       P +   GS R ++     
Sbjct: 134 AKEDNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAGIMAPLEADEGSSRKAVP---- 189

Query: 179 LIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQE 238
           LI+KLS  +P     L ++E+IGG   LTE+E  +L+D+FFL M+PFFP+IP QL+  +E
Sbjct: 190 LIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFPHIPLQLQDPEE 249

Query: 239 LKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEAST 298
           L RYP+LLC+I+T+SARYH+F +  + +  +++RNIEVH++LWIYCQ+LISQ++WAEAST
Sbjct: 250 LARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQLWIYCQKLISQTIWAEAST 309

Query: 299 RSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRSDNTSLTGMGAMR 358
           RS+GT+LAFLLFTEWNPRAIHW W+DYAN     D S  D+   +   D+  LTGM A+R
Sbjct: 310 RSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRS-NDF---SISRDSERLTGMAAIR 365

Query: 359 RSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSILSQSLAEVSLN 418
           RSDRMAWMLTG AVRLAQDMGF   S KIFTA HI+ET TAMN+ QRS L++SL E++L 
Sbjct: 366 RSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMNVGQRSTLTESLNEINLG 425

Query: 419 G----HDGDSGLSSACIEEIFRNEDSKRRWKSYTQQ-RDSVEGKSVG-FCDNEKEFLIDE 472
                 +   G     +E+I  N+DSK RW  +    RD       G   D E+EFL DE
Sbjct: 426 SIKFPRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDYAHHDEGPLTDIEREFLNDE 485

Query: 473 YAFFHNEDSDA-YRDLSNLGTHEKSKLSAADKLLFTPRQRAKVELLRIMSIGYEAIY-YK 530
           Y  ++  D D+ +RD SNL             L F+  QRAK+ELLRI+++G+EAIY  K
Sbjct: 486 YVLYYTADGDSKHRDSSNLLPF---------PLRFSKIQRAKIELLRIITVGFEAIYCTK 536

Query: 531 DTKLTLI-DHKHKLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTRDENKNATYDTPSK 589
           D + +L  D    L++L +++P+I+ W+ +Y  LL P  G  C      NK   +    K
Sbjct: 537 DKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDLCRNKREVHYVVRK 596

Query: 590 IDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYVELAYNAAKEVLHSA 649
           ID ESLI +Y+YCQLYIYS ALQ++    K+ +  ++E+T+SAKYVELAYNAAK +L SA
Sbjct: 597 IDRESLICEYYYCQLYIYSSALQVDV---KEGQLKLHEITRSAKYVELAYNAAKMLLTSA 653

Query: 650 IRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTLTGSGLGSDPRATTILAVCVISAEEII 709
            R+H+L  LK MP                CY+TL G+ + ++P A TIL + VI AE+I+
Sbjct: 654 TRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILKLTVIPAEDIL 713

Query: 710 EMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRKQHSEPQXXXXXXXXXXXXXXPT 769
           + I  AA+ L+EASPDELHLC R+ST+LM LC+EM+  +                    T
Sbjct: 714 KTIHTAALILKEASPDELHLCMRYSTILMSLCSEMRESED-----------------YTT 756

Query: 770 DAPARMPTTPAENYAATDFAIPAF-LETPHPSHLPSELEDWFCTSDDVGLDFVEPWAEML 828
           D+P     TP   +   +   P   L+T  P  LP+++ DWF TSD++GL+FVE WAEM+
Sbjct: 757 DSP-----TPGTTFGQDNDPSPIQPLDTAIP--LPNDVVDWFSTSDEIGLEFVESWAEMI 809

Query: 829 EQQFI 833
           EQ+++
Sbjct: 810 EQRYL 814

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/891 (43%), Positives = 526/891 (59%), Gaps = 84/891 (9%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75
           K++R ++AC++CR RK +CDLGP ++P  PPCVRC+RE K C+F      GG       +
Sbjct: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF----SSGGNGMSSANL 81

Query: 76  DGNTDVNATARFEAEDKYIPV---ATLKD---TTSIKEGSLT----------PELNSMHN 119
                 N  A F    + + V   +TL     TT IK+   T           EL SM N
Sbjct: 82  STMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQN 141

Query: 120 ALEFLAKAAGSAAKEDSRSRIPSYER-------QDKTIREKTYHREESPNQH-------A 165
           +LEFLAKAA S A + +        +        D +  +    +++SPN++        
Sbjct: 142 SLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSENDTPVQQQDSPNENYLTPLTTP 201

Query: 166 SGSKRASLATPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPF 225
             S+R++L      +EK    +P S   L D+E+IG  KLL+E+EA  LIDLFFL M+PF
Sbjct: 202 HNSRRSALPQ----LEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFLTMNPF 257

Query: 226 FPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGE--RSSRNIEVHDRLWIY 283
           FP+IP QL+ + EL RYPILLCAILTIS+RYH F E     G   R  RNI VH++LWIY
Sbjct: 258 FPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVHEKLWIY 317

Query: 284 CQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEA 343
           CQRLISQ+VWAEASTRS+GTI AF++FTEWNPRAIHW W+DYAN+    D+++R+  S+ 
Sbjct: 318 CQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKRESFSQE 377

Query: 344 KRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMN 403
              D   LTG+ A+RRSDRMAWMLTGTAVRLAQD+G +  S K+F A HI+E+ TA+NMN
Sbjct: 378 PNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESYTAINMN 437

Query: 404 QRSILSQSLAEVSLNGHDGDSGLSSA--CIEEIFRNEDSKRRWKSYTQQRDSVEGKSVGF 461
           Q  ILSQS  E +L+G D  +G+ +    +E+I +N++SK RW    +  D+  G S  +
Sbjct: 438 QGLILSQSFNERNLDGIDNLNGVDNERLYLEQILQNDESKARWNGILKLLDNEVGISEEY 497

Query: 462 C-DNEKEFLIDEYAFF---HNEDSDAYRDLSNLGTHEKSKLSAADKLLFTPRQRAKVELL 517
             D E+EFL DEY  +   H+ED+           H +  +     L FT  Q+AK+ELL
Sbjct: 498 LQDVEREFLNDEYTLYYADHDEDTQQ---------HTQQIIP----LKFTSTQKAKLELL 544

Query: 518 RIMSIGYEAIYYK--DTKLTLIDHKHKLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPT 575
           RI+ +GYE IYY+  D +L   D +H LAVL ILAP+I+ W+N Y+ LL    G      
Sbjct: 545 RILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEVLSLN 604

Query: 576 RDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYV 635
           +  NK   ++   +I++E++ISDY+YCQLYIYSLALQ++    ++ K  +NE+ + A +V
Sbjct: 605 QRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDV---EENKLKLNEIRRCASFV 661

Query: 636 ELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTLTGSGLGSDPRAT 695
           E AY AAKE+L SA RVHKL  LKYMP                CY+TLT S L ++P A 
Sbjct: 662 EKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEAN 721

Query: 696 TILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRKQHSEPQXX 755
           TIL +  IS +E I+ IQ AAITL+EA+PDELHLC+R+S +LM+LC EMK +  +     
Sbjct: 722 TILRLSAISVDETIQTIQTAAITLKEAAPDELHLCTRYSAILMYLCREMKLRDKTNNNNN 781

Query: 756 XXXXXXXXXXXXPTDAP---------ARMPTTPAENYA---------ATDFAIPAFLETP 797
                        ++             +P+T   +YA         + D A        
Sbjct: 782 TGENEEQKILIENSNPDGVEGVASNFGNVPSTLPPSYAQKSTTKEQLSDDGAHSMSFMDE 841

Query: 798 HPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINN-DKNMTFENLYNE 847
            PS L + + DWF    D+GLDFVEPW EM+EQ+++ + D N +FE LY +
Sbjct: 842 GPS-LSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDVNTSFEELYRQ 891

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
           similar to uniprot|Q04052 Saccharomyces cerevisiae
           YDR421W ARO80 Zinc finger transcriptional activator of
           the Zn2Cys6 family activates transcription of aromatic
           amino acid catabolic genes in the presence of aromatic
           amino acids
          Length = 945

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/781 (46%), Positives = 489/781 (62%), Gaps = 52/781 (6%)

Query: 4   LATGNDLEVSSQK--YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLE 61
           ++ GN+ + + +K  ++RGYKACLNC+ RK +CDLGP D+P  PPCVRCKRE +EC+F E
Sbjct: 2   VSNGNESQTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTE 61

Query: 62  NSKRGGRKRIEWTVDGNTDVNATARFEAEDKYIPVATLK----------DTTSIKEGSLT 111
             + G R   +  V    +    +  +     I   TLK           T +  + S+ 
Sbjct: 62  TKRGGFRVAKQSLVSLKEESAGKSMADVITSVIQGQTLKKELDTDLDRLQTHTKDDISIN 121

Query: 112 PELNSMHNALEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREES----PNQHASG 167
            +  ++ NA  FLAKAAGS AKED R ++ +  + D+        R+ S     N+ A+G
Sbjct: 122 TDPPTLQNAFYFLAKAAGSVAKEDLRDQVDAATKYDEIEPTDAVSRQPSVSSYGNKQATG 181

Query: 168 SKRASL------------------ATPGK--LIEKLSDWKPGSLYDLGDVEYIGGHKLLT 207
           S   S                     PG   LIEKLS  +P     LGD+EYIG ++LLT
Sbjct: 182 SMEPSSIPKMLTDSYVTSFVEPEGQKPGTIPLIEKLSSVRPKPSMKLGDIEYIGPYQLLT 241

Query: 208 EKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEG 267
           E EA + ID FFL MHPF PYIP QL+ + EL RYP+LLC ILTISARYH   +  ++E 
Sbjct: 242 EAEARKRIDAFFLTMHPFSPYIPLQLQDADELARYPLLLCTILTISARYHTLHDLGLNEI 301

Query: 268 ERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYAN 327
           + ++ ++E+H+RLWIYCQRL+SQ+VWAEASTRS+GTILAFL+FTEWNPRAIHW  +DYAN
Sbjct: 302 D-NTVHVELHERLWIYCQRLVSQTVWAEASTRSIGTILAFLIFTEWNPRAIHWKGSDYAN 360

Query: 328 DTSLSDISRRDYHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKI 387
              +SD+ +R     ++   + SLTG+ AMRRSDRM+W+LTG AVRLAQD+  +  S KI
Sbjct: 361 YPDISDLPKRPSSQTSQPQGSDSLTGLAAMRRSDRMSWLLTGNAVRLAQDLNVIEFSSKI 420

Query: 388 FTALHITETQTAMNMNQRSILSQSLAEVSLNG-HDGDSGLSSACIEEIFRNEDSKRRWKS 446
           F   HI ET TAMN+N+RS LS+SL+EV LNG  D D       +E I +N+ SK RW  
Sbjct: 421 FVMTHICETHTAMNLNKRSSLSESLSEVRLNGFEDNDLDNEQFFLERILQNDKSKERWAR 480

Query: 447 YTQQRDSVEGKSVGFCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLF 506
           +  +R     K     D E+EFL DEY  +H        +  N  T    +     +L F
Sbjct: 481 FL-ERVGERSKKGSLTDIEREFLNDEYLLYH-------YNTENPNTQSDPEF----RLKF 528

Query: 507 TPRQRAKVELLRIMSIGYEAIYYKDTKLTLIDHKHKLAVLGILAPMIKGWHNTYKHLLVP 566
           +  QR KVELL+I+S+GYE +Y  + KL+  D   +L++L +L+P+I+GW+N YK LLVP
Sbjct: 529 SKIQRGKVELLKIVSLGYENVY--NGKLSSHDRHQRLSMLSVLSPLIEGWYNIYKSLLVP 586

Query: 567 FAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNIN 626
             G  C   +  NK+  ++   K++ ESLISDY+YCQLYIYSLALQ +       K  +N
Sbjct: 587 CGGAACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQLYIYSLALQWDHQDTSTSKLRLN 646

Query: 627 ELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTLTGS 686
           E+TKSA+YVELAYNAAKE+L+SA RVHKL+ LKYMP                CY+TLTG+
Sbjct: 647 EITKSARYVELAYNAAKEILNSAQRVHKLKMLKYMPVRWVMRIVRSIVFMIKCYLTLTGN 706

Query: 687 GLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKR 746
           G+  +P A TIL + V+  +EII+ IQ+ AI LR A+PDELHLCSR+ST+LM+LCTEMK 
Sbjct: 707 GITQNPEANTILTMSVLPTDEIIQTIQRTAIILRAAAPDELHLCSRYSTILMYLCTEMKH 766

Query: 747 K 747
           +
Sbjct: 767 R 767

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 36/47 (76%)

Query: 801 HLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINNDKNMTFENLYNE 847
           +LP +L DWF  ++++GLDFV PW EM+E+QF+N   + ++EN +N+
Sbjct: 893 YLPPQLVDWFNDNNEIGLDFVGPWTEMVEKQFVNKVDDSSYENWFND 939

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/905 (42%), Positives = 531/905 (58%), Gaps = 93/905 (10%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRG---GRKRIE 72
           K++RGYKAC NC+ RK +CD+GP ++P DPPC RC+RE K CVFL    R    G  +I 
Sbjct: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78

Query: 73  WTV------DGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPE-----LNSMHNAL 121
            T        GN+   +  R ++    +    +K   +     ++P      L SM N+L
Sbjct: 79  STTPTLKPNSGNS--VSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIGLTSMQNSL 136

Query: 122 EFLAKAAGSAAKEDSRSRIPSYERQDKTIREK--TYHREESPNQHASG--SKRASLATPG 177
           EFLAKAAG+     + S   + E  +  +  K  +  +EES     S   S   +++  G
Sbjct: 137 EFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMNMTSSLHSDLLNISPIG 196

Query: 178 KL-------IEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIP 230
           KL       I+KL+  +P     L D++YIG ++LL+E +A  LIDLFFL M PFFP IP
Sbjct: 197 KLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFLTMFPFFPNIP 256

Query: 231 FQLRCSQELKRYPILLCAILTISARYHNFAEH--KVSEGERSSR-NIEVHDRLWIYCQRL 287
            QL+  +EL +YPILLCAILTIS+RYH+F      ++ G+ + R +I+VH++LWIYCQRL
Sbjct: 257 LQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVHEKLWIYCQRL 316

Query: 288 ISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRSD 347
           ISQ++WAEASTRS+GTILAF++FTEWNPRAIHW+W+DYA+D +L+DIS+R+   +  + +
Sbjct: 317 ISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDISKRNMEPQIIKRE 376

Query: 348 NTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSI 407
              LTG+ A+RRSDRMAWML+GTAVRLAQD G +  + K+  A HI++T TAMNMNQRS 
Sbjct: 377 EEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTHTAMNMNQRSA 436

Query: 408 LSQS--------LAEVSLNGHDGDSGLS-SACIEEIFRNEDSKRRWK--SYTQQRDSVEG 456
           LS S        L++    G D    ++ +  + +I +N++SK RWK  S T Q+D+ E 
Sbjct: 437 LSHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQNKESKERWKKISATFQKDNEE- 495

Query: 457 KSVG-FCDNEKEFLIDEYA-FFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFTPRQRAKV 514
            +VG   D E EFL DEYA +F  ED+D+          ++  L     L FT  QRAK+
Sbjct: 496 -TVGQLSDMEYEFLNDEYALYFSKEDNDS---------SQRPPLP----LKFTFVQRAKL 541

Query: 515 ELLRIMSIGYEAIYYKDTKLTLI--DHKHKLAVLGILAPMIKGWHNTYKHLLVPFAGGQC 572
           ELLRI+++GYE IYY++ +  L+  D +  LAVL IL+P+I  W++ Y  LL   A    
Sbjct: 542 ELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRPV 601

Query: 573 PPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINELTKSA 632
            P   + K   +     I  E++ISDY+YCQLYI+SLALQ++ G  K K   +NE+T+ A
Sbjct: 602 SPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLK---LNEITRCA 658

Query: 633 KYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTLTGSGLGSDP 692
            YVE AY AAKE+L SA RVHKL+ LKYMP                CY+TLT     S+P
Sbjct: 659 IYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNP 718

Query: 693 RATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRKQHSEP 752
            A TIL++  IS +E I+ IQ  AI L+EA+PDELHL +R+S +L++LC EMK K  S  
Sbjct: 719 EARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQ 778

Query: 753 QXXXXXXXXXXXXXXPTD---------------------APARMPTTPAENYAAT----- 786
           Q                D                       A+ P T  EN         
Sbjct: 779 QSKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNKPN 838

Query: 787 ---DFAIPAFLETPHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINN-DKNMTFE 842
               FA      T + + LP ++ +WF TS ++GL+FVEPW EM+EQ ++ + D N TF+
Sbjct: 839 LDGKFASDMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDANTTFD 898

Query: 843 NLYNE 847
           +LY E
Sbjct: 899 DLYKE 903

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
           Anc_5.525 YDR421W
          Length = 938

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/793 (45%), Positives = 475/793 (59%), Gaps = 82/793 (10%)

Query: 7   GNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRG 66
           G  L+  S K+RR YKACLNCR+RK +CDLGP D+P  PPCVRCKRE++EC+F       
Sbjct: 7   GKSLKTES-KWRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECLFTSR---- 61

Query: 67  GRKRIEWTVDGNTDV-NATARFEAEDKYIPVATLKDTTSIKEGSLTPE------------ 113
            RK+ +  + G   + N  +    ED    +     ++     S +P+            
Sbjct: 62  -RKKKDDVISGTVSLTNVPSAITQEDDNDRIQLNSGSSKGALFSNSPKNPNTQDQSKWKY 120

Query: 114 -LNSMHNALEFLAKAAGSAAKEDSRS------------------RI----PSYERQDKTI 150
            L SM N LEFLA AAGS +KE +R                   R+    PS ER+D  I
Sbjct: 121 GLGSMQNTLEFLATAAGSVSKESNRRLTTARHSHQYAKETSEDFRVDDSSPSSERKD--I 178

Query: 151 REKTYHREESPNQHASGSKRASLATPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKE 210
            + +     +P     G++RA+++    LIE+LS  +P     L D++YIG   LL+E+E
Sbjct: 179 TDTSEQSVIAPLLKECGTQRATVS----LIEELSRVRPKPNKKLADIDYIGPSNLLSEQE 234

Query: 211 ATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERS 270
           A  LID +FL MHPFFP IP QL+   EL  YPILLCAILT+S+RYH F+E     GE +
Sbjct: 235 ARELIDAYFLTMHPFFPNIPLQLQDPDELVNYPILLCAILTMSSRYHPFSEFGFYNGENN 294

Query: 271 SRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTS 330
            RNIEVH+ LW YCQRLISQ+VWAEASTRS+GT+LAF++FTEWNPR IHW  TDYAN   
Sbjct: 295 KRNIEVHETLWDYCQRLISQTVWAEASTRSIGTVLAFIIFTEWNPRQIHWRRTDYANS-- 352

Query: 331 LSDISRRDYHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTA 390
               + +D      + D+  LTG+GA+RRSDRM+WMLTG+AVRLAQDMGF+  S KIF A
Sbjct: 353 ----AEKDTDVPHSQKDDDGLTGIGAIRRSDRMSWMLTGSAVRLAQDMGFIETSTKIFVA 408

Query: 391 LHITETQTAMNMNQRSILSQSLAEVSLN-GHDGDSGLSSA------------CIEEIFRN 437
            HI++T  +MNMNQR  LS++ + V    G +  S + S              +E++ +N
Sbjct: 409 SHISDTFASMNMNQRCALSETFSVVGFGAGRERASAIDSEQTDVDEVGNEKFYLEQMLQN 468

Query: 438 EDSKRRWKSYTQQRDSVEGKSVG-FCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKS 496
           E+S+ RW    ++      K  G   D E+EFL DEY  ++     A R+   +  H   
Sbjct: 469 EESRERWTRVLERLQHNNDKKNGPLTDLEREFLNDEYVLYY-----ANRNDEMVQQH--- 520

Query: 497 KLSAADKLLFTPRQRAKVELLRIMSIGYEAIYYKDT--KLTLIDHKHKLAVLGILAPMIK 554
            L     L F+  QRAK+EL+RI+ I Y+ IYY     KLT  D  H LAVLGIL+P+I+
Sbjct: 521 -LQLPFPLKFSFHQRAKIELIRIILIAYDTIYYDKGKRKLTSNDQVHNLAVLGILSPLIE 579

Query: 555 GWHNTYKHLLVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIE 614
           GW+ TY++LL   +G        +NK A ++   +I+ ES++SDY+YCQLYIYSLALQ++
Sbjct: 580 GWYATYRNLLKISSGQPYSIEIRKNKRAVHELGEEINRESILSDYYYCQLYIYSLALQVD 639

Query: 615 AGTEKDKKPNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXX 674
               K  K  INE TKSAKYVELAY AAKE+L S+ RVH+L+ LKYMP            
Sbjct: 640 V---KGPKLRINEATKSAKYVELAYVAAKEILISSTRVHRLKMLKYMPVRWVMRIVRAVS 696

Query: 675 XXXXCYMTLTGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFS 734
               CY+TLTG G   +  A TIL +C IS +E I  I+ AA+ L+EASPDELHLC R+S
Sbjct: 697 FLVKCYLTLTGGGGVPNSEAQTILKLCCISLDETIHTIRLAALILKEASPDELHLCVRYS 756

Query: 735 TVLMFLCTEMKRK 747
            +L++LC EM  K
Sbjct: 757 AILLYLCKEMNLK 769

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (68%), Gaps = 2/54 (3%)

Query: 796 TPHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFI-NNDKNMTFENLYNEA 848
           T  PS LP E  DWF  S D+GLDFVEPW E+LEQ+F+ + D N  FE LYN+ 
Sbjct: 874 TNFPS-LPDEAIDWFSGSADIGLDFVEPWTELLEQRFLQSGDGNNIFEELYNQV 926

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/785 (43%), Positives = 478/785 (60%), Gaps = 63/785 (8%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRG---GRKRIE 72
           K RR Y+AC+NCRSRK +CDLGP D+P  PPC RCKRE K+C F  +S RG   G     
Sbjct: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF--SSTRGETNGTSPNM 74

Query: 73  WTVDGNTDVNATARFEAEDKYIPVA---TLKDTTSIKEGSLTPE-------LNSMHNALE 122
            T    T ++ + +        P+    TL    +  E S   E       L+SM NALE
Sbjct: 75  ITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELSSMQNALE 134

Query: 123 FLAKAAGSAAKEDSRSRI--------PSYERQDKTIREKT------YHREES-------P 161
           FLA+AAG+ AKE ++  I        P  +  D + +  T        R +S       P
Sbjct: 135 FLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASATCTP 194

Query: 162 NQHASGSKRASLA---TPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLF 218
           +++ +    ASL    T  +LI ++S  +P     + D +YIG   LLT++EA  LI+ F
Sbjct: 195 HENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELIEAF 254

Query: 219 FLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHD 278
           FL MHPFFP IP QL   +EL  YPIL CAILT+SARYH F    +  GE   R+IEVHD
Sbjct: 255 FLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGLRHIEVHD 314

Query: 279 RLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRD 338
           +LW+YCQ+LISQ++WAEASTRS+GT+LAF++FTEWNPR+IH+ W+DYAND  L++++ R 
Sbjct: 315 KLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVNVRG 374

Query: 339 YHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQT 398
             +   R D   LTG+GA+RRSDRM+WMLTG+AVRLAQDMGF+ NS KIF   HI+ET +
Sbjct: 375 SKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHISETTS 434

Query: 399 AMNMNQRSILSQSLAEVSLNGHDGDS----------GLSSACIEEIFRNEDSKRRWKS-Y 447
           AMNMNQRS+L++S + ++LN    DS          G     ++EI  N++ K+RWK  +
Sbjct: 435 AMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPNDEIKKRWKGVF 494

Query: 448 TQQRDSVEGKSVGFCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFT 507
               D+ + +     D E+EFL DEY  +++  +D     +NL  +          L F+
Sbjct: 495 EDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDD----TNLAQNHTPPF----PLRFS 546

Query: 508 PRQRAKVELLRIMSIGYEAIYYKDT--KLTLIDHKHKLAVLGILAPMIKGWHNTYKHLLV 565
             QRAK+E++RI+SI YE IY +    KL   D +H L+VL I +P+++GW + Y+ +LV
Sbjct: 547 FAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLV 606

Query: 566 PFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNI 625
           P +         +NK   +D   +I+ ES+I+D+ YCQLYI+SLALQ++    K  + N+
Sbjct: 607 PLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDG---KISRLNM 663

Query: 626 NELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTLTG 685
           NE+  SA+YVELAY +AKE+L SA RV +   LK+MP                CY+TLTG
Sbjct: 664 NEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTG 723

Query: 686 SGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMK 745
           S L ++P A  IL +  IS +E  ++++  A+TL+EA+PDELHLC R++ +LM+LCTEMK
Sbjct: 724 SELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMK 783

Query: 746 RKQHS 750
            ++ S
Sbjct: 784 LRKSS 788

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 2/47 (4%)

Query: 802 LPSELEDWFCTSDDVGLDFVEPWAEMLEQQFI--NNDKNMTFENLYN 846
           L  E+ DWF  S+D+GL+FVEPW E++EQ+++   +  N  FENLYN
Sbjct: 887 LSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYN 933

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/787 (42%), Positives = 476/787 (60%), Gaps = 71/787 (9%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75
           K RR Y+AC++CRSRK +CDLGP D+P DPPC RCKRE K+C+F  +S +G    +    
Sbjct: 17  KRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIF--SSNKGTSNDLPPNS 74

Query: 76  DGNTDVNATARFEAE---DKYIPVATLKDTTSIKEGSLTP------------ELNSMHNA 120
                + +  + + E   D   P+  L D    ++G  +             EL+SM NA
Sbjct: 75  INAISLPSLGKSKQEIQNDSTSPI--LSDVPLSRKGISSEKSFKSEGMKWKLELSSMQNA 132

Query: 121 LEFLAKAAGSAAKEDSRSRIPSYERQDKTIRE--------------KTYHREESPN---- 162
           LEFLA+AAG+ AKE ++  I       K ++               K   + +S N    
Sbjct: 133 LEFLAQAAGTVAKEGAKEIIKEKSTTPKPLKSSLDATNKSATDEGLKRLSKSDSTNTLYE 192

Query: 163 ------QHASGSKRASLATPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLID 216
                  H   + R +     +L+E++   +P     + D +YIG   LLT++EA  LI+
Sbjct: 193 NTADMLNHTLNTNRKT----SQLMEEIGKVRPPPTRKIDDFDYIGPDSLLTKEEAIELIE 248

Query: 217 LFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEV 276
            FFL MHPFFP IP QL   +EL  YPIL CAILT+SARYH F    +  GE   R+IEV
Sbjct: 249 AFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHPFDTLGLDNGEDGMRHIEV 308

Query: 277 HDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISR 336
           HD+LW+YCQ+LISQ++WAEASTRS+GT+LAF++FTEWNPR+IH+ W+DYAND  L++++ 
Sbjct: 309 HDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVNA 368

Query: 337 RDYHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITET 396
           R   + + R D   LTG+GA+RRSDRM+WMLTG+AVRLAQDMGF+ NS K+F   HI+ET
Sbjct: 369 RGSKNISTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKVFIVTHISET 428

Query: 397 QTAMNMNQRSILSQSLAEVSLN----GHDGDS------GLSSACIEEIFRNEDSKRRWKS 446
            +AMNMNQRS+L++S + ++LN     +DG+       G     + EI  +E+SK RWK 
Sbjct: 429 TSAMNMNQRSLLAESFSVLNLNLGKIENDGNESNEDYLGNEKFYLNEILPDEESKLRWKR 488

Query: 447 YTQQRDSVEGKSVGF-CDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLL 505
             +  ++       F  D E+EFL DEY  +++      +D +NL  +          L 
Sbjct: 489 VFENSENDHDNEKNFLTDWEREFLNDEYVLYYSNK----KDDTNLAQNHIPPFP----LR 540

Query: 506 FTPRQRAKVELLRIMSIGYEAIYYKDT--KLTLIDHKHKLAVLGILAPMIKGWHNTYKHL 563
           F+  QRAK+E++RI+SI YE IY +    KL   D +H L+VL + +P+I+GW + Y+ L
Sbjct: 541 FSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYREL 600

Query: 564 LVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKP 623
           LVP +         +NK   +D   +I+ ES+I+D+ YCQLYI+SLALQ++  T    + 
Sbjct: 601 LVPLSDVPFSLADRKNKKQIFDNIDRINGESIITDFNYCQLYIFSLALQVDGKT---SRL 657

Query: 624 NINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTL 683
           N+NE+  SA+YVELAY +AKE+L SA RV +   LKYMP                CY+TL
Sbjct: 658 NMNEIVTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWVIRIIRSIAFIVKCYLTL 717

Query: 684 TGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTE 743
           TGS L ++P A  IL +  IS +E  ++I+  A+TL+EA+PDELHLC R++ +LM+LCTE
Sbjct: 718 TGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTE 777

Query: 744 MKRKQHS 750
           MK ++ S
Sbjct: 778 MKLRKKS 784

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 2/47 (4%)

Query: 802 LPSELEDWFCTSDDVGLDFVEPWAEMLEQQFIN--NDKNMTFENLYN 846
           L  E+ DWF  S+D+GL+FVEPW E++EQ+++   +  N  FENLYN
Sbjct: 883 LSDEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYN 929

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/779 (43%), Positives = 479/779 (61%), Gaps = 56/779 (7%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF-----LENSKRGGRKR 70
           K RR Y+AC+NCRSRK +CDLGP D+P +PPC RCKRE +EC+F     ++NS       
Sbjct: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECLFSSQKVVKNSTSPHMVN 76

Query: 71  IEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLT--PELNSMHNALEFLAKAA 128
                 G    N + R  + +  +      D T  K   +    EL+SM NALEFLA+AA
Sbjct: 77  TICQSKGEIP-NHSRRLISSEMALSEKGTNDETLFKSDGVKWKLELSSMQNALEFLAQAA 135

Query: 129 GSAAKEDSRSRI--------PSYERQDK-------------TIREKTYHREESPNQHASG 167
           G+ AKE ++  I        PS    D              +I E       +P+++ + 
Sbjct: 136 GTVAKEGAKETIKDRSATPRPSESSLDTPHQSAANKELKTLSISECDASATNTPHENITD 195

Query: 168 SKRASLATPGK---LIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHP 224
           +  A+L +  K   LI+++S  +P     + D EYIG   LLT++EA  LI+ FFL MHP
Sbjct: 196 TLAAALNSNQKMSQLIKEISRARPMPTRRIDDFEYIGPDNLLTKEEAIELIEAFFLTMHP 255

Query: 225 FFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYC 284
           FFP IP QL   +EL  YPIL C+ILT+SARYH F    +  GE   R+IEVHD+LWIYC
Sbjct: 256 FFPNIPLQLHDPKELAEYPILFCSILTVSARYHPFDTLGLDNGENGIRHIEVHDKLWIYC 315

Query: 285 QRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAK 344
           Q+LISQ++WAEASTRS+GT+LAF++FTEWNPR+IH+ W+DYAND  L+++  R+  + + 
Sbjct: 316 QKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVGVRESKNIST 375

Query: 345 RSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQ 404
           + D   LTG+GA+RRSDRM+WMLTG+AVRLAQDMGF+ NS KIF   HI+ET +AMNMNQ
Sbjct: 376 KKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHISETTSAMNMNQ 435

Query: 405 RSILSQSLAEVSLN-------GHDGDS---GLSSACIEEIFRNEDSKRRWKS-YTQQRDS 453
           R +L++S + ++LN       G+ G+    G     + EI  +++SK+RWK  +    D 
Sbjct: 436 RPLLAESFSVLNLNVRKFDDDGNKGNENYLGNEKFYLNEILPDDESKKRWKKVFKDSEDD 495

Query: 454 VEGKSVGFCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFTPRQRAK 513
            + +     D E+EFL DEY  +++      +D +NL  +          L F+  QRAK
Sbjct: 496 DDSEKNILTDWEREFLNDEYVLYYSNK----KDDTNLAQNPM----PPSPLRFSFAQRAK 547

Query: 514 VELLRIMSIGYEAIYYKDT--KLTLIDHKHKLAVLGILAPMIKGWHNTYKHLLVPFAGGQ 571
           +E++RI+SI YE IY +    KL   D +H L+VL + +P+I+GW + Y+ +LVP +   
Sbjct: 548 IEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYREVLVPISDVS 607

Query: 572 CPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINELTKS 631
                 +NK   +D  ++++ E++I+D+ YCQLYI+SLALQ++  T    + N+NE+  S
Sbjct: 608 FLLADRKNKKQVFDNINRLNGETIITDFNYCQLYIFSLALQVDGKT---SRLNMNEIMTS 664

Query: 632 AKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTLTGSGLGSD 691
           A+YVELAY +AKE+L SA RV +   LKYMP                CY+TLTGS L ++
Sbjct: 665 ARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWAIRIIRSIAFIVKCYLTLTGSELATN 724

Query: 692 PRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRKQHS 750
           P A  IL +  IS +E  ++I+  A+TL+EA+PDELHLC R++ +LM+LCTEMK ++ S
Sbjct: 725 PDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKS 783

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (70%), Gaps = 4/48 (8%)

Query: 802 LPSELEDWFCTSDDVGLDFVEPWAEMLEQQFI---NNDKNMTFENLYN 846
           L  E+ DWF  S+D+GL FVEPW E++EQ+++   + D N  FENLYN
Sbjct: 882 LSEEVTDWFGASEDIGLGFVEPWTELIEQRYMQCGDGDIN-NFENLYN 928

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/786 (43%), Positives = 481/786 (61%), Gaps = 65/786 (8%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75
           K RR Y+AC+NCRSRK +CDLGP D+P  PPC RCKRE K C+F  +S R     +  ++
Sbjct: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF--SSNREAMHTLSPSM 85

Query: 76  DGNTDVNATARFE---------AEDKYIPVA---TLKDTTSIKEG-SLTPELNSMHNALE 122
              T  +A+++ E         +    +P++   T  +T    EG     EL+SM N LE
Sbjct: 86  INITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLELSSMQNTLE 145

Query: 123 FLAKAAGSAAKEDSRSRI-------------------PSYERQDKTIREKTYHREES--P 161
           FLA+AAG+ AKE ++  I                   PS +   K +        ++  P
Sbjct: 146 FLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRSLSAASDTNTP 205

Query: 162 NQHASGSKRASLA---TPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLF 218
            ++ + +   +L    T  +LIE++   +P     + D EYIG   LLT++EA  LI+ F
Sbjct: 206 IENLTVALATTLNANRTTSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKEEAIELIEAF 265

Query: 219 FLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHD 278
           FL MHPFFP IPFQL   +EL +YPIL CAILT+SARYH F    +  GE  +R++EVHD
Sbjct: 266 FLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGENGTRHVEVHD 325

Query: 279 RLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRD 338
           +LW+YCQ+LISQ++WAEASTRS+GT+LAF++FTEWNPR+IH  W+DYAND  L++++ R 
Sbjct: 326 KLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYANDPELNNVNVRG 385

Query: 339 YHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQT 398
                 R D   LTG+GA+RRSDRM+WMLTG+AVRLAQDMGF+ NS +IF   HI+ET +
Sbjct: 386 GKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIFIVTHISETTS 445

Query: 399 AMNMNQRSILSQSLAEVSLN----------GHDGDSGLSSACIEEIFRNEDSKRRWKSYT 448
           AMNMNQRS+L++S + ++LN           ++   G     ++EI  N++SK RWK   
Sbjct: 446 AMNMNQRSVLAESFSVLNLNLGRFDNDGNENNENYLGNERFYLDEILPNDESKERWKKVL 505

Query: 449 Q--QRDSVEGKSVGFCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLF 506
           +  + DS   K V   D E+EFL DEY  +++      +D +NL  +          L F
Sbjct: 506 ENLEADSDNEKCV-LTDWEREFLNDEYVLYYSNK----KDDTNLAQNHMPPF----PLRF 556

Query: 507 TPRQRAKVELLRIMSIGYEAIYYKDT--KLTLIDHKHKLAVLGILAPMIKGWHNTYKHLL 564
           +  QRAK+E++RI+SI YE IY +    KL   D +H L+VL + +P+++GW + Y+ +L
Sbjct: 557 SFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYREVL 616

Query: 565 VPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPN 624
           VP +         +NK    +   +I+ ES+I+D+ YCQLYI+SLALQ++    K  + N
Sbjct: 617 VPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDG---KISRLN 673

Query: 625 INELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTLT 684
           ++E+ KSAKYVELAY +AKE+L SA RV +   LKYMP                CY+TLT
Sbjct: 674 MSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLT 733

Query: 685 GSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEM 744
           GS + ++P A  IL +  IS +E  ++I+  A+TL+EA+PDELHLC R++ +LM+LCTEM
Sbjct: 734 GSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTEM 793

Query: 745 KRKQHS 750
           K ++ S
Sbjct: 794 KLRKKS 799

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 2/47 (4%)

Query: 802 LPSELEDWFCTSDDVGLDFVEPWAEMLEQQFI--NNDKNMTFENLYN 846
           L  E+ DWF  S+D+GL+FVEPW E++EQ+++   +  N  FENLYN
Sbjct: 898 LSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYN 944

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/935 (40%), Positives = 509/935 (54%), Gaps = 113/935 (12%)

Query: 13  SSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLE----------- 61
           S +K+RR YKACLNCR+RK RCDLGP D PR+PPCVRC RERKEC+F E           
Sbjct: 21  SGRKWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIFTELRRGRNRRIRV 80

Query: 62  -NSKRGGRKRIEWTV---DGNTD-VNATARFEAEDKYIPVAT--LKDTTSIK-------- 106
             + R G    +  +   + + D  +AT RF  E   +   +    D+ S +        
Sbjct: 81  AKNDRAGHAEPDGGICVANAHGDPSSATGRFSGEPTALSAGSDPSPDSASNRGRDDQSSN 140

Query: 107 ----------EGSLTPELNSMHNALEFLAKAAGSAAKEDSR--SRIPSYERQDKTIREKT 154
                     E SL+ E  ++HN LEFL KAAGS AK++ R  S   +  +    I E  
Sbjct: 141 SDEPEFSERPELSLSSEFTTLHNTLEFLTKAAGSVAKDNGRLLSSSTAVGKHSAAICESI 200

Query: 155 YHREESP---NQHA---SGSKRASLATPGKLIEKLSDWKPGSL-YD-LGDVEYIGGHKLL 206
             +  +P    Q+A   SG +     T      +    +P S  Y  L ++EY+G +  L
Sbjct: 201 TLQLYNPLHNGQYASVVSGPRNPEAITDQAAASRTPQEEPESTKYPLLRNIEYVGPNNTL 260

Query: 207 TEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSE 266
           T +E  RL +LFF+  +PFFP+IP  ++  +EL RYPILLC +L+ISARYH F +  +S 
Sbjct: 261 TVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELARYPILLCGVLSISARYHKFEDIGLSN 320

Query: 267 GERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYA 326
               +RNI+VH+ LW YCQ++ISQ+VW EASTRS+GT+L FL+FTEWNPRAIH    DYA
Sbjct: 321 RGSPTRNIDVHEYLWRYCQQMISQTVWTEASTRSIGTVLVFLIFTEWNPRAIHRKCNDYA 380

Query: 327 NDTSLSDISRRDYHSEAKRS--------------------DNTSLTGMGAMRRSDRMAWM 366
           N T   D      HSE   +                     +   +G+ AMRRS RMAWM
Sbjct: 381 NAT---DRQNEQSHSEKANTAHCGSGIPATERNGPRRFVLADQGSSGLSAMRRSKRMAWM 437

Query: 367 LTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSILSQSLAEVSLNGHDGDSGL 426
           L G AVRLAQDM F+N S KIF A H +ET  AMNM Q S LS SL   ++ G +  + +
Sbjct: 438 LVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMGQNSTLSHSLMNANIIGSESSTAI 497

Query: 427 SSACIEEIFRNEDSKRRWKSYTQQRDSVEGKSVGFCDNEKEFLIDEYAFF----HNEDSD 482
           S+  +       +++ R+KS  Q+      +  G      EFL DE   +     +E  +
Sbjct: 498 SNPPMP-----SETEERYKSVLQRLGKHVPRGRGLSQLYNEFLEDERILYGLGGGSEYVE 552

Query: 483 AYRD--------LSNLGTHEKSKLSAADKLLFTP-RQRAKVELLRIMSIGYEAIYYKDTK 533
           AY D        +S    +E S L    + +F    QRAK+ELLRIMS+GYE IY    K
Sbjct: 553 AYCDSLDQTKNNVSIETAYESSLLERGGQQVFLSFAQRAKIELLRIMSVGYETIYSNHAK 612

Query: 534 LTLIDHKHKLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTRDENKNATYDTPSKIDSE 593
           L L +  H L+VLG+L+P I+ W+  Y  LLVP  G    PT D ++    D   +ID+E
Sbjct: 613 LVLREKHHILSVLGLLSPQIENWYTQYNSLLVPAGGAPFNPTADFSRINPLDLVRRIDAE 672

Query: 594 SLISDYFYCQLYIYSLALQIEAGTEKDKKPN---INELTKSAKYVELAYNAAKEVLHSAI 650
           S+I DY+YCQLYIYSLAL ++    K + PN   ++ L KSA+YVELAYNAA+EVL SAI
Sbjct: 673 SIICDYYYCQLYIYSLALTVD--FRKPRHPNASWLDRLMKSARYVELAYNAAREVLRSAI 730

Query: 651 RVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTLTGSGLGSDPRATTILAVCVISAEEIIE 710
           RVH++R LKYMP                CY+T+  + L +   A+ IL +  I  +E++ 
Sbjct: 731 RVHRIRMLKYMPTRWVERIVGAVAFIVKCYLTM-AAHLTASHEASAILTLSAIPPDEVVN 789

Query: 711 MIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRKQHSEPQXXXXXXXXXXXXXXPT- 769
            IQ+AAITLREASPD++HLC+++ST+LM+LC+EMK +    P               P  
Sbjct: 790 TIQRAAITLREASPDDVHLCNKYSTILMYLCSEMKLRNWPTPTPPLPRSVSGEPIRVPVF 849

Query: 770 ----DAPARM---PTTPAENYAA--------TDFAIPAFLETPHP----SHLPSELEDWF 810
                  AR+   P  PAE+            D  + A    P P    SHLP EL DW 
Sbjct: 850 ECSATPAARIFSPPHHPAESQTTGGTDPPPLPDHTLAAPSSDPAPFDTTSHLPWELIDWL 909

Query: 811 CTSDDVGLDFVEPWAEMLEQQFINNDKNMTFENLY 845
            TSD++GLDFVEPW +++E+   +   N+   +LY
Sbjct: 910 HTSDEIGLDFVEPWTDVIERLMESGPDNIDTNSLY 944

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/927 (37%), Positives = 511/927 (55%), Gaps = 122/927 (13%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75
           K+RR Y+AC+NCRSRK +CDLGP D+P  PPCVRCKRE++EC+F    +R          
Sbjct: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR---------- 67

Query: 76  DGNTDVNATARFEAEDKYIPVATLKDT------------TSIKEGSL---------TPEL 114
           D    +N     E E + I  + L D             + +K+ ++           ++
Sbjct: 68  DVTAKINNMKGSELE-RSIISSILPDVDKKSLNGGGSAGSDLKQNNIRKKPTDSNWQSDI 126

Query: 115 NSMHNALEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLA 174
           ++M  ALEFLA A G  +K D+RS + +  + +  I  +        N ++    R+   
Sbjct: 127 STMQTALEFLANAVGVISKSDTRSLL-NLNQNNTLIENEDADDSNPNNDNSEDVSRSDSN 185

Query: 175 TP-------------------GKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLI 215
           TP                     L+  +   +P    +L D+EYIG +KLLTE EA  LI
Sbjct: 186 TPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLI 245

Query: 216 DLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIE 275
           ++FFL MHP+FPYIP QL    EL RYPILLCAILT+S+RY++F E  ++      RNI 
Sbjct: 246 NVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEKDRNIV 305

Query: 276 VHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDIS 335
           VH++LW YCQRLIS ++WAEASTRS+GTILAFLLFTEWNPRAIHW W+DY N+  L+  +
Sbjct: 306 VHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFT 365

Query: 336 RRDYHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITE 395
           + + ++ ++     + TG  AMR SDRMAWM TG+AVRLAQDM F++N+ KIF A HI+E
Sbjct: 366 KNNENNMSEFKGEKT-TGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISE 424

Query: 396 TQTAMNMNQRSILSQSLAEVSLN-----GHDGDS----------GLSSACIEEIFRNEDS 440
           T  AMN+NQRS LS SL+ ++L+     G + D           G     +E+I +++ S
Sbjct: 425 TFNAMNVNQRSTLSDSLSNINLSITRSHGKNNDDEEGHIFAENFGNEQYYLEQILKHDKS 484

Query: 441 KRRWKSYTQQRDSVEG--KSVGFCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKL 498
           K +W  + ++ +S +    S    D E+E+L DEY  ++  ++   +     G H  +  
Sbjct: 485 KEKWIKFLKEINSNKSSENSTVITDAEREYLNDEYILYYQNNNPETQ--PTWGNHSVTST 542

Query: 499 SAADKLLFTPRQRAKVELLRIMSIGYEAIYYKDTK--LTLIDHKHKLAVLGILAPMIKGW 556
           S    L F    +AK+E+LRIMSI YE IY    K  L   + +  LAVL I +P+I+ W
Sbjct: 543 SLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESW 602

Query: 557 HNTYKHLLVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAG 616
           ++ +  LL  F    C  ++ ++KN        I+ ESLI DY+YCQLYIYSLAL+++  
Sbjct: 603 YSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDI- 661

Query: 617 TEKDKKPNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXX 676
             KD   N++E+TKSAKYV +AYNAAKE+L SA+RV+KL+ L+Y+P              
Sbjct: 662 --KDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFI 719

Query: 677 XXCYMTLTGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTV 736
             C++ LT S    +     I+ +  I  +E +E+I+  ++TL +ASPDELHLC R+S++
Sbjct: 720 VKCFLLLTESETSENSEINAIIRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSI 779

Query: 737 LMFLCTEMKRKQHSEPQXXXXXXXXXXXXXXPTDAPARMPTTPAENYAATDFA---IPAF 793
           L+++C E++ K  +                   +A  ++     EN ++ + +   I  F
Sbjct: 780 LLYMCKELRNKTQN-------LYMNEGVAAKQENADVKVGNKSLENLSSIENSQEPIEPF 832

Query: 794 LETPHP-SHLP-------------------------------SELEDWFCTSDDVGLDFV 821
           +   HP + LP                                E+ DWF +S D+GL+FV
Sbjct: 833 IMNEHPQTELPINTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFV 892

Query: 822 EPWAEMLEQQFI---NNDKNMTFENLY 845
           E W EM+EQ ++   + D+N+   +L+
Sbjct: 893 ESWTEMIEQMYLRSSDGDQNIHVNSLF 919

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/878 (39%), Positives = 508/878 (57%), Gaps = 79/878 (8%)

Query: 13  SSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRG---GRK 69
           SS+K++R ++AC  CR RK +C+LGP D+P  PPC RCKRE++EC+F+E S++      K
Sbjct: 9   SSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPK 68

Query: 70  RIEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNALEFLAKAAG 129
            I +  DG+ +      ++  D            ++++ +   +++SM NALE+LA AA 
Sbjct: 69  DINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNALEYLASAAK 128

Query: 130 SAAKEDSR-------SRIPSYERQDKT---IREKTYHREESPNQHASGSKRASLATPGKL 179
           S ++ ++          + SY + D T   I ++ + + E  N  +S            L
Sbjct: 129 SVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNPASS------------L 176

Query: 180 IEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQEL 239
           I +LS  +      L D+ YIG  KLLTE+EA RLI++FF  +HPFFPYIP QL   ++L
Sbjct: 177 IAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQL 236

Query: 240 KRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTR 299
            RYPILLCA++TISARY+NF +  +   E    NI +H++LW+YCQRLIS+++WAEASTR
Sbjct: 237 VRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIWAEASTR 296

Query: 300 SVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRSDNTSLTGMGAMRR 359
           S+GTILAFLLFTEWNPRAIHW+W+DYAND+   + +  +           S+TG  AMR 
Sbjct: 297 SIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPINSYKGESITGFEAMRH 356

Query: 360 SDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSILSQSLAEVSLNG 419
           SDRMAWMLTG+AVRLAQDM F++ S KIF A HI ET  AMN+N RS LS+SL+ V+++ 
Sbjct: 357 SDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMNVNLRSSLSESLSNVNIHS 416

Query: 420 HDGDS-------------GLSSACIEEIFRNEDSKRRWKSYTQQRDSVEGK--SVGFCDN 464
              D              G     +E+IF+N  +K R  SY    + +  +  +  F DN
Sbjct: 417 KKIDPVKIIDGKKSERYFGNEKYYLEQIFKN--AKDRESSYDLLENILRERRNAKAFPDN 474

Query: 465 EKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFTPRQRAKVELLRIMSIGY 524
           E++FL DEY  F++   DA ++   L T           L FT  QRAK+ELL+IMSIGY
Sbjct: 475 ERDFLNDEYILFYSNPDDATQN-DELDT----------PLDFTVIQRAKIELLKIMSIGY 523

Query: 525 EAIYYKDTK--LTLIDHKHKLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTRDENKNA 582
           E IY +  +   T  + K  LA+L I + +I  W+  Y  LL P       P  + +K  
Sbjct: 524 ETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSP--EETLDPVLNASKMG 581

Query: 583 TYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYVELAYNAA 642
                  I++ESLI DY+YCQLYIYSL+LQ+E   +++ K  + EL++SAKYV +AY++A
Sbjct: 582 LQSMTQIIENESLICDYYYCQLYIYSLSLQVE---DEESKLKLKELSQSAKYVSIAYSSA 638

Query: 643 KEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTLTGSGLGSDPRATTILAVCV 702
           KE+L+SA R+ ++R LK++P                CY+T T     +     ++L++  
Sbjct: 639 KEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMNYKELNSLLSLSG 698

Query: 703 ISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRKQHSEPQXXXXXXXXX 762
           I  +E +E+I  AA+ L+E++PDELHLC+R+S +L+ L  E+K    S  Q         
Sbjct: 699 IPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQQAHGNDSMPE 758

Query: 763 XXXXXPT-------------DAPARMPTTPAENYAATDFAIPAFLETPHP-SHLPSELED 808
                 T             ++ +++  TP  N  AT   +P    T  P +  P+E+ D
Sbjct: 759 RLTADTTLENAIRTEFTTTSNSGSQVELTPLSNKLAT---LPIDRNTTPPYASFPTEVVD 815

Query: 809 WFCTSDDVGLDFVEPWAEMLEQQFI--NNDKNMTFENL 844
           WF TS D+GL+FVEPW EM+EQ++I   N +N  F++L
Sbjct: 816 WFSTSADIGLEFVEPWTEMIEQRYIKSGNTQNKDFDDL 853

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  539 bits (1389), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 318/787 (40%), Positives = 440/787 (55%), Gaps = 79/787 (10%)

Query: 19  RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDGN 78
           RG+KAC NCR +K RCD GP D+P  PPC RCKRE K C F   + + G+++   T +  
Sbjct: 21  RGFKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTF---TAKTGKEQDMVTGEAT 77

Query: 79  TDVNATARFEAEDKYIPVATLKDTTS---IKEGS-----LTP------ELNSMHNALEFL 124
             +        +   + +  L  T S   I+  S       P      EL SMHN L FL
Sbjct: 78  NGIPTVDTVPVKKNELALPALAVTVSPGLIQNRSEMGNEANPNTGWKLELTSMHNTLAFL 137

Query: 125 AKAAGSAAKEDSRSRIPSYERQDKTIREKTYHR--EESPNQHASGSKRASLATPGK---- 178
           A+AAG+ +   ++  +      D++       R   ++P   AS       + P K    
Sbjct: 138 AQAAGTVSNTLNKGLMKKTLPSDRSTPSLEISRLGSKTPTGFASSLGLGMPSNPTKTLLQ 197

Query: 179 ---------LIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYI 229
                    LIEK  + K      L D++ IG + LL+E+EAT  ID FF  MHPFFPYI
Sbjct: 198 EIETQNKVQLIEKSKNTKSKVPKTLKDIKCIGENGLLSEQEATAFIDAFFCTMHPFFPYI 257

Query: 230 PFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLIS 289
           P QL+   EL  YPILLCAILTIS RYH+F+E     G+ + RN EVH++LW  CQ ++S
Sbjct: 258 PLQLQDPLELLEYPILLCAILTISTRYHSFSEFGFDNGDYNKRNFEVHEKLWDNCQVMLS 317

Query: 290 QSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRSDNT 349
           +++W EASTRS+GT+LAF+LFTEWNPR IHW  +DYAND         +  SE    +  
Sbjct: 318 KTIWGEASTRSIGTVLAFILFTEWNPRQIHWKKSDYANDDD-------EAVSELSNDEAE 370

Query: 350 SLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSILS 409
            LTG  A+RRSDRMAWMLTG+AVRLAQDMGFM  + K+  A HI++   +MNMNQ+ +LS
Sbjct: 371 ELTGTKAIRRSDRMAWMLTGSAVRLAQDMGFMETNAKVCVATHISDAFASMNMNQKPVLS 430

Query: 410 Q--SLAEVSLNGHDGD----SGLS--SACIEEIF-----RNEDSKRRWK---SYTQQRDS 453
              ++ +   N +  D    SG S  S C E+ F      N +S  RW+   S  Q  D 
Sbjct: 431 GNFNVLQGGTNNYTSDPLNSSGSSHESTCSEQAFMKQMLENTNSHTRWRHILSSLQMEDL 490

Query: 454 VEGK----SVGFCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFTPR 509
            + +    S    D E+EFL DE+  ++           +L     ++ +    L F+  
Sbjct: 491 FQRQRNEYSNDLSDLEREFLNDEFILYY-----------SLERRSDNQETPPFPLQFSYA 539

Query: 510 QRAKVELLRIMSIGYEAIYYK--DTKLTLIDHKHKLAVLGILAPMIKGWHNTYKHLLVPF 567
           Q+AK+EL  IM +GY+ IYY     KL   +  H L+VL IL+P+++GWHN YK+LL+  
Sbjct: 540 QKAKIELTNIMLLGYDTIYYDRGRKKLASNNQLHNLSVLSILSPLMEGWHNVYKNLLIAP 599

Query: 568 AGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINE 627
           +      T   +K A Y+    IDSES+I DY Y QLYIYSLALQ +    K  +  ++E
Sbjct: 600 SANPYTTTTRGDKRAMYELSKNIDSESIICDYRYSQLYIYSLALQADF---KRAELTVSE 656

Query: 628 LTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXXXXXXXXXXXXXXCYMTLTGSG 687
           +T++AKYVE+A+NAAKE++ SA RVHKL  LKYMP                C + L  + 
Sbjct: 657 ITQNAKYVEIAFNAAKEIIFSAFRVHKLNLLKYMPVRWVMRLVRAVSFLVKCCLILNATS 716

Query: 688 LG----SDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTE 743
           +G    S+    TIL +C IS ++    I+ AA+TL+EA+PDELHL  R+S +L++LC E
Sbjct: 717 IGGGGSSEAEVRTILKLCSISVKDTANTIKMAAMTLKEATPDELHLSMRYSAILLYLCRE 776

Query: 744 MKRKQHS 750
           ++ ++ S
Sbjct: 777 LESEKDS 783

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 32/45 (71%), Gaps = 1/45 (2%)

Query: 802 LPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINNDK-NMTFENLY 845
           LP E+ +WF  + ++GL+FVEPW +M+EQ+F+ +   N  FE LY
Sbjct: 886 LPDEVTNWFSGNAEIGLEFVEPWTDMIEQRFLQSGTGNDVFEELY 930

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score =  530 bits (1365), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 324/811 (39%), Positives = 441/811 (54%), Gaps = 91/811 (11%)

Query: 14  SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGG------ 67
           S ++RR YKAC+NCR +K +CDLGP ++P  PPCVRCKRE ++C+F E  K+ G      
Sbjct: 21  SVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENEN 80

Query: 68  -----RKRI----EWTVDGNTDV----------NATARFEAEDKYIPVATLKDTTSIKEG 108
                 +R+    E  +  NTD+             +RF  +         KD  S ++ 
Sbjct: 81  DSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKDKPSERKS 140

Query: 109 SLTPELNSMHNALEFLAKAAGSAAK------------------EDSRSRIPSYERQDKTI 150
           +L     +M NALEFLA AAG AA+                   D    I S   Q  T 
Sbjct: 141 NLKVNFTNMRNALEFLANAAGQAAEERLSEEEEELNNKFEKELNDDHISIDSPATQSTTS 200

Query: 151 REKTYHREESPNQHAS---GSKRASLATPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLT 207
            +   H + S    AS        +      LIE +   +P S   L D +YIG  K+++
Sbjct: 201 TDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTDYDYIGKSKMIS 260

Query: 208 EKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEG 267
           E EA +LI+ FFL MHPF+PY+P QL+   EL RYPILLC ILTIS+R+H F E     G
Sbjct: 261 EFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRHHKFNELGTYNG 320

Query: 268 ERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYAN 327
               R+I+VH++LW+YCQ++ISQ+VWAEASTRS+GT+LAFLLFTEWNPRAIHW W DYAN
Sbjct: 321 VNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWNPRAIHWKWADYAN 380

Query: 328 DTSLSDISR-----RDYHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMN 382
           +  L+D S       DY    KR+     TG+GA+RRSDRMAWML GT+VR+AQDMGF+ 
Sbjct: 381 NPKLNDFSTSDTGINDYLKVGKRT-----TGLGAIRRSDRMAWMLCGTSVRIAQDMGFIE 435

Query: 383 NSPKIFTALHITETQTAMNMNQRSILSQSL-------AEVSLNGHDGDSGLSSAC--IEE 433
           NS  +F A H +ET  AMN+ QRS L++SL         +S   +     L +    IE 
Sbjct: 436 NSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQTLKNEIFYIEN 495

Query: 434 IFRNE---DSKRRWKSYTQQRDSVEGK-----SVGFCDNEKEFLIDEYAFFHNEDSD-AY 484
           IF        +  WKS  Q ++++E K      +   D  + FL DE+A F++  +D  Y
Sbjct: 496 IFSENFKITERNYWKS--QLQENIENKIDIDDKIALSDKVRGFLNDEFALFYSNGNDPTY 553

Query: 485 RDLSNLGTHEK-SKLSAADKLLFTPRQRAKVELLRIMSIGYEAIYYK--DTKLTLIDHKH 541
            +  N   +   S L     L  +  Q+A +ELLRI S  Y+ IY +  + KL+  +  H
Sbjct: 554 SNERNNQPYSSFSTLPLPVNL--SKSQQANIELLRIFSTAYKTIYSRNQNQKLSSNNQSH 611

Query: 542 KLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTRDENKN---ATYDTPSKIDSESLISD 598
            +++L I AP++  W   +  LL P     C P    N+N      +    I+ ESLI D
Sbjct: 612 NISLLDIFAPLLHNWTIAFGDLLQP--SDVCEPINLNNRNNKRVVKEFNKIIEGESLICD 669

Query: 599 YFYCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRAL 658
           Y YCQLYI+SLALQI    E      +NE+TKS+ Y+ LAY +AKE + S  RV  L+ L
Sbjct: 670 YNYCQLYIFSLALQIGLDGE---ILTVNEITKSSTYINLAYQSAKEYILSTERVFTLKML 726

Query: 659 KYMPXXXXXXXXXXXXXXXXCYMTLTGSG--LGSDPRATTILAVCVISAEEIIEMIQKAA 716
           KYMP                CY+++ G+   L S      I  +   SA E++E+I+K+A
Sbjct: 727 KYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIKKSA 786

Query: 717 ITLREASPDELHLCSRFSTVLMFLCTEMKRK 747
           I L  +SPDELHLCSR+S+++M    EM  K
Sbjct: 787 ILLGSSSPDELHLCSRYSSIIMCFYKEMSEK 817

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 797  PHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINNDKNMTFEN 843
            P  SH  +E  DWF  S D+GL+FVE W EMLEQ+++ +D N+ F N
Sbjct: 973  PTGSH-ANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNLLFNN 1018

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score =  492 bits (1266), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 313/930 (33%), Positives = 483/930 (51%), Gaps = 133/930 (14%)

Query: 15  QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR------ 68
           QK++  + ACL C+ +K +CDLGP D P  PPC  C+R R  C F     + G+      
Sbjct: 29  QKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILD 88

Query: 69  -----------KRIEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTP-ELNS 116
                            ++  T      R    ++ + +  L +   +K  +L    LNS
Sbjct: 89  SQGLQSSQSTSPTSASMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNS 148

Query: 117 MHNAL------------------------EFLAKAA-------GSAAKEDSRSRIPSYER 145
            + AL                        EFLAKA         +     +RS   S   
Sbjct: 149 PNTALIEACDRVKSDTAWKLELTSMQSALEFLAKATKLRNDYKNNEPFGSTRSDAASTTS 208

Query: 146 QDKTIREKTYHREESPNQHASGSKRASLATPGKLIEKLSDWKP---GSLYDLGDVEYIGG 202
           + + + EK  +  ES +   S SK  S  +    IE +    P      YDL     +G 
Sbjct: 209 ETRDLSEKD-NGNESDSTTNSTSKDTSTRSSYPSIEAIKPEVPTPSNHNYDL-----LGD 262

Query: 203 HKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEH 262
            KL+T  EA  L+++FF  MHPF+PYIP  L+   EL +YP+LL  IL ISARY+ F + 
Sbjct: 263 GKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNPFDKV 322

Query: 263 KVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHW 322
               G   +RN+ +H++LW +CQ+L+SQ+VW++ASTRS+GT LAFLLFTEWNPRAIHW  
Sbjct: 323 GFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPRAIHWEV 382

Query: 323 TDYANDTSLSDISRRDYHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMN 382
           +D A+  S +++S       + + D   L G+  ++RSDRMAWM TGTA+RLAQ+M  + 
Sbjct: 383 SDTAHYLSDNNVS-------SSKEDPDGLGGIATVKRSDRMAWMFTGTAIRLAQEMDILE 435

Query: 383 NSPKIFTALHITETQTAMNMNQRSILSQSLAEVSLNG----HDGDSGLSSACIEE----- 433
           N+ KI+TA +I E   A NMN +  L +SL  VS++G     + D+  S   IE      
Sbjct: 436 NNAKIYTAANIAEICYASNMNLKPTLGESL--VSIDGGMKEFEIDNPKSQDDIENEDLLK 493

Query: 434 ----IFRNEDSKRRWKSYTQQRDSVEGKSVGF-CDNEKEFLIDEYAFFHNEDSDAYRDLS 488
               + +N++S ++W  +    D ++ ++     D E EFL DEY+  + +++ ++    
Sbjct: 494 FVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDEYSINYLDENSSF---- 549

Query: 489 NLGTHEKSKLSAADKLLFTPRQRAKVELLRIMSIGYEAIYYKDTK--LTLIDHKHKLAVL 546
                        + + +T  Q+A++ELLRI++I Y+ IYY+  K  ++ +D K  L +L
Sbjct: 550 -----------LKNPIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMIL 598

Query: 547 GILAPMIKGWHNTYKHLLVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYI 606
            +L+P++  W+  Y  L+ P +  + P     +  + +   + I  ES ISDY+YCQLY 
Sbjct: 599 DVLSPILNAWYLNYYKLMKPVSDEK-PVIISLDDLSKFKRTANIRGESFISDYYYCQLYT 657

Query: 607 YSLALQIEAGTEKDKKPNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPXXXX 666
           +SLALQ+E    K+ K  +NE+ KSA++VE AY AAKE+L SAIRVHK+  LKYMP    
Sbjct: 658 FSLALQVEV---KESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWV 714

Query: 667 XXXXXXXXXXXXCYMTLTGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDE 726
                       CY+TL    + ++  A +IL +  I  ++ + MI++AA+ L+E++PDE
Sbjct: 715 MRIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDE 774

Query: 727 LHLCSRFSTVLMFLCTEMKRKQ------------HSEPQXXXXXXXXXXXXXXPTD---A 771
           LHL S+FST+LMFLC E+  ++            +++P                 D   +
Sbjct: 775 LHLASKFSTILMFLCKEIDERKRDNENLMTGNGLNNDPSLESQTTHKESLEASNHDTISS 834

Query: 772 PARMPTTPAENYAATDFAIPAFLETPH-------------PSHLPSELEDWFCTSDDVGL 818
            A+ P  P+EN ++ D        +                ++LP ++ DWF  S+++GL
Sbjct: 835 DAQEP--PSENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGL 892

Query: 819 DFVEPWAEMLEQQFINN-DKNMTFENLYNE 847
           DFVEPW E++EQ++I N D    F+ L++E
Sbjct: 893 DFVEPWTELIEQKYIQNKDGFQDFDQLFDE 922

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPP--CVRCKRERKECVFLENSKRGGRK 69
          S+K +   +ACL CR RK +CD      P   P  C  C R   ECVF+  S RGGR+
Sbjct: 17 SRKRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVFVA-SNRGGRR 73

>TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}
          Length = 812

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 78/359 (21%), Positives = 137/359 (38%), Gaps = 68/359 (18%)

Query: 23  ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR----IEWTVDG- 77
           AC+ C   K +C           PC +CKR R +CVF    ++  RKR     ++  DG 
Sbjct: 48  ACVRCHRLKQKCLPSDLADIYRKPCSKCKRMRLKCVFDLTKRKRNRKRNSNITDYKQDGL 107

Query: 78  --NTDVNATARFEAEDKY--------------------------IPVATLKDTTSIKEGS 109
             + +++ + R +  D +                          +P+  L+    +   +
Sbjct: 108 SIDINIDDSVRLKKYDTFSSISGKKIITDIQPNNTANSLPAPHSLPIHILQSDAGVLHSN 167

Query: 110 LTPELNSMHNAL-----EFLAKAAGS---AAKEDSRSRIPSYERQDKTIREKTYHREESP 161
           L P   S++N +     + +    GS     K D R +  +    D  +R   +      
Sbjct: 168 LFPNTYSINNGVTQFSHQKMHANTGSDFNTLKNDKRFKNSNDTNSDLKVRYNYHISSTFE 227

Query: 162 NQHAS--GSKRASLATPGKLIEKLSDWKPGSLYDLG---DVEYIGGHKLLTEKEATRLID 216
           N   S   +++  L T  K +E++S +    L +     ++  I    +LTE+EAT  + 
Sbjct: 228 NDLYSLLIAQKDKLQTSNKKLEEMSHYGIELLKNTDFPLNIRDIFLFDILTEEEATFRLA 287

Query: 217 LFFLNMHPFFPY----IPFQLRCSQELKRYPILLCAILT-ISARYHNFAEHKVSEGERSS 271
            +  N    FP     I   +   Q  K  PILL AI++ +S +            + S 
Sbjct: 288 YYRNNFSVKFPICSIKISKDITVRQFWKEKPILLSAIMSCVSIKL-----------DSSQ 336

Query: 272 RNIEVHDRLWIYCQRLISQSVWAEA-----STRSVGTILAFLLFTEWNPRAIHWHWTDY 325
             +E + RL      LIS S++ +         S+ TI  +  F EW  +   +H  +Y
Sbjct: 337 TTLEKNVRLDGLTVHLISNSIFLKGEKSIEQIESMLTICTWYNFPEWFSKT-KFHIFNY 394

>CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON}
           similar to uniprot|P08638 Saccharomyces cerevisiae
           YLR451w LEU3 transcription factor
          Length = 940

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/313 (20%), Positives = 119/313 (38%), Gaps = 53/313 (16%)

Query: 23  ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR-----------KRI 71
           AC+ CR +K++CD     +P   PC RC+++   CV  ++ +R  +           K +
Sbjct: 57  ACVECRQQKSKCD-AHDKAPE--PCTRCQKKGVPCVLKKDFRRTYKRARNEAIEKRFKEL 113

Query: 72  EWTVDGNTDVNATARFEAEDKYI---------PVATLKDTTSIKEGSLTPELNSMHNALE 122
             T+   +      R E E + +          +  +KD  ++K+     +  S+ N++ 
Sbjct: 114 TATLSNLSSEQILKRIEEEQQQLLDNSNFTKDKIKKMKD-ENMKKWQQENQETSIINSIN 172

Query: 123 FLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLIEK 182
           +  + +  AA  DS          +KTI E+ Y +  +   H S      L    K    
Sbjct: 173 YQEENSPVAAHIDSNG--------NKTISEENYDKSANVVFHFSEMTEEQLKCSPK---- 220

Query: 183 LSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRY 242
                     +LGDV Y+   ++        L   F    H F P +  +    +     
Sbjct: 221 ----------NLGDV-YVSSQQI------AELFQEFATKYHIFLPVVNLEYGAEKIYNLS 263

Query: 243 PILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVG 302
           P L   IL I  R    + H + +     +++     +    +   S++     +  SV 
Sbjct: 264 PCLFWVILLIGLRRKPQSTHLMKKLSGLVKSVLAEITISPIIRYTPSETDEPVLNVASVY 323

Query: 303 TILAFLLFTEWNP 315
           ++ AFLL+T W P
Sbjct: 324 SVQAFLLYTFWPP 336

>KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.512
           YLR451W
          Length = 766

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/311 (20%), Positives = 109/311 (35%), Gaps = 63/311 (20%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDP-PCVRCKRERKECV----FLENSKRGGRKRIE 72
           RR Y AC+ CR +K++CD     + + P PC RCK++   C     F    KR   + IE
Sbjct: 13  RRKY-ACVECRQQKSKCDY----TTKFPEPCSRCKKKGIICAVKQGFKRTKKRATAEAIE 67

Query: 73  WTV--------DGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNALEFL 124
             +        DG   V+   R   ED+ + +    +T   +E             L  L
Sbjct: 68  RKIEQLKNHIADGPVSVDDLIRLAKEDEDVDLGQFDNTAFTRE------------QLHIL 115

Query: 125 AKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLIEKLS 184
              A +     SR+  P     + T+      R  S  +     K               
Sbjct: 116 RSEARTPV---SRAMTPLTNALNTTVNNGLLSRSLSAEECKCSPK--------------- 157

Query: 185 DWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPI 244
                    LGD+        ++ ++   L   F  N H F P +       +     P 
Sbjct: 158 --------SLGDI-------YMSSEDIADLFQEFATNYHQFLPVVDLSKGAEKIFSLSPC 202

Query: 245 LLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTI 304
           L   I+    R+ + +   +++     ++I     +    Q   ++S     +  SV ++
Sbjct: 203 LFWVIMLTGLRHRSGSIETMTKLSTLVKSILAEITISPIIQYTPTESDEPLLNVASVYSV 262

Query: 305 LAFLLFTEWNP 315
            AFLL+T W P
Sbjct: 263 QAFLLYTFWPP 273

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 6   TGNDLEVSSQKY-RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLEN 62
           T ND  +S   Y RR  KAC NCR RK +CD   P   +   C  C +  K C F EN
Sbjct: 144 TSNDNFISQHPYKRRVVKACYNCRRRKIKCDAIDPSKNK---CSNCLKLNKICSFSEN 198

>SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 801

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 8/93 (8%)

Query: 11  EVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70
           ++S +KY R    C  C+ R+ +CD G P       C +C R  +ECV++ N K   RK 
Sbjct: 153 KISKRKYSRN--GCTECKKRRMKCDEGKPS------CWQCTRLNRECVYILNPKNKKRKP 204

Query: 71  IEWTVDGNTDVNATARFEAEDKYIPVATLKDTT 103
                 GN+  ++ A+ +         TL+ T+
Sbjct: 205 RVGRNAGNSTKHSAAKQKTAKHKCASPTLESTS 237

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 12 VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
          V  +K  R    CLNCR RKT+CD G P       C  C +  + CV+ E++     K++
Sbjct: 9  VPVKKRHRPTLVCLNCRRRKTKCDRGKPS------CSNCLKLGETCVYSEDTDENASKKV 62

Query: 72 EW 73
           +
Sbjct: 63 RY 64

>Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar to
           Ashbya gossypii AER141C
          Length = 665

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 94/247 (38%), Gaps = 42/247 (17%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDG 77
           +R  K C NC+  K +C+          PC RC R   EC F++               G
Sbjct: 8   KRRTKPCSNCKQNKVKCEYN-----EGLPCSRCTRNGLECYFIQR--------------G 48

Query: 78  NTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNALE-FLAKAAGSAAKEDS 136
           N D + +++ +        AT ++       S+   LN+  +ALE  L    GS  ++  
Sbjct: 49  NIDKSPSSQKQETMLQFQTATTQEPIKEWMNSIDERLNTFESALESVLGLLHGSQIQQQQ 108

Query: 137 RSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLIEKLSDWKPGSLYDLGD 196
           +          +    +  H     NQ        +L     L+++ +        D+ D
Sbjct: 109 QI------NLLQQQISQQQHNLPDINQLLI----PTLFDSNSLVKQYT--------DVND 150

Query: 197 VEYIGGHKLLTEKEATRLIDLFFLNM-HPFFPYIPFQLRCSQELKRYPILLCAILTISAR 255
             +     +LT+++A  L+ LF  N  +  F Y    L         P+LL AI T+++R
Sbjct: 151 FRF---DHVLTKQQAQELLALFDKNCSNHLFHYTIGDLHIDDLWVNSPLLLAAICTVASR 207

Query: 256 YHNFAEH 262
           YH    H
Sbjct: 208 YHPALSH 214

>Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON}
           (21147..23855) [2709 nt, 903 aa]
          Length = 902

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/303 (19%), Positives = 115/303 (37%), Gaps = 37/303 (12%)

Query: 18  RRGYKACLNCRSRKTRCDL--GPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75
           RR   AC+ CR +K++CD     PD     PC +C ++  +C+  ++ +R  ++     +
Sbjct: 52  RRKKFACVECRQQKSKCDAVERAPD-----PCTKCSKKGLQCILKKDYRRTYKRARNQAI 106

Query: 76  DGNTDVNATARFEAEDKYIPVATLKDTTSIKEG---SLTPELNSMHNALEFLAKAAGSAA 132
           +         RF+   K +   +  +     E    +L    N   + +E L  A   A 
Sbjct: 107 E--------QRFKELTKTLSNLSADEIMKKIEEEQMNLLDSRNFTKDKVEKLRLANLDAP 158

Query: 133 KEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLIEKLSDWKPGSLY 192
            ++   +   +   +   +E+  H +E  N          +    K+ +     +P SL 
Sbjct: 159 IQEGLDKSAYFNTANTNPKEQEQHDQERKN---------IIIESYKMTKDQLQCQPKSLG 209

Query: 193 DLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTI 252
           D+           ++ +E + L + F    HPF P +       +     P L   IL I
Sbjct: 210 DI----------YMSSEEISELFEEFATKYHPFLPVVDLSKGAERIYNLSPCLFWVILLI 259

Query: 253 SARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTE 312
             R    +   + +   S ++I     +    +   + +     +  SV ++ AFLL+T 
Sbjct: 260 GLRRKFKSAELMKKLSESVKSILAEITISPIIRYTPTDNEEPILNVASVYSVQAFLLYTF 319

Query: 313 WNP 315
           W P
Sbjct: 320 WPP 322

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/334 (20%), Positives = 116/334 (34%), Gaps = 64/334 (19%)

Query: 22  KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWT------- 74
           +AC  CR +K RC      S   P C +C +    C +   +KR    R   T       
Sbjct: 3   QACDICRVKKLRC------SKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAHLTEVEKKLN 56

Query: 75  ---------VDGNTDVNATARFEAE------DKYIPVATLKDTTSIKEGSLTPELNSMHN 119
                      G    N   RF  +      D        +D   I + ++T  ++   +
Sbjct: 57  NLTILFGKLFPGENIGNLVKRFNIDSSKSDFDNAYLTNNEEDDKKINKANVTIPID---D 113

Query: 120 ALEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKL 179
           ++E L        K D   R+   +   K I +K+Y+    PN   S  +         L
Sbjct: 114 SVENLLYGFDWEEKND---RVNHGQSIMKHITDKSYNGYFGPNSTISLFRSIKNLNIIML 170

Query: 180 IEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYI---------- 229
           +E  ++    +LY + + +      L  +    R I  FF N HPF P +          
Sbjct: 171 LEN-NNISNKNLYGIPNAQISSSVNLTKKTTMKRYIRSFFENFHPFNPIVDEDWFMSMYT 229

Query: 230 -PFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLI 288
               +    E + + +L+  ILTI A  H        EGE +    E+    + +C    
Sbjct: 230 DKKSVHSKNETQYWQLLMNIILTIGAWCH--------EGESN----EIDTYYYQHCHNFF 277

Query: 289 SQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHW 322
           S +  +  S  S+  ++        N  +I+  W
Sbjct: 278 SNNGCSFLSNGSIDLLIVM------NLVSIYLFW 305

>YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON}
           TBS1Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies
          Length = 1094

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (44%), Gaps = 11/139 (7%)

Query: 19  RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDGN 78
           R  KAC  CR RK RC    P S +   C  C +  K+C F  + +   R+       GN
Sbjct: 102 RVTKACDYCRKRKIRCTEIEPISGK---CRNCIKYNKDCTFHFHEELKRRREEALNNKGN 158

Query: 79  TDVNATARFEAEDKY----IPVATLKDTTSIKEGSLTPELNSMHNALEFLAKAAGSAAKE 134
                  R + E+K+      +A     TS  + S  P+L++ + + E++  +AG +A  
Sbjct: 159 GKSVKKPRLDKENKFKDENFDIAVRSRNTSSTDSS--PKLHT-NLSQEYIGVSAGKSA-S 214

Query: 135 DSRSRIPSYERQDKTIREK 153
           D     P +   D+T+ EK
Sbjct: 215 DKEDTWPDFVPIDRTVLEK 233

>SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]
           {ON} conserved hypothetical protein
          Length = 676

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/250 (21%), Positives = 98/250 (39%), Gaps = 39/250 (15%)

Query: 12  VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
           +++++ RR  K C+NC+  K RC           PCVRC++    C + EN ++   + I
Sbjct: 1   MTTKEPRRRTKPCMNCKRNKVRCQY-----IETLPCVRCQKHNLRCFYPENEQQNPEENI 55

Query: 72  EWT---VDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNALEFLAKAA 128
           +     V  NT  N                        E ++   L++  NALE +  + 
Sbjct: 56  QQQLTHVSENTQTNW-----------------------ETTVDYRLSTFENALESVLSSL 92

Query: 129 GSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLIEKLSDWKP 188
            S   +                + +    +  P+ H S ++R  L +  +L   L +   
Sbjct: 93  QSNQAQQQHQ------INLLQQQLQQQQGQRQPS-HYSINQRVKLPSVRELESFLYNHPS 145

Query: 189 GSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHP-FFPYIPFQLRCSQELKRYPILLC 247
            S  +  +        ++ ++EA  L++LF   + P  F Y   +L      +  PILL 
Sbjct: 146 TSQQNYSESLDFRETLIINKEEAKELLELFSTKLAPHLFGYDIGKLSVDALWEESPILLA 205

Query: 248 AILTISARYH 257
           +I T+S  +H
Sbjct: 206 SICTVSCTHH 215

>Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON}
          (12074..14566) [2493 nt, 831 aa]
          Length = 830

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 18/81 (22%)

Query: 13 SSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK-RI 71
          +S K  + +  C  CRSRK +CDL        P C +C   R EC        GG   ++
Sbjct: 15 NSYKRIKTFTGCWTCRSRKIKCDLTK------PSCRKCTNSRIEC--------GGYDIKL 60

Query: 72 EWT--VDGNT-DVNATARFEA 89
           WT  VD NT +V++T+R E+
Sbjct: 61 VWTEPVDFNTPEVSSTSREES 81

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
           YML099C (ARG81) - zinc-finger transcription factor of
           the Zn(2)-Cys(6) binuclear cluster domain type [contig
           336] FULL
          Length = 841

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 27/112 (24%)

Query: 19  RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK-RIEWT--- 74
           + +  C  CRSRK +CDLG P+      C RC++   EC        GG   ++ W+   
Sbjct: 18  KTFTGCWTCRSRKVKCDLGKPN------CQRCEKSGLEC--------GGYDIKLRWSPSI 63

Query: 75  -------VDGN-TDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMH 118
                  VD N +  N T   +++ + +   T KD     E  +  EL+++H
Sbjct: 64  KFNKFGQVDSNGSPANGTEEPQSQRRNVGFVTYKDEYEFYE-DMDEELSALH 114

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
           RR  KAC  CR RKT+CD     SP    C  C +   +C+F+    +  RK
Sbjct: 172 RRAAKACEYCRKRKTKCD---EVSPYTNKCSNCSKAGVDCIFITEPTKKKRK 220

>Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa]
          {ON} similar to Ashbya gossypii ACR209W + ACR208C
          Length = 856

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 4/82 (4%)

Query: 13 SSQKYRRGYKACLNCRSRKTRCD---LGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
          S +K +   +ACL CR RK RCD    G         C  C     +C+F+  S+RGGR+
Sbjct: 7  SGKKRKVAKRACLACRKRKIRCDGETRGTVVEDGQRVCSNCANHGLKCIFVR-SQRGGRR 65

Query: 70 RIEWTVDGNTDVNATARFEAED 91
               +   T  N T+  ++ D
Sbjct: 66 MPRKKLQHATSENKTSCIDSND 87

>KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.344
           YML076C
          Length = 903

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70
           K +R   AC+ C S K +C     +     PCVRC R+RK+C F + SKR  ++R
Sbjct: 51  KNKRNTFACVGCHSLKQKCVPSDFNDIYRKPCVRCFRQRKKCKF-DLSKRTRKRR 104

>SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON}
          conserved hypothetical protein
          Length = 750

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 12 VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
          V  Q  +R    CL CR RK +CD         P C  CKR   +CV++  ++   +   
Sbjct: 24 VVKQTEKRSKSGCLTCRKRKKKCDEA------RPRCTGCKRNLLDCVWVNEAQGTAQPEF 77

Query: 72 EWTVDGNTDVNATARFEAED 91
          E   DG + +N T    A+D
Sbjct: 78 E-KKDGESFINFTINDLAKD 96

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
          YKL222C (REAL)
          Length = 688

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 6/42 (14%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60
          +  KACLNCR +K +CD   P       C +C+  + ECV+L
Sbjct: 11 KAIKACLNCRRKKQKCDQARPQ------CYQCRIRKTECVYL 46

>CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa]
           {ON} similar to uniprot|P40971 Saccharomyces cerevisiae
           YDR034c LYS14 transcriptional activator of lysine
           pathway genes
          Length = 831

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 63/144 (43%), Gaps = 12/144 (8%)

Query: 4   LATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENS 63
           ++T  D E ++ K +     C  C+ R+ +CD         P C +C R  ++CV++ N 
Sbjct: 184 ISTIKDAEGNTVKRKYSRNGCAECKRRRMKCD------ESKPKCWQCTRLNRDCVYILNP 237

Query: 64  KRGGRKRIEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNALEF 123
           K   RK    T  G +D     R E E K +    +       + ++TP+L+  H+ +  
Sbjct: 238 KNKKRK----TSKG-SDRVKEERCE-EQKLVNGQLVTSNNEPPQATITPQLDIRHSPITP 291

Query: 124 LAKAAGSAAKEDSRSRIPSYERQD 147
           ++  +      +  + +P+ +  D
Sbjct: 292 ISSKSAETKNPEIPNVLPTSDLMD 315

>KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON}
          Anc_7.512 YLR451W
          Length = 869

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 5/57 (8%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDP-PCVRCKRERKECVFLENSKRGGRK 69
          ++ YRR   AC+ CR +K+RCD     S + P PC +CK++   CV  ++ +R  ++
Sbjct: 38 TKVYRRKKFACVECRQQKSRCDA----SEKAPGPCTKCKQKGVTCVLKKDFRRTYKR 90

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
          similarities with uniprot|Q12180 Saccharomyces
          cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
          cerevisiae YBR150c TBS1
          Length = 1049

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 7  GNDLEVSSQKY-RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          G  +E+  Q Y RR  KAC +CR RK RCD   P + +   C  C + + EC F
Sbjct: 23 GMAMELLQQHYKRRSTKACDHCRKRKIRCDEVNPVTNK---CSNCVKFKVECTF 73

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 7/52 (13%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGG 67
          K RR  +AC  CR +K +CD          PC+ C     EC + + +KRGG
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRGG 51

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 11/91 (12%)

Query: 5   ATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSK 64
           ++G D +   +KY R    C  C+ R+ +CD G       P C +C R  +ECV++  +K
Sbjct: 132 SSGADGKTVKRKYSR--NGCTECKRRRMKCDEG------KPTCWQCARLNRECVYVIRTK 183

Query: 65  RGGRKRIEWTVDGNTDVNATA-RFEAEDKYI 94
              RKR   + D + D +    R +  +K I
Sbjct: 184 N--RKRRPKSTDNSKDTSKPGQRVQKSEKGI 212

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {ON}
           similar to uniprot|Q12151 Saccharomyces cerevisiae
           YDR213w UPC2
          Length = 844

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 9/81 (11%)

Query: 17  YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF--LENSKRGGRKRIEW- 73
           + +    C +C+ R+ +CD G       P C +C + + ECV+  ++  KR  R R+++ 
Sbjct: 47  HNKSKNGCDHCKRRRVKCDEG------KPMCDKCVKMKLECVYTPVQPPKRRTRTRVKYI 100

Query: 74  TVDGNTDVNATARFEAEDKYI 94
           T D N ++  T + + E K +
Sbjct: 101 TRDANGEIIETEKPQVEGKDV 121

>ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 736

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 9/91 (9%)

Query: 5   ATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSK 64
            T  + +V  +KY R    C  C+ R+ +CD         P C +C R  +ECV++ N+K
Sbjct: 103 VTDGEGKVVKRKYSRN--GCTECKRRRMKCD------ETKPTCWQCARLNRECVYILNAK 154

Query: 65  RGGRKRIEWTVDGNTDVNATARFEAEDKYIP 95
              RK  E  +   TD N        +  IP
Sbjct: 155 NKKRKPREARIKS-TDRNNKKGLAKTNGSIP 184

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
          Anc_4.344 YML076C
          Length = 945

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70
          QK +R   AC+ C S K +C     ++    PC+RC + +++C F + SKR   +R
Sbjct: 33 QKRKRNTVACITCHSSKQKCVPSDLNNIFWKPCIRCLKSKRQCTF-DLSKRTRNRR 87

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWT 74
          ++ R+ + AC NCR ++ +CD+       + PC  C +   EC+ + N KR  R   E+ 
Sbjct: 8  KRKRKAHLACQNCRIKRRKCDM-------ERPCSNCLKYGIECITVNNDKRTKRTTHEYV 60

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 77/191 (40%), Gaps = 37/191 (19%)

Query: 19  RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR--------KR 70
           + +  C  CRSRK +CDL      R P CVRC +   EC   +   R  +         +
Sbjct: 16  KTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQ 69

Query: 71  IEWTVDGNTDVNATARFEA--------EDKYIPVATLKDTTSIKEGSLTPELNSMHNALE 122
           +  + +GN+  N   +++         +++YI    + D  SI      P    + +   
Sbjct: 70  LPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHA---PPTEKIADGKT 126

Query: 123 FLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLIEK 182
           ++ K  G     D         + DK    +   R+ +P   ++ SKR +L T  KL  K
Sbjct: 127 WIIKKFGVFRGTD---------KIDKQYAPRKKRRKPAP---STVSKRKTLKTGNKLSAK 174

Query: 183 LSDWKPGSLYD 193
            S  KP ++ D
Sbjct: 175 ESAGKPINIED 185

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDG 77
           +R  +AC +CR RK +CD   P +P+   C  C +    C F        RKR    +DG
Sbjct: 112 KRVARACDHCRRRKIKCD---PVNPQTNKCSNCTKYDANCTFRVRDDVEKRKRANEAIDG 168

Query: 78  NTDVN 82
           +  V+
Sbjct: 169 SGGVS 173

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 15/66 (22%)

Query: 10 LEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
          ++  S +  + Y  C  CR+RK +CDL        P C+RC+R + +C        GG K
Sbjct: 1  MDKKSTRSVKTYSGCWTCRARKVKCDL------VRPSCLRCRRSKVQC--------GGYK 46

Query: 70 -RIEWT 74
           ++ W+
Sbjct: 47 IKLRWS 52

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 1   MKRLATGNDLEVSSQKY----RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKE 56
           MKR AT    E   Q      +R  +AC +CR RK +CD   P  P    C  C +    
Sbjct: 114 MKRTATSPQQEKIQQDTYYSKKRATRACESCRKRKIKCD---PVDPITNKCSNCTKFHMI 170

Query: 57  CVFLENSKRGG 67
           CVF +N KR  
Sbjct: 171 CVF-DNRKRKA 180

>TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {ON}
           Anc_7.512 YLR451W
          Length = 817

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 61/299 (20%), Positives = 110/299 (36%), Gaps = 44/299 (14%)

Query: 23  ACLNCRSRKTRCDLGPPDSPRDP-PCVRCKRERKECV----FLENSKRGGRKRIEWTVDG 77
           AC+ CR +K++CD       R P PC +C ++   C+    F    KR   + IE     
Sbjct: 35  ACVECRQQKSKCDA----HERAPEPCTKCAKKDVPCILKRDFRRTYKRARNEAIE----- 85

Query: 78  NTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNALEFLAKAAGSAAKEDSR 137
                   RF+   + +   + +D     E      L+  +   E L     S  + +  
Sbjct: 86  -------KRFKELTRTLTNLSSEDILKKIEQEQKDLLSGQNFTKEKLKIKKLSTTQSNVS 138

Query: 138 SRIPSYERQDKTIREKTYHRE-ESPNQHASGSKRASLATPGKLIEKLSDWKPGSLYDLGD 196
           S +PS++ ++ T  +     + +  N+  S S +  + +P  L         G +Y    
Sbjct: 139 SSVPSWDIEEITNGDADATEDNKVENEQCSISDQQLVCSPKSL---------GEVY---- 185

Query: 197 VEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARY 256
                    ++  +   L   F    HPF P +             P L   IL I  R 
Sbjct: 186 ---------MSSDDIAELFQEFATKYHPFLPVVDISRGAESIYSLSPCLFWVILLIGLRR 236

Query: 257 HNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNP 315
            + A   +++     ++I     +    +   S++     +  SV ++ AFLL+T W P
Sbjct: 237 KSGAIDLMTKLSSLVKSILAEITISPIIRYTPSENDEPVLNVASVYSVQAFLLYTFWPP 295

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa]
          {ON} YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 4/38 (10%)

Query: 22 KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          +AC  CR +KTRCD     S  +P C  C+R  K C F
Sbjct: 37 RACDQCRGKKTRCDF----SDENPVCTSCQRMSKTCTF 70

>Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR451W
           (LEU3) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 124]
           FULL
          Length = 882

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 69/317 (21%), Positives = 116/317 (36%), Gaps = 47/317 (14%)

Query: 13  SSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR---- 68
           SS++ RR   AC+ CR +K++CD     +P   PC RC ++   CV  ++ +R  +    
Sbjct: 20  SSRRGRRKKLACVECRQQKSKCD-AHEKAPE--PCTRCAKKNVACVLQKDFRRTYKRVRN 76

Query: 69  ----KRIEWTVDGNTDVNA---TARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNAL 121
               KR +      +++ A     R E E + +    L      KE        S  N  
Sbjct: 77  EVIEKRFKELTKSLSNLGAEEILKRIEEEQQTL----LDKNNFTKEKLKKLRQESSSNND 132

Query: 122 EFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLA---TPGK 178
            F   ++ S+ +    +R P                E SP+ H   S    L    T G+
Sbjct: 133 VFPTLSSPSSMEHTPMTRPP----------------EGSPHDHGLSSNSPGLVAGMTSGE 176

Query: 179 LIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQE 238
              +  +  P SL          G   ++ ++   L   F    HPF P +         
Sbjct: 177 PNAESFECTPKSL----------GEIYMSTEDIQELYAEFEAKYHPFLPVMDISKGPELI 226

Query: 239 LKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEAST 298
               P L   I+ I  R    A   +++     ++I     +    +   S++     + 
Sbjct: 227 YSLSPCLFWVIMLIGLRRKFRATETMAKLSTLVKSILAEITMSPIIRYSPSENDEPVLNV 286

Query: 299 RSVGTILAFLLFTEWNP 315
            SV ++ AFLL+T W P
Sbjct: 287 ASVYSVQAFLLYTFWPP 303

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          + +  C  CRSRK +CDLG P       C RC+R   EC
Sbjct: 15 KTFTGCWTCRSRKVKCDLGRPS------CKRCERSGFEC 47

>SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON}
          conserved hypothetical protein
          Length = 770

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 30/65 (46%), Gaps = 5/65 (7%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF---LENSKRGGRKRIE 72
          K +R  +AC +CR  KTRC   P   P +  C+RC   +  C F   LENS   G     
Sbjct: 22 KGKRALRACDSCRRLKTRC--IPSPLPNEIQCLRCDSLKLRCSFQDLLENSGSPGDAPTS 79

Query: 73 WTVDG 77
             DG
Sbjct: 80 KIADG 84

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} similar
           to uniprot|P05085 Saccharomyces cerevisiae YML099C ARG81
           Zinc-finger transcription factor of the Zn(2)-Cys(6)
           binuclear cluster domain type involved in the regulation
           of arginine-responsive genes acts with Arg80p and Arg82p
          Length = 833

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 48/111 (43%), Gaps = 27/111 (24%)

Query: 21  YKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK-RIEWT----- 74
           +  C  CRSRK +CDLG       P C RC +   EC        GG   ++ W+     
Sbjct: 20  FTGCWTCRSRKVKCDLG------KPTCQRCDKSGLEC--------GGYDIKLRWSQPIRF 65

Query: 75  -----VDGNTDVNATA-RFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHN 119
                VD NT  +A A   +++ + +   T KD     E  +  EL+ +H+
Sbjct: 66  DNFGQVDPNTSSSACADEPQSQRRNVGFVTYKDEYEFYE-DMDDELSELHS 115

>KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.879
          YML099C
          Length = 861

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          + +  C  CRSRK +CDL      R P C+RC++   EC
Sbjct: 18 KTFTGCWTCRSRKVKCDL------RRPGCLRCEKSSLEC 50

>CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa]
          {ON} weakly similar to uniprot|Q03631 Saccharomyces
          cerevisiae YML076c
          Length = 945

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 3  RLATGNDLEVSSQ-KYRRGYKACLNCRSRKTRC---DLGPPDSPRDPPCVRCKRERKECV 58
          RL+  + LEV+     +R   AC+ C   K +C   D+G  D  R+P CVRC R R  C+
Sbjct: 40 RLSQPSQLEVNENGNMKRNTFACVKCHDLKQKCRPSDVG--DIYRNP-CVRCLRSRDPCI 96

Query: 59 F 59
          F
Sbjct: 97 F 97

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 1   MKRLATGNDLEVSSQKYR-RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
           M    + NDL  SS+  + R  KAC +CR RK RCD   P + +   C  C + +  C F
Sbjct: 109 MMEHTSSNDLIASSKNLKKRVSKACDHCRKRKIRCDEVDPQTNK---CSNCVKFQSACTF 165

Query: 60  LENSKRGGRKR 70
               +   +KR
Sbjct: 166 KHRDEILRKKR 176

>KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {ON}
           Anc_3.264 YDR034C
          Length = 736

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 8/58 (13%)

Query: 12  VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
           +  +KY R    C  C+ R+ +CD         P C +C R  +ECV++ N K   RK
Sbjct: 145 IVKRKYSRN--GCTECKRRRMKCD------ETKPSCWQCARLNRECVYVLNPKNKKRK 194

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
          Anc_8.879 YML099C
          Length = 953

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          + +  C  CRSRK +CDL      R P C RC+R   +C
Sbjct: 7  KTFTGCWTCRSRKVKCDL------RRPNCSRCERSELQC 39

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 7/63 (11%)

Query: 11 EVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70
          +V  Q  +    ACL+CR ++ +C++         PC  C+R   +C+F     R  RK 
Sbjct: 8  QVVLQTVKPKRLACLHCRHKRKKCNM-------KSPCSNCQRAGMKCIFTHEDLRSKRKS 60

Query: 71 IEW 73
          + +
Sbjct: 61 VSY 63

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDG 77
           +R   AC++C S K +C     D     PC RC +  K C F + SKR  R++   +   
Sbjct: 116 KRNTFACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNGKVCTF-DLSKRTKRRKQRNSNST 174

Query: 78  NTDVNATARFEA 89
           ++ V+ T  F++
Sbjct: 175 SSLVSMTGSFQS 186

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa]
          {ON} Anc_8.423 YLR228C
          Length = 730

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 6/59 (10%)

Query: 17 YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75
          + +    C NC+ R+ +CD G       P C +C   R ECVF     R  + ++  T+
Sbjct: 27 HNKSKNGCDNCKRRRVKCDEG------KPFCQKCANMRLECVFTPPQPRRKKSKVSNTL 79

>KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa]
          {ON} similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 919

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          K +R   AC++C S K +C+   P      PC+RC +  K C F
Sbjct: 56 KVKRSTFACISCHSMKQKCNPTDPTDIYRHPCIRCAKLNKICQF 99

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 8/56 (14%)

Query: 5   ATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60
           +T  D ++  +KY R    CL C+ R+ +CD G       P C +C R  ++CV++
Sbjct: 138 STDADGKIVKRKYSR--NGCLECKKRRMKCDEG------KPTCWQCARLNRKCVYI 185

>Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}
           similar to Ashbya gossypii ACL058W
          Length = 885

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 91/237 (38%), Gaps = 44/237 (18%)

Query: 4   LATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENS 63
           L  G   +V  ++ RR    C+ C  RK +C      S   P C  C R   ECV+  N 
Sbjct: 19  LEDGTIYKVQHKRQRRVLN-CMPCHKRKVKC------SRERPSCDNCLRNSFECVYFVND 71

Query: 64  K--RGGRKRIEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNAL 121
           +  RGG+ ++                E++ + + V        I++     E  +  NA+
Sbjct: 72  RVSRGGQHKVPK--------------ESKQQLLKV--------IEKARKVVEQENSENAV 109

Query: 122 EFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHRE------ESPNQHASGSKRASLAT 175
                +  +A   +  +  P+    D+++      RE        P +  S S+   L +
Sbjct: 110 VMQENSRSTAVVAEESATHPNKYVVDRSLDSTNNARETKRTVITQPEEGNSDSQHQLLTS 169

Query: 176 PGKLI--EKLSDWKPGSLYDLGDVEYIGGHKLLTEKE-ATRLIDLFFLNMHPFFPYI 229
            GK I    LS   P  L   G   +    +LL  +E    L+D + +++HP  P +
Sbjct: 170 SGKHISANTLSLELPQPLMTSGADNF----QLLPSRERCLELLDHYKVSVHPILPLV 222

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 50/106 (47%), Gaps = 14/106 (13%)

Query: 17  YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK--RIEW- 73
           + +    C NC+ R+ +CD G       P C +C   + +CV+L  + R   K  ++E  
Sbjct: 99  HNKSKNGCANCKRRRVKCDEG------KPTCQKCLNMKLQCVYLPVTARNKPKISQVETL 152

Query: 74  ----TVDGNTDVNATARFEAE-DKYIPVATLKDTTSIKEGSLTPEL 114
                +  N+ +N+  + ++E D  +   + ++T    + S TP+L
Sbjct: 153 PNPSIMTSNSTINSNEKIKSESDIKVKDNSSQNTIFPNKTSSTPQL 198

>KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa]
          {ON} 
          Length = 860

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          Q+ +R    CL CRSRK +CD         P C RCK++ K C +
Sbjct: 6  QRKQRPSYVCLECRSRKLKCD------KARPYCNRCKKDGKVCAY 44

>TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 64/323 (19%), Positives = 128/323 (39%), Gaps = 52/323 (16%)

Query: 12  VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
           + S + ++  + C++C+ +K +C           PC RC +    C F    K+      
Sbjct: 1   MGSYESKKRTRPCVSCKRQKLKCQYK-----ESLPCERCIKHGMACYFPTTQKQSA---- 51

Query: 72  EWTVDGNTDVNATARFEA---------EDKYIP-------VATLKDTTSIKEG---SLTP 112
             T   +       R+++         E   +P       +   K TT +  G   SL P
Sbjct: 52  --TAKQSLHETVLPRYQSPPPLQSNPPEASVVPNTLPKPRIREAKSTTVLPSGLPTSLLP 109

Query: 113 ELNSM-----HNALEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASG 167
              ++         +FL  A  S       ++I  +E+Q K ++ +   +     +  S 
Sbjct: 110 NNGNLWAYSGEQRADFLQTALESMLTIFQHNQI-QHEQQIKVLQNQVNQQNHVVIRDQSR 168

Query: 168 SKRASLATPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHP-FF 226
           +  +++A P   + ++ D   G    + D   +G   ++++ EA  L+ +F   M    F
Sbjct: 169 AGPSAVALPS--VSEIID-NGGPKEQVTDFRKLG---IISKTEAAELLHIFCTKMSGHMF 222

Query: 227 PYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQR 286
            Y   +L   +   + P+LL +I T++  +H   ++K +  + S R        W+  + 
Sbjct: 223 GYSSEELTLEELWDQSPLLLASICTVACPHHPLLQYKKTRLQESLR--------WLASEL 274

Query: 287 LI-SQSVWAEASTRSVGTILAFL 308
           L  S S+ +      +G I+AFL
Sbjct: 275 LNHSDSIDSNVEHIILGLIIAFL 297

>Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON}
          YKL222C - Hypothetical ORF [contig 17] FULL
          Length = 735

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 7/52 (13%)

Query: 11 EVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRC-KRERKECVFLE 61
          E+ S+K R+  K CL CR RK +CD         P C  C  R   ECV++E
Sbjct: 23 ELGSRKRRKSIKQCLFCRKRKLKCD------KNRPVCGTCASRGLTECVYVE 68

>KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 811

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 3   RLATGNDLEVS---SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
           RL     LE +   + K +R   AC NC S+K++C           PCVRC + RK C F
Sbjct: 88  RLTQPTALEAAPTGAGKPKRNTFACTNCHSQKSKCVPSDVSDIYRKPCVRCHKRRKLCKF 147

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 7/52 (13%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          ++K +R   ACL CR R  +C       P   PC +C +   +C ++E S++
Sbjct: 24 TKKQKRQQIACLECRKRHIKC-------PNGNPCFKCLKNNLKCEYIEPSRK 68

>KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa]
          {ON} Anc_1.199 YKR064W
          Length = 835

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKR--ERKECVFLENSKRGGRKRIE 72
          +K +R    C NCR RK+RCD       R+ PC  C R      CV+L++S      +I 
Sbjct: 13 RKRKRPTVVCTNCRRRKSRCD-------RERPCNTCTRFGNADSCVYLDSSPSSNEPQIL 65

Query: 73 WT 74
           T
Sbjct: 66 LT 67

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
          extends into a gap in the genome sequence
          Length = 729

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 7/51 (13%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCK-RERKECVFLENS 63
          ++K R+  + C  CR RK RCD G       P C  CK R   EC++LE++
Sbjct: 15 TRKKRKHIRTCTFCRQRKVRCDQG------RPLCSSCKARGFSECIYLEDA 59

>Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {ON}
           complement(31679..33880) [2202 nt, 734 aa]
          Length = 733

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 11/60 (18%)

Query: 12  VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL---ENSKRGGR 68
           V  +KY R    C  C+ R+ +CD         P C +C R  +ECV++   +N KR G+
Sbjct: 109 VVKRKYSRN--GCAECKRRRMKCD------ETKPTCWQCSRLNRECVYVLNPKNKKRNGK 160

>KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]
           {ON} conserved hypothetical protein
          Length = 661

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 92/244 (37%), Gaps = 46/244 (18%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDG 77
           RR  K C NC+  K +C     DS    PC RC R + +C F EN               
Sbjct: 7   RRRTKPCTNCKKNKVKCLY--QDSL---PCERCARHQLQCHFAEN--------------- 46

Query: 78  NTDVNATARFEAEDKYIPVA-TLKDTTSIK-EGSLTPELNSMHNALEFLAKAAGSAAKED 135
           N+  N T      +  +P A  L D +++    S+   L++  NALE +     S   + 
Sbjct: 47  NSLRNETLSVHEINTGLPQAPALNDASTLGWSNSVDARLDTFENALESVLSILQSNQIQQ 106

Query: 136 SRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKL-IEKLSDWKPGSLYDL 194
            +       R    IR+         N HA  S+    A P  L +E L     G L   
Sbjct: 107 QQQINLLQHR----IRQ---------NSHACPSQ----ALPLNLELESL-----GELVGS 144

Query: 195 GDVEYIGGHKLLTEKEATRLIDLFFLNMHP-FFPYIPFQLRCSQELKRYPILLCAILTIS 253
            +V       ++++ +A  L+ +F     P  F Y    L         P+LL +I  ++
Sbjct: 145 SEVRDFRTALIISKDQAAELVTIFSEKFVPRLFGYDIGSLDAENLWNNSPLLLASICAVA 204

Query: 254 ARYH 257
             +H
Sbjct: 205 CAHH 208

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 10  LEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
           L+VS    +R  KAC +CR RK +CD      PR   C  C +   EC F
Sbjct: 125 LDVSGAPKKRVSKACDHCRKRKIKCD---DVKPRTGKCSNCTKFNAECTF 171

>KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON}
          similar to uniprot|P08638 Saccharomyces cerevisiae
          YLR451W LEU3 Zinc-finger transcription factor that
          regulates genes involved in branched chain amino acid
          biosynthesis and ammonia assimilation positively
          regulated by alpha-isopropylmalate an intermediate in
          leucine biosynthesis
          Length = 873

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 6  TGNDLEVSSQKYRRGYKACLNCRSRKTRCDLG--PPDSPRDPPCVRCKRERKECVFLENS 63
            +D+    +K RR   AC+ CR +K++CD     P+S     C RC ++  +CV  ++ 
Sbjct: 13 VSSDINAGLRKGRRKKLACVECRQQKSKCDAHERAPES-----CTRCAKKNVQCVLQKDF 67

Query: 64 KR 65
          +R
Sbjct: 68 RR 69

>TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa]
          {ON} Anc_1.199 YKR064W
          Length = 827

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 20/93 (21%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKR--ERKECVFLENSKRGGRKRIE 72
          +K  R    C NCR RK++CD       R  PC  C R  ++  CV+++ +K G R  ++
Sbjct: 13 RKRNRLTVVCSNCRRRKSKCD-------RQTPCGNCVRLGDKDTCVYIKEAK-GDRNSMD 64

Query: 73 WTV----------DGNTDVNATARFEAEDKYIP 95
            +          +  T+   +  F++  +Y+P
Sbjct: 65 LRITKKLPTSKRKNSVTNTKKSVSFDSVQEYVP 97

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          ++K R+  KAC+ CR RK +CDL        P C +C      C++
Sbjct: 4  TRKRRKIIKACVFCRKRKLKCDLTK------PKCKQCSSRNLNCIY 43

>Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {ON}
           YML076C (REAL)
          Length = 944

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 12/109 (11%)

Query: 3   RLATGNDLEVSSQ-KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF-- 59
           RL+    LE + + K +R   AC+ C S K +C+    +     PC RC + RK C F  
Sbjct: 53  RLSYPTKLETTEKGKIKRNSFACVCCHSLKQKCEPSDANDIYRKPCRRCLKHRKLCKFDL 112

Query: 60  -LENSKRGGRKRIEWTVDG---NTDVNATARFEAEDKYIPVATLKDTTS 104
                KR  R R   + D    N  +      ++E+     ++LKD TS
Sbjct: 113 SKRTRKRKPRSRSPTSFDSPLVNVSIKCKVPTDSEE-----SSLKDGTS 156

>NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56
          Length = 718

 Score = 38.9 bits (89), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 7  GNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRG 66
          GN+L++     +R   AC NCR R+ +CDL       + PC  C R    C   E   R 
Sbjct: 20 GNELDILDDYPKRKRLACSNCRRRRKKCDL-------NFPCANCIRLGLNCNVNEEDMRK 72

Query: 67 GR 68
           R
Sbjct: 73 KR 74

>TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {ON}
           Anc_3.264 YDR034C
          Length = 770

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 19/91 (20%)

Query: 15  QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWT 74
           +KY R    C  C+ R+ +CD         P C +C R  + CV++ N K   R      
Sbjct: 133 RKYSRN--GCTECKRRRMKCD------ETKPTCWQCSRLNRHCVYVFNPKNKKR------ 178

Query: 75  VDGNTDVNATA--RFEAEDKYIPVATLKDTT 103
              N D+ ATA    + EDK+    T+  TT
Sbjct: 179 ---NKDLLATALSSNDNEDKFKLKKTISGTT 206

>KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]
           {ON} conserved hypothetical protein
          Length = 860

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 19/94 (20%)

Query: 23  ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVD-GNTDV 81
           +C NCR  + +CD G       P C RC + + +CV+    +   + +I+ +VD GN  +
Sbjct: 4   SCQNCRKTRRKCDRG------KPTCARCIKYKIDCVY----ELPPKHKIKQSVDIGNDMI 53

Query: 82  NATARFEAEDKYIPVATLKDTTSIKEGSLTPELN 115
           + T R +           +   S++   +TP+L+
Sbjct: 54  SETQRQQKLH--------RKQNSVRSSVITPQLH 79

>NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON}
           Anc_3.109
          Length = 978

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 6/66 (9%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF---LENSKRGGRKRIEWT 74
           +RG +AC  CR RK +C    P + +   C  C +   +C F   +E  K+   K  E+ 
Sbjct: 150 KRGTRACDYCRKRKIKCSAVDPKTKK---CPNCDKNNMKCTFKFHMELEKKKRLKDAEFY 206

Query: 75  VDGNTD 80
            DG  D
Sbjct: 207 DDGTID 212

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 994

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          ++K  R    C  CR  KTRCD         P C RCK+ + ECV+
Sbjct: 17 TRKRNRISFVCQACRRSKTRCD------KEKPICTRCKKLKLECVY 56

>YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}
          OAF3Putative transcriptional repressor with
          Zn(2)-Cys(6) finger; negatively regulates transcription
          in response to oleate levels, based on mutant phenotype
          and localization to oleate-responsive promoters; the
          authentic, non-tagged protein is detected in highly
          purified mitochondria in high-throughput studies
          Length = 863

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 9/59 (15%)

Query: 7  GNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKR--ERKECVFLENS 63
          G D +V ++K  R    C NC+ RK++CD       R  PC  C R  +   CV+L +S
Sbjct: 2  GYDSQVRTKKRHRITVVCTNCKKRKSKCD-------RTKPCGTCVRLGDVDSCVYLTDS 53

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 11/78 (14%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF----LENSKRGGRKRI 71
           K  R    C  CR RKTRCD       R  PC +C     ECV+    + N  +    ++
Sbjct: 67  KRNRVSYVCYACRRRKTRCD-------RGNPCSKCVALSTECVYSISEMNNGNKVSATQV 119

Query: 72  EWTVDGNTDVNATARFEA 89
                G    N+TA   A
Sbjct: 120 LAETSGTALPNSTADIVA 137

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 15  QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
           +KY R    C  C+ R+ +CD G       P C +C R  +ECV++  +K   R+
Sbjct: 142 RKYSR--NGCTECKRRRMKCDEG------KPTCWQCARLNRECVYIIRTKNRKRR 188

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 17  YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60
           + +    C+NC+ R+ +CD G       P C +C   + +CV+L
Sbjct: 196 HNKSKNGCVNCKRRRVKCDEGK------PTCKKCLNMKLDCVYL 233

>ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR034C (LYS14)
          Length = 800

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1   MKRLATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60
           +K+ +   D + + +KY R    C  C+ R+ +CD G       P C +C R  +EC ++
Sbjct: 176 IKKASAVGDPKRTKRKYSRN--GCTECKRRRMKCDEG------KPICWQCSRLNRECKYI 227

Query: 61  ENSKRGGR 68
            N++   R
Sbjct: 228 LNARNKKR 235

>ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain; DNA-binding
          transcriptional activator or CHA1 and to YOR337W
          uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer-mediated
          Activation Ty1 enhancer activator
          Length = 523

 Score = 38.5 bits (88), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 7/36 (19%)

Query: 23 ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECV 58
          AC NCR ++ +CDL       + PC RC R + EC+
Sbjct: 7  ACQNCRQKRKKCDL-------ELPCSRCTRLKVECI 35

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa]
          {ON} 
          Length = 909

 Score = 38.5 bits (88), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 8/50 (16%)

Query: 12 VSSQKYRRGYKA--CLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          ++ + YR+   +  CL CRS+K +CD   P       C RC++  K CV+
Sbjct: 1  MNDKNYRKARPSFVCLVCRSKKVKCDKARPS------CGRCRKTNKLCVY 44

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          K RR  +AC  CR +K +CD          PC+ C     EC + + SKR
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR 49

>ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON}
          conserved hypothetical protein
          Length = 680

 Score = 38.5 bits (88), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          K +R  +AC  CR  KTRC L P   P +  C+RC+  +  C F
Sbjct: 25 KGKRAVRACDTCRRLKTRCILSP--IPNEFYCLRCESLKIHCSF 66

>Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W
           (REAL)
          Length = 918

 Score = 38.5 bits (88), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 15/83 (18%)

Query: 17  YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR-------- 68
           + +    C NC+ R+ +CD G       P C +C   + ECV+     R GR        
Sbjct: 44  HNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECVYTPIHLRKGRGATVVKYV 97

Query: 69  -KRIEWTVDGNTDVNATARFEAE 90
            ++ + +V+ ++ VN +   + E
Sbjct: 98  TRKADGSVEPDSSVNLSTAVKKE 120

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 38.5 bits (88), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          K RR  +AC  CR +K +CD          PC+ C     EC + + SKR
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR 49

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
          conserved hypothetical protein
          Length = 955

 Score = 38.5 bits (88), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 11/71 (15%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSK--RGGRKRIEW 73
          K +R   +C+ C  RK +CD         P C  C +   EC++  N++  RGG+  I  
Sbjct: 38 KRQRQILSCVACHKRKIKCDRA------KPVCESCGKNGWECLYFLNARVSRGGKHNIS- 90

Query: 74 TVDGNTDVNAT 84
             G  DV A+
Sbjct: 91 --TGTEDVTAS 99

>KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON}
           conserved hypothetical protein
          Length = 728

 Score = 38.1 bits (87), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 57/164 (34%), Gaps = 39/164 (23%)

Query: 6   TGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
           +G+DL+   +   R    C  CR ++ +CD       + P C RCKR    C+       
Sbjct: 27  SGSDLKKKKKT--RSKSGCFTCRLKRMKCD------EQHPICGRCKRNLLTCI------- 71

Query: 66  GGRKRIEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNALEFLA 125
                  W  +GN  +    R   +D   P A               E+N     L F  
Sbjct: 72  -------WPKEGNGKLTKKMRQAMKDNVDPYA---------------EMNPKKVQLLFEI 109

Query: 126 KAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSK 169
           K  G     DS S   + ++ DK +  K    +  P   + G K
Sbjct: 110 KEDGKCQLTDSDSTSFASDKSDKVVNRKDLRNK--PQAPSKGDK 151

>Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {ON}
           YML076C (REAL)
          Length = 939

 Score = 38.1 bits (87), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 8/105 (7%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF---LENSKRGGRKRIE 72
           K +R   AC+ C S K +C+    +     PC RC + +K C F       KR  R R  
Sbjct: 67  KIKRNSFACVCCHSLKQKCEPSDTNDIYRKPCQRCLKHKKLCKFDLSKRTRKRKPRSRSP 126

Query: 73  WTVDG-NTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNS 116
            + +    +++  ++F  + +    ++LKDTTS    S  P+ NS
Sbjct: 127 TSFESPMVNISTKSKFPTDSEE---SSLKDTTSYL-TSFPPDSNS 167

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 38.1 bits (87), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 11/76 (14%)

Query: 10 LEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF-----LENSK 64
          L+  S + +R    C+ C+++K RCD         P C RC+R  ++CV+      E   
Sbjct: 17 LQQKSLRRQRRSHVCITCKNQKLRCD------RERPSCSRCRRIGRDCVYESPTPEETMT 70

Query: 65 RGGRKRIEWTVDGNTD 80
            G K +  T   +TD
Sbjct: 71 NHGNKELSVTSGISTD 86

>Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451W
           (REAL)
          Length = 888

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 72/346 (20%), Positives = 122/346 (35%), Gaps = 84/346 (24%)

Query: 6   TGNDLEVSSQKYRRGYKA------CLNCRSRKTRCDLGPPDSPRDP-PCVRCKRERKECV 58
           +G+++  S  K R G  A      C+ CR +K++CD       R P PC +C ++   C+
Sbjct: 13  SGSEMSHSENKNRAGMIARKRKFACVECRQQKSKCDA----HERAPGPCTKCAKKNVPCI 68

Query: 59  FLENSKRGGRKRIEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMH 118
              + +R  ++               AR EA +K     T +  T++    +   L  + 
Sbjct: 69  LKRDFRRTYKR---------------ARNEAIEKRFKELT-RTLTNLTSDEI---LKKIE 109

Query: 119 NALEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTY---------------HREESPNQ 163
              E +   +    ++  R R  ++E  D  I  ++Y               H + SP  
Sbjct: 110 EEQEIVLDNSNFTKEKVKRLRKSAFESTD--IESRSYRTLRGEPIAYNTNRKHTDSSPLT 167

Query: 164 HASGSKRASLATP-GKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNM 222
             S S  +    P   + E+     P S   LGDV        L+  +   L   F    
Sbjct: 168 LLSPSTNSDYVQPINVMTEEQLKCLPKS---LGDV-------YLSSSDIAELFQEFATKY 217

Query: 223 HPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWI 282
           H F P +       +     P L   IL I  R             R     ++  RL +
Sbjct: 218 HQFLPVVDLSKGAERIYHLSPCLFWVILLIGLR-------------RKFGATDLMTRLSV 264

Query: 283 YCQRLISQSVWAEA-------------STRSVGTILAFLLFTEWNP 315
             + ++S+   +               +  SV ++ AFLL+T W P
Sbjct: 265 LVKSVLSEITISPIIRYTPSDNDEPVLNVASVYSVQAFLLYTFWPP 310

>ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YKL015W (PUT3)
          Length = 835

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 7/48 (14%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          +R   ACL CR R  RC       P   PC +C      C +LE SK+
Sbjct: 55 KRAPLACLRCRRRHVRC-------PGGTPCAKCAVANIACEYLEPSKK 95

>SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON}
          conserved hypothetical protein
          Length = 1061

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 10/63 (15%)

Query: 13 SSQKYRRGYKACLNCRSRKTRCD------LGPPDSPRDPPCVRCKRERKECVFLENSKRG 66
          S  K +   +ACL CR +K +CD      LG  D      C  C     +CVF+  S RG
Sbjct: 8  SDPKRKVARRACLTCREKKIKCDGEVRASLGGSDPGI---CSNCAASGSKCVFVA-SMRG 63

Query: 67 GRK 69
          GR+
Sbjct: 64 GRR 66

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
          similar to uniprot|P35995 Saccharomyces cerevisiae
          YKL222C Hypothetical ORF and similar to uniprot|Q12340
          Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRC-KRERKECVFLE 61
          +K R+  K+CL CR RK +CD       + P C  C  R   ECV++E
Sbjct: 10 RKRRKVIKSCLFCRKRKLKCD------HKKPKCSTCAARNLPECVYVE 51

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 850

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 9/53 (16%)

Query: 7  GNDLEVSSQKYRRG--YKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          GN L+ +  K +RG  +  C  CRSRK +CDL      R P C RC++    C
Sbjct: 22 GNRLK-NGTKSKRGKTFTGCWTCRSRKVKCDL------RRPHCQRCEKSGLVC 67

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          R   AC+ CR R  +C       P   PC+RC + + +C + E S++
Sbjct: 35 RKSNACIQCRRRHVKC-------PNGNPCLRCVKSKLQCEYSEPSRK 74

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 1022

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 15/93 (16%)

Query: 1  MKRLATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60
          MK +  G+  ++S ++ R  +  C  CR  KT+CD         P C RC +    CV+ 
Sbjct: 1  MKYVDEGDSSDISKKRNRLSF-VCQGCRKAKTKCD------KEKPACSRCLKHGIRCVYD 53

Query: 61 ENSKRGGRKRIEWTVDGNTDVNATARFEAEDKY 93
            S++  +       + N D    AR E E  Y
Sbjct: 54 LTSQKAPK-------NPNKDA-MIARLEKELSY 78

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query: 12 VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
           S ++  +  +AC  CR +KTRCD     S   P C  C+R  K C F
Sbjct: 23 ASDRRRSKTSRACDQCREKKTRCDF----SDERPICSACQRMGKTCTF 66

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 15  QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70
           +K +R   AC++C + K +C     D     PC RC R +K C F + SKR  +++
Sbjct: 58  EKRKRNTFACISCHASKQKCVPSDLDDIFLKPCQRCFRSKKICAF-DLSKRTRKRK 112

>KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa]
          {ON} 
          Length = 847

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 7/54 (12%)

Query: 10 LEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENS 63
          +E   +K R  Y  C+ CR++K +CD       + P C RC + +++CV+  NS
Sbjct: 2  IEKDFRKIRPSY-VCVTCRTQKLKCD------KQRPSCGRCLKNKRKCVYEINS 48

>TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWT 74
          Q   R    CL+CR R+ +CD       R P C  C R   EC++     R G++R+  +
Sbjct: 14 QTKGRSNTGCLSCRRRRKKCD------ERRPSCKACARNFLECIW---PHRSGKQRLNIS 64

Query: 75 VDGN 78
          +  N
Sbjct: 65 LSKN 68

>KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa]
          {ON} Anc_7.512 YLR451W
          Length = 846

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 6  TGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDP-PCVRCKRERKECVFLENSK 64
          T +++ V++   R+   AC+ CR +K++CD       R P PC +C ++   CV  ++ +
Sbjct: 21 TSSNMSVANTAARKRKFACVECRQQKSKCDA----HERAPEPCSKCAKKGVPCVLKKDFR 76

Query: 65 R 65
          R
Sbjct: 77 R 77

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          SQK +R    C+ C+S+K RC+         P C RC+R  K C
Sbjct: 25 SQKSKRTVSVCIPCKSQKLRCNKA------RPICSRCQRLGKHC 62

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          K RR  +AC  CR +K +CD          PC+ C     EC + + SKR
Sbjct: 10 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR 52

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 6/35 (17%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKR 52
          R+ +  C  CRSRK +CDL        P C RC R
Sbjct: 11 RKSFNGCWTCRSRKVKCDLNR------PKCQRCDR 39

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 11 EVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          ++   K RR  +AC  CR +K +CD          PC+ C     EC + + +KR
Sbjct: 7  QILQNKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKR 54

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 3/50 (6%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGG 67
           +R  KAC  CR RK +CD       R   C  C +   EC F   +KR G
Sbjct: 97  KRASKACDLCRRRKIKCDAF---DDRLKKCSNCIKYHSECTFSNQNKRKG 143

>YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}
          YRM1Zn2-Cys6 zinc-finger transcription factor that
          activates genes involved in multidrug resistance;
          paralog of Yrr1p, acting on an overlapping set of
          target genes
          Length = 786

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCK-RERKECVFLE 61
          +QK R+  K+C  CR RK RCD       + P C  CK R R  C++ E
Sbjct: 21 AQKRRKPIKSCAFCRKRKLRCD------QQKPMCSTCKTRGRSGCLYTE 63

>YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON}
          CHA4DNA binding transcriptional activator, mediates
          serine/threonine activation of the catabolic L-serine
          (L-threonine) deaminase (CHA1); Zinc-finger protein
          with Zn[2]-Cys[6] fungal-type binuclear cluster domain
          Length = 648

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1  MKRLATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60
          +K+  T ND + ++   R+   AC NCR R+ +C++       + PC  C + R ECVF 
Sbjct: 22 LKKSVTDND-QNNNNVPRKRKLACQNCRRRRRKCNM-------EKPCSNCIKFRTECVFT 73

Query: 61 ENSKRGGR 68
          +   R  R
Sbjct: 74 QQDLRNKR 81

>TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON} 
          Length = 873

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 4  LATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENS 63
          +  G++   SS   +R   AC+ CR +K++CD     +P   PC +C ++   CV  ++ 
Sbjct: 12 MIAGHEARRSSAIDKRKKFACVECRQQKSKCD-ALEKAPE--PCTKCSKKGVSCVLQKDY 68

Query: 64 KR 65
          +R
Sbjct: 69 RR 70

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
          Anc_7.17 YAL051W
          Length = 944

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 6/52 (11%)

Query: 8  NDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          ND +V+ +K  R    C  CR  K +CD         P C RC +   ECV+
Sbjct: 24 NDSQVTKKKRYRLSFVCQGCRRSKVKCD------QEKPVCSRCSKHDLECVY 69

>ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR337W (TEA1)
          Length = 701

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 15/88 (17%)

Query: 23  ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDGNTDVN 82
           AC NCR R+ +CDL       + PC  C R + EC   +   R  R  I +  +  T V 
Sbjct: 46  ACTNCRRRRKKCDL-------NYPCSSCLRLKLECNVNDEDLRKKRYSITYVKNLETQV- 97

Query: 83  ATARFEAEDKYIPVATLKDTTSIKEGSL 110
             A  E++     V  L DT ++++  L
Sbjct: 98  --AFLESK-----VRELADTVALRDRGL 118

>Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172W
          (REAL)
          Length = 790

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCK-RERKECVFLE 61
          +K R+  K+C  CR RK RCD       + P C  CK R R +C++ E
Sbjct: 22 RKRRKPIKSCAFCRKRKLRCD------QQKPVCSTCKARRRTDCLYTE 63

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
          Ashbya gossypii AAL175W
          Length = 908

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 6/51 (11%)

Query: 7  GNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          GN +  + +   + +  C  CR RK +CDLG P+      C RC++    C
Sbjct: 29 GNGVCTARRPRAKTFTGCWTCRIRKVKCDLGKPN------CQRCEKSGLSC 73

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR 68
          R+   AC +CR R+ +CD+       + PC  C + + +CVF +   R  R
Sbjct: 38 RKRKLACQSCRRRRRKCDM-------EKPCSNCIKFQTDCVFAQQDLRNKR 81

>SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} similar
           to uniprot|P08638 Saccharomyces cerevisiae YLR451W LEU3
           Zinc-finger transcription factor that regulates genes
           involved in branched chain amino acid biosynthesis and
           ammonia assimilation positively regulated by
           alpha-isopropylmalate an intermediate in leucine
           biosynthesis
          Length = 964

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 120/327 (36%), Gaps = 68/327 (20%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDP-PCVRCKRERKECVFLENSKRGGRKRIEWT 74
           K RR   AC+ CR +K++CD       R P  C RC ++   CV     +RG R+  +  
Sbjct: 29  KGRRKKLACVECRQQKSKCDA----YERSPESCTRCAKKNVPCVL----QRGFRRTYK-- 78

Query: 75  VDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHN--ALEFLAKAAGSAA 132
                     AR E  +K             KE  LT  L+S+ +  A E L K    A 
Sbjct: 79  ---------RARNEVLEK-----------RFKE--LTKSLSSLSDVGAKEILKKI--EAE 114

Query: 133 KEDSRSRIPSYERQDKTIREKT-YHREESPNQHASGSKRASL-ATPGKLIEKLSDW---- 186
           +E         + + K +RE      + +PN    GS  +S   TP   +   S +    
Sbjct: 115 QEALLDNSNFTKEKVKQLRESGRIDLDSTPNSSIPGSNNSSSNGTPVPNVTSASAFTTFT 174

Query: 187 ---------KPGSLYD---------LGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPY 228
                    +P  L D         LGD+        +  +E + L   F    HPF P 
Sbjct: 175 ASKDTFSIDQPVDLTDEQLKCSSKSLGDI-------YMASEEISALFKEFSTKYHPFLPI 227

Query: 229 IPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLI 288
           +       +     P L   I+ I  R    A   +++     +++     +    +   
Sbjct: 228 VDITKGPERIYSLSPCLFWVIILIGLRRKVGAIELMTKLSTLVKSVLAEITISPIIRYAP 287

Query: 289 SQSVWAEASTRSVGTILAFLLFTEWNP 315
           ++S     +  SV ++ AFLL+T W P
Sbjct: 288 TESDEPVLNVASVYSVQAFLLYTFWPP 314

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 6/41 (14%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          R  K CL CR RK +CD       + P C+RC +    C +
Sbjct: 10 RPSKVCLTCRRRKVKCD------QQHPSCMRCIKSSTLCTY 44

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 7/42 (16%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          RR  KAC  CR  KT+CD        + PC RC +E K C +
Sbjct: 16 RRVSKACDACRKSKTKCD-------GERPCSRCLKENKLCTY 50

>KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa]
          {ON} 
          Length = 841

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 12 VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCK-RERKECVFLENSKRG 66
          V+ Q+ R+  K+CL CR RK +CD         P C  CK R +  C++ ++   G
Sbjct: 8  VAKQRRRKRVKSCLFCRHRKLKCDQAV------PLCSSCKVRNKTVCIYADSPDDG 57

>Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar to
          Ashbya gossypii ACL096W
          Length = 847

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 7/51 (13%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          ++ +R   ACL CR R  RC       P   PC +C      C +LE SK+
Sbjct: 48 ERKKRAPLACLRCRKRHVRC-------PGGNPCSKCVSANIACEYLEPSKK 91

>KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {ON}
           Anc_1.199 YKR064W
          Length = 862

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 52/136 (38%), Gaps = 18/136 (13%)

Query: 14  SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKR-ERKECVFLENSKRGGRKRIE 72
           +++ +RG   C NCR RK+RCD       R  PC  C R    E    EN        I 
Sbjct: 8   ARRRKRGTVVCTNCRKRKSRCD-------RQLPCNTCMRLGNSETCEYENKLNPNTSSIR 60

Query: 73  WTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLT-----PELNSMHNALEFLAKA 127
            +     +     R + +DK+IP      ++   + S +     P  +  H+  E++   
Sbjct: 61  VSFAPKIE-----RVKKQDKFIPSTLFGSSSKYVKVSDSVVQPAPSKDFYHDIPEYINLI 115

Query: 128 AGSAAKEDSRSRIPSY 143
                 E  RS I  +
Sbjct: 116 PSGDYIETKRSAISQF 131

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON}
          Anc_8.879 YML099C
          Length = 1132

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 29/74 (39%), Gaps = 13/74 (17%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDGN 78
          R Y  C  CRSRK +CD       + P C RC +   +C        G   R+ W     
Sbjct: 11 RTYSGCWTCRSRKIKCD------QQKPQCKRCLKANLKC-------EGYNIRLTWCDLAK 57

Query: 79 TDVNATARFEAEDK 92
           D+       A+DK
Sbjct: 58 YDIYGDLIESADDK 71

>KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON}
          Anc_8.423 YLR228C
          Length = 864

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 17 YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60
          + +    CLNC+ R+ +CD         P C++C   + +CV++
Sbjct: 48 HNKSKTGCLNCKRRRVKCD------ETKPFCIKCTNMKLDCVYV 85

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 4/71 (5%)

Query: 1   MKRLATGNDLEVSSQKYR-RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
           M      NDL  S +  + R  KAC +CR RK RCD   P + +   C  C + +  C F
Sbjct: 112 MVESTNSNDLGASGKNSKKRVSKACDHCRKRKIRCDEVDPQTDK---CSNCVKFQSVCTF 168

Query: 60  LENSKRGGRKR 70
               +   +KR
Sbjct: 169 KHRDEILQKKR 179

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLE 61
          ++  KACLNCR RK +C           PC  C   + ECVF E
Sbjct: 11 KKVVKACLNCRRRKIKC-------TGTFPCSNCAAYQCECVFDE 47

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 7/51 (13%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRG 66
          K RR  +AC  CR +K +CD          PC+ C     EC +   SKR 
Sbjct: 29 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNHPSKRS 72

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
          weakly similar to uniprot|P25611 Saccharomyces
          cerevisiae YCR106W RDS1 Regulator of drug sensitivity
          transcriptional regulator
          Length = 934

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 9/67 (13%)

Query: 12 VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
          +  QK  R    C  CR RK +CD       + P C RC      C +L +   G R   
Sbjct: 7  IKIQKRNRPSFVCQECRRRKIKCD------KKRPRCSRCVDTGLPCTYLAS---GSRSAA 57

Query: 72 EWTVDGN 78
          +W + G+
Sbjct: 58 DWHISGD 64

>Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa]
          {ON} YML076C (WAR1) - ORF [contig 219] FULL
          Length = 743

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 13 SSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          S+ + +R   AC NC ++K++C           PCVRC++  K C F
Sbjct: 49 SAGRPKRNTFACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLCTF 95

>Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 15  QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
           +KY R    C  C+ R+ +CD         P C +C R  +ECV++ N K   R+
Sbjct: 146 RKYSRN--GCSECKRRRMKCD------ETKPTCWQCARLNRECVYVLNPKNKKRR 192

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 7/51 (13%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR 68
          +R   AC NCR R+ +CDL         PC  C R R +C   E   R  R
Sbjct: 53 KRKRLACTNCRKRRKKCDLS-------YPCASCVRLRIDCNVNEEDLRKKR 96

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1270

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 4   LATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
           + +G D   S+  YR   +AC  CRS+KTRCD       + P C +C     EC
Sbjct: 72  VTSGADTPASASNYRVA-QACDRCRSKKTRCD------GKRPQCSQCAAVGFEC 118

>NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON}
          Anc_7.512 YLR451W
          Length = 823

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 4/52 (7%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
          RR Y AC+ CR +K++CD          PC +C ++R  CV  ++ +R  ++
Sbjct: 23 RRKY-ACVECRQQKSKCD---AHETMPNPCSKCAKKRVPCVLKKDFRRTYKR 70

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 41/99 (41%), Gaps = 14/99 (14%)

Query: 7   GNDLEVSSQKYRR--GYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENS- 63
            N+   SS   RR    +AC  CR +K +CD G   S     C  C+R  ++C F     
Sbjct: 44  ANNASRSSSNKRRTKASRACDQCRKKKVKCDNGDDRS----VCTNCQRNGEKCTFERVPL 99

Query: 64  KRGGRKRIEWTVDGNTDVNATA-------RFEAEDKYIP 95
           KRG  K    +     D+N  +       R   E+KY P
Sbjct: 100 KRGPSKGYSKSGHKGKDINNKSPDDIRMRRESFENKYSP 138

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 8/58 (13%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR-GGRKRIE 72
          K RR  +AC  CR +K +CD          PC+ C     EC + + ++R GG K  E
Sbjct: 14 KRRRITRACDECRKKKVKCD-------NRHPCIHCTVYSYECTYNQPARRTGGNKNSE 64

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          S K RR  +AC  CR +K +CD          PC+ C     EC + + +KR
Sbjct: 11 SVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKR 55

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          S K RR  +AC  CR +K +CD          PC+ C     EC + + +KR
Sbjct: 11 SVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKR 55

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          S K RR  +AC  CR +K +CD          PC+ C     EC + + +KR
Sbjct: 11 SVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKR 55

>Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [contig
           219] FULL
          Length = 669

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 90/250 (36%), Gaps = 37/250 (14%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDG 77
           R+  K C NC+  K +C+          PC RC R   +C +L               DG
Sbjct: 7   RKRTKPCSNCKKNKVKCEYL-----SSLPCQRCARHSLKCYYL---------------DG 46

Query: 78  NTDVNATARFEAEDKYIPVATLKDTTSIKEG---SLTPELNSMHNALEFLAKAAGSAAKE 134
               NA A    E     V  +  ++S   G   S+   LN+  +ALE +     S   +
Sbjct: 47  RPPRNAEASSSLETNPNTVEAILPSSSEPFGWSNSVDVRLNTHESALESVLSILKSNQIQ 106

Query: 135 DSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLIEKLSDWKPGSLYDL 194
             +             R K Y   E  N   +      L+   +  E L   K   + D 
Sbjct: 107 QQQQ------INLLQQRIKQYSSAEL-NPRVTLPSMKELSFQAQEHEALKVQKSSEVRDF 159

Query: 195 GDVEYIGGHKLLTEKEATRLIDLFFLNMHP-FFPYIPFQLRCSQELKRYPILLCAILTIS 253
              E      +L+ +EA  L+++F     P  F Y    L+     +  P+LL +I T++
Sbjct: 160 RTAE------VLSLQEAEALVNIFAEKFAPRLFGYDIGLLKVQDLWQESPLLLVSICTVA 213

Query: 254 ARYHNFAEHK 263
             +H +   K
Sbjct: 214 CAHHAYLGSK 223

>NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}
          Anc_7.512
          Length = 906

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 8/59 (13%)

Query: 13 SSQKYRRGYKACLNCRSRKTRCDL--GPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
          ++ K +R + AC+ CR +K++CD     PD     PC +C+++   CV  ++ +R  ++
Sbjct: 36 TNHKRKRKF-ACVECRQQKSKCDAYEKAPD-----PCTKCQKKGVPCVLKKDFRRTYKR 88

>Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172W
          (REAL)
          Length = 784

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCK-RERKECVFLE 61
          +QK R+  ++C  CR RK RCD       + P C  CK + R +C++ E
Sbjct: 21 TQKRRKPIRSCAFCRKRKLRCD------RQKPICSTCKTKGRSDCIYTE 63

>NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON}
           Anc_3.264
          Length = 741

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 12  VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70
           +  +KY R    C  C+ R+ +CD         P C +C R  +ECV++   K G +KR
Sbjct: 122 IVKRKYSRN--GCAECKRRRMKCD------ETKPICWQCARLSRECVYI--VKSGNKKR 170

>ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON}
          weakly similar to uniprot|Q12172 Saccharomyces
          cerevisiae YOR162C YRR1 Zn2-Cys6 zinc-finger
          transcription factor that activates genes involved in
          multidrug resistance paralog of Yrm1p acting on an
          overlapping set of target genes
          Length = 921

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 7/50 (14%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRC-KRERKECVFLENS 63
          +K  +  K+C  CR RK RCD       + P C  C  RE  ECV++E+S
Sbjct: 44 KKRMKPIKSCTFCRRRKLRCD------QQKPMCSTCIARELPECVYMESS 87

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
          (PIP2) - activator of peroxisome proliferation [contig
          46] FULL
          Length = 838

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 7/59 (11%)

Query: 11 EVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
          E    + R+ +  C NC+ RK +CD   P       C RC +   ECV+     + GR+
Sbjct: 18 EFKKSRMRQSF-VCRNCKKRKIKCDKARPS------CGRCSKLELECVYDFQENKDGRR 69

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa]
          {ON} Anc_1.128 YJL206C
          Length = 658

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 8/63 (12%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDGN 78
          R +KAC+ CR +K RCD          PC  C R    C +  N+ R     I +  D +
Sbjct: 27 RVFKACIACRKKKRRCD-------GKSPCSHCARTSIICEY-TNTARPRSHSIAFANDVS 78

Query: 79 TDV 81
           D+
Sbjct: 79 NDI 81

>Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W
          (REAL)
          Length = 470

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 7/50 (14%)

Query: 22 KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
          ++C  CR R+ +CD       R+ PC RC +   +C +L+  K+ G K I
Sbjct: 6  QSCDCCRVRRVKCD-------RNKPCNRCLQRHLKCTYLQPLKKRGPKSI 48

>TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.61
          YOR172W
          Length = 878

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 7  GNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRC-KRERKECVFLENSKR 65
          GN+     +K R   K C  CR RK +CD       R P C  C  R   ECV+++ +  
Sbjct: 9  GNENPPLKKKRRTIIKTCTFCRKRKLKCD------KRKPRCSSCVTRNLPECVYIDGTGS 62

Query: 66 GG 67
          G 
Sbjct: 63 GA 64

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981
          aa] {ON} YKL015W (REAL)
          Length = 981

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 12 VSSQKYRRGYK---ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          V+ Q+ RR  +   ACL+CR R  +C       P   PC +C      C +LE SK+
Sbjct: 19 VNKQRQRRQPRSAVACLSCRKRHIKC-------PGGSPCQKCITSNAICEYLEPSKK 68

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 7/51 (13%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRG 66
          K RR  +AC  CR +K +CD          PC+ C     EC + + +KR 
Sbjct: 31 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRS 74

>SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]
          {ON} similar to gnl|GLV|KLLA0A04169g Kluyveromyces
          lactis KLLA0A04169g and some similarites with YDR213W
          uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
          involved in sterol uptake zinc finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 754

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 6/59 (10%)

Query: 17 YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75
          + +    C NC+ R+ +CD G       P C +C   + ECV+   ++R  R   E  V
Sbjct: 47 HNKSKNGCDNCKRRRVKCDEG------KPCCQKCINMKLECVYTPITQRKKRLNGETVV 99

>KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]
          {ON} weakly similar to uniprot|P26370 Saccharomyces
          cerevisiae YDL170W
          Length = 681

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 6/48 (12%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLEN 62
          ++ R   K CL C+ RK RC      S   P C  C R   +CVF +N
Sbjct: 11 KRRRHSKKGCLTCKVRKKRC------SEDRPICKDCARLSLDCVFPDN 52

>AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR228C (ECM22) and
           YDR213W (UPC2)
          Length = 866

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 11/67 (16%)

Query: 17  YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR-----I 71
           + +    C NC+ R+ +CD G P       C +C + R  CV+     R  + R     I
Sbjct: 82  HNKSKNGCDNCKRRRVKCDEGKPG------CQKCLKMRLSCVYTPAKPRKKKDRDVETVI 135

Query: 72  EWTVDGN 78
           ++   GN
Sbjct: 136 KYVTRGN 142

>ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKR064W
          Length = 795

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 9/56 (16%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKR--ERKEC-VFLENSKRGG 67
          +K +R    C NC+ RK+RCD G       P C  C R   R+ C  F+  S++GG
Sbjct: 5  KKRQRQTLVCSNCKRRKSRCDRG------KPACGNCIRLGNRETCHYFISPSEKGG 54

>Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar to
          Ashbya gossypii ABR174W
          Length = 884

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDP-PCVRCKRERKECVFLENSKRGGRK 69
          +K +R   AC+ CR +K++CD       R P PC RC ++   CV   + +R  ++
Sbjct: 30 RKQKRKKFACVECRQQKSKCDAH----DRAPEPCTRCFKKNVPCVLQRDFRRTYKR 81

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          R Y  C  CR+RK +CD       + P C RCK+   EC
Sbjct: 15 RSYSGCWTCRARKVKCDT------QRPKCCRCKQLGIEC 47

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          S K RR  +AC  CR +K +CD          PC+ C     EC + + +KR
Sbjct: 11 SVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKR 55

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
          PUT3Transcriptional activator of proline utilization
          genes, constitutively binds PUT1 and PUT2 promoter
          sequences as a dimer and undergoes a conformational
          change to form the active state; differentially
          phosphorylated in the presence of different nitrogen
          sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          ++ +R   ACL+CR R  +C       P   PC +C      C +LE SK+
Sbjct: 25 KRQQRSSVACLSCRKRHIKC-------PGGNPCQKCVTSNAICEYLEPSKK 68

>Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}
          YBR297W (REAL)
          Length = 463

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 22 KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
          +AC  CR R+ +CD        D PC RC +   +C +L+  K+ G K I
Sbjct: 6  QACDCCRVRRVKCD-------GDKPCNRCLQHDLKCTYLQPLKKRGPKNI 48

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 10/59 (16%)

Query: 7   GNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
           GN +++   K RR  +AC  CR +K +CD          PC+ C     EC + + S R
Sbjct: 52  GNPIQL---KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSTR 100

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON}
          conserved hypothetical protein
          Length = 639

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 6/57 (10%)

Query: 12 VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR 68
          +  +K  R Y  C  C+S K +CD         P C  CK+   +C +    K GGR
Sbjct: 5  IEMKKVARSYMGCQKCKSLKKKCD------EVKPHCGYCKKRGFQCDYSRTLKWGGR 55

>KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON}
           conserved hypothetical protein
          Length = 597

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 42/96 (43%), Gaps = 10/96 (10%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSK-RGGR--KRIEWT 74
           +R    CL CR RK +CD         P C  CKR   EC++  +S  + G+  K+I   
Sbjct: 5   KRSSTGCLICRRRKKKCD------EVKPTCTACKRNFLECIWPNSSNTKDGKVGKKISQV 58

Query: 75  VDGNTDVNAT-ARFEAEDKYIPVATLKDTTSIKEGS 109
              +T  N T  + +   KY   + L+    +K  S
Sbjct: 59  ESEDTKFNITHLKLKHRIKYTRTSDLRMEVYVKRRS 94

>Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON}
          YDR034C (LYS14) - transcription factor involved in
          lysine biosynthesis [contig 358] FULL
          Length = 598

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 12 VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRC-KRERKECVFLENSKRGGR 68
          + S K +R    C+NC+  K +CD       + P C +C K+ R +C +    + GGR
Sbjct: 2  IMSTKNQRSRGGCINCKKSKIKCD------EKKPMCGQCAKKGRDDCAYALVLQWGGR 53

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 12 VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          V   K  + +  C  CRSRK +CDL  P+      C RC++   +C
Sbjct: 16 VQKGKRAKTFTGCWTCRSRKVKCDLQRPN------CGRCEKSGLDC 55

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 838

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          RR   AC+ CR +  +C       P   PC +C   R  C +LE +K+
Sbjct: 36 RRSTLACVRCRRKHVKC-------PGGDPCSKCSAARIACEYLEPNKK 76

>YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON}
           WAR1Homodimeric Zn2Cys6 zinc finger transcription
           factor; binds to a weak acid response element to induce
           transcription of PDR12 and FUN34, encoding an acid
           transporter and a putative ammonia transporter,
           respectively
          Length = 944

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 3   RLATGNDLEVSSQ-KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLE 61
           RL+    LE + + K +R   AC+ C S K +C+    +     PC RC + +K C F +
Sbjct: 54  RLSYPTKLETTEKGKTKRNSFACVCCHSLKQKCEPSDVNDIYRKPCRRCLKHKKLCKF-D 112

Query: 62  NSKRGGRKR 70
            SKR  +++
Sbjct: 113 LSKRTRKRK 121

>KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserved
           hypothetical protein
          Length = 1004

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 8/51 (15%)

Query: 11  EVSSQKYRRGY--KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
           ++S++K +  Y  K CL C+   T+CD       R P C RC++   +C +
Sbjct: 56  KLSTKKRKSTYSRKGCLQCKKAHTKCD------ERKPKCSRCEKRSIDCTY 100

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 7/52 (13%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGG 67
          K RR  +AC  CR +K +CD          PC+ C      C + + SKR  
Sbjct: 28 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYNCTYNQPSKRSN 72

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa]
          {ON} similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206C and some similarities with YIL130W
          uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
          Proposed transcriptional activator member of the Gal4p
          family of zinc cluster proteins
          Length = 650

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query: 6  TGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          + N LE    K +    AC +C+ RK RCD          PC  C   R +C ++ N K 
Sbjct: 21 STNQLEPVRHKVKH---ACSSCKERKVRCD-------GQSPCASCINARVKCEYVMNMKP 70

Query: 66 GGRKR 70
            +KR
Sbjct: 71 LKKKR 75

>KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}
          Anc_7.56 YOR337W
          Length = 710

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 7/46 (15%)

Query: 23 ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR 68
          +C NCR R+ +CDLG        PC  C R   EC   E+  R  R
Sbjct: 39 SCSNCRKRRKKCDLG-------FPCGNCTRLEIECNVNEDDLRKKR 77

>YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative
          maltose-responsive transcription factor
          Length = 470

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 7/50 (14%)

Query: 22 KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
          ++C  CR R+ +CD       R+ PC RC++    C +L+  ++ G K I
Sbjct: 6  QSCDCCRVRRVKCD-------RNRPCDRCRQRNLRCTYLQPLRKRGPKSI 48

>Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W
           (REAL)
          Length = 918

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 58/137 (42%), Gaps = 17/137 (12%)

Query: 17  YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVD 76
           + +    C NC+ R+ +CD G       P C +C   + EC++     R GR        
Sbjct: 44  HNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHLRKGR-------- 89

Query: 77  GNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNALEFLAKAAGSAAKEDS 136
           G T V    R +A+    P +++   T +K+   TP  N + +A++    +  S     S
Sbjct: 90  GATVVKYVTR-KADGSVEPESSVDLPTVVKK-EQTP-FNDVSSAIKASGSSNDSYPSSAS 146

Query: 137 RSRIPSYERQDKTIREK 153
            ++  S E+    I +K
Sbjct: 147 TTKSESEEKSSAPIEDK 163

>Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON}
          (38439..41270) [2832 nt, 944 aa]
          Length = 943

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 6/41 (14%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          R  + C+ C+ RK RCD       + P C RCKR    C +
Sbjct: 10 RPSRVCVQCKKRKLRCD------RQRPTCTRCKRSSTICTY 44

>Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar to
           Ashbya gossypii ABL099W
          Length = 770

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 6/52 (11%)

Query: 9   DLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60
           D  V S K +     C  C+ R+ +CD G       P C +C R  + CV++
Sbjct: 135 DASVKSGKRKYSRNGCTECKRRRMKCDEG------KPVCWQCSRLNRSCVYI 180

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 8/53 (15%)

Query: 19  RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF-LENSKRGGRKR 70
           R  KAC  C+ RK +CD        + PC+ C + +KEC +  + + R  R+R
Sbjct: 82  RVQKACELCKKRKVKCD-------GNNPCLNCSKHQKECRYDFKATNRKRRRR 127

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query: 13  SSQKYR-RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
           SSQK R +  +AC  CR +K +CD     S     C  C+R  ++C F
Sbjct: 63  SSQKKRTKASRACDQCRKKKIKCDF----SEEKTLCSNCQRNGEKCTF 106

>Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}
          similar to Ashbya gossypii AER153W
          Length = 822

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 13 SSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          S+ K +R   AC +C + K RC     +     PC RC + +K CVF
Sbjct: 32 SNGKPKRNTFACSSCHAVKQRCIPTDANDIYRKPCTRCLKFKKLCVF 78

>KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {ON}
           Anc_8.423 YLR228C
          Length = 1013

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 17  YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENS 63
           + +    C+NC+ R+ +CD G       P C +C      CV++  S
Sbjct: 90  HNKSKTGCINCKKRRVKCDEG------KPACKKCTNMSLSCVYISAS 130

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
          similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 880

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 13 SSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          + ++Y+  +  C  CR  KT+CD       + P C RC+R  K C++
Sbjct: 11 AKKRYKLSF-VCQLCRKSKTKCD------RKKPSCARCQRLNKPCIY 50

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976
          aa] {ON} YKL015W (REAL)
          Length = 976

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          +R   ACL+CR R  +C       P   PC +C      C +LE SK+
Sbjct: 28 QRSSIACLSCRKRHIKC-------PGGNPCQKCVASNAICEYLEPSKK 68

>KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserved
          hypothetical protein
          Length = 631

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70
          K +R    CL CR+R+ +CD         P C  C+R   +C + +++  GGR R
Sbjct: 6  KRKRSVHGCLTCRTRRKKCD------ENKPVCGGCERNFVQCTWPQHT--GGRVR 52

>KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}
          Anc_4.344 YML076C
          Length = 936

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70
          K +R   AC+ C S K +C     +     PC RC R++  C F + SKR  +KR
Sbjct: 46 KTKRHAFACVRCHSLKQKCVPSDSNDIYRKPCQRCLRQKIVCKF-DLSKRIRKKR 99

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985
          aa] {ON} YKL015W (REAL)
          Length = 985

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 7/51 (13%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          +K  R   ACL+CR R  +C       P   PC +C      C +LE SK+
Sbjct: 25 RKQPRSAVACLSCRKRHIKC-------PGGNPCQKCITSNAICEYLEPSKK 68

>NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.344
           YML076C
          Length = 989

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 3   RLATGNDLEVSSQ-KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLE 61
           R +T + +E +   K +R   AC+ C S K +C     +     PC RC R  K C F +
Sbjct: 64  RHSTPSKMETTENGKIKRNTFACVRCHSLKQKCVPSDTNDIYRRPCERCLRTGKLCKF-D 122

Query: 62  NSKRGGRKRIE 72
            SKR  ++R++
Sbjct: 123 LSKRTRKRRLK 133

>YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}
           LYS14Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway; requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 790

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 15  QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
           +KY R    C  C+ R+ +CD         P C +C R  ++CV++ N K   R+
Sbjct: 152 RKYSRN--GCSECKRRRMKCD------ETKPTCWQCARLNRQCVYVLNPKNKKRR 198

>NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}
          Anc_7.512
          Length = 944

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 7/49 (14%)

Query: 23 ACLNCRSRKTRCDL--GPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
          AC+ CR +K++CD     PD     PC +C+++   CV  ++ +R  ++
Sbjct: 47 ACVECRQQKSKCDAYDKAPD-----PCTKCQKKGVPCVLKKDFRRTYKR 90

>TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {ON}
           Anc_3.264 YDR034C
          Length = 825

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 8/58 (13%)

Query: 11  EVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR 68
           +V  +KY R    C  C+ R+ +CD         P C +C R  + C+++ N K   R
Sbjct: 152 KVIKRKYSRN--GCTECKKRRMKCD------ETKPICWQCSRLNRSCIYILNPKNKKR 201

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          + +  C  CR+RK +CDL        P C RC+R   +C
Sbjct: 17 KTFTGCWTCRARKVKCDL------TRPSCTRCERSGLKC 49

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          K RR  +AC  CR +K +CD          PC+ C     EC + + ++R
Sbjct: 6  KRRRVTRACDECRKKKVKCD-------GKQPCIHCTVYNYECTYNQPTRR 48

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
          (REAL)
          Length = 894

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 7/41 (17%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          R  KAC  C+ RK +CD        + PC+ C + +KEC +
Sbjct: 27 RVQKACELCKKRKVKCD-------GNKPCLNCSKHQKECRY 60

>Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W
          (REAL)
          Length = 913

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 6/52 (11%)

Query: 17 YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR 68
          + +    C NC+ R+ +CD G       P C +C   + EC++     R GR
Sbjct: 44 HNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHLRKGR 89

>TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON}
          Anc_8.423 YLR228C
          Length = 973

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 17 YRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          + +    C NC+ R+ +CD         P CV+C   + +CV+
Sbjct: 45 HNKSKNGCDNCKRRRVKCD------EAKPACVKCSNMKLDCVY 81

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 7/38 (18%)

Query: 22 KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          KAC NCR RK +C         + PC  CK    EC+F
Sbjct: 15 KACDNCRRRKIKC-------SGERPCAGCKTYNCECIF 45

>Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 36.2 bits (82), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 6/39 (15%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          + +  C  CR RK +CDL      R P C RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
           {ON} YAL051W (REAL)
          Length = 1000

 Score = 36.2 bits (82), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 61/155 (39%), Gaps = 31/155 (20%)

Query: 14  SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEW 73
           S+K  R    C  CR  KT+CD         P C RC ++   C++  +  R    R   
Sbjct: 15  SRKRNRLSFVCQACRKAKTKCD------QEKPRCGRCTKQNLFCIY--DVARQAAPR--- 63

Query: 74  TVDGNTDVNAT-ARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNAL----EFLAKAA 128
               N + +AT AR + E +Y    T+          LT E    + AL    E LAK  
Sbjct: 64  ----NPNKDATIARLKKEIRYWRNKTV---------DLTQEKKDFYTALKRPTEALAKNT 110

Query: 129 GSAAKEDSRSRIPS--YERQDKTIREKTYHREESP 161
              +K   ++  P   Y+   + I  K   RE +P
Sbjct: 111 RKTSKSSQKNNFPISLYKTHPRLIMTKVMKREVNP 145

>Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 36.2 bits (82), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 15  QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
           +KY R    C  C+ R+ +CD         P C +C R  ++CV++ N K   R+
Sbjct: 146 RKYSRN--GCSECKRRRMKCD------ETKPTCWQCARLNRQCVYVLNPKNKKRR 192

>KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON}
          similar to uniprot|P53749 Saccharomyces cerevisiae
          YNR063W Hypothetical ORF
          Length = 591

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 23 ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
          ACL C+ RK +CD          PC RC +   +C++  + ++  RK
Sbjct: 2  ACLECKKRKQKCD-------GQKPCRRCTKLNVKCIYGTDRRKDKRK 41

>Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343
          bp, 780 aa] {ON}
          (9848..11548,11550..11612,11615..12193) [2343 nt, 781
          aa]
          Length = 780

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 11/66 (16%)

Query: 1  MKRLATGNDLEVSS----QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRC-KRERK 55
          ++ +   ND  V+     ++ R+  K+C  CR RK +CD G       P C +C  RE  
Sbjct: 9  IEYIVNANDSSVTDGCGKKRRRKVIKSCTFCRKRKLKCDHG------RPMCNQCSSRELP 62

Query: 56 ECVFLE 61
          EC++ E
Sbjct: 63 ECIYTE 68

>CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON}
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064w
          Length = 891

 Score = 36.2 bits (82), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 9/56 (16%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKR--ERKECVFLENSKRGGRKRI 71
          RR    C+NCR RK++CD       R  PC +C +  +   C +L +   G +  +
Sbjct: 12 RRPMLVCVNCRKRKSKCD-------RQLPCSKCIQHGDTDTCTYLNDVPIGKKNNV 60

>NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON}
          Anc_7.512 YLR451W
          Length = 809

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
          RR Y AC+ CR +K++CD     +P   PC +C R+   C+  ++ +R  ++
Sbjct: 14 RRKY-ACVECRQQKSKCD-ANDKAPN--PCSKCARKGVPCILKKDFRRTYKR 61

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911
          aa] {ON} YMR019W (REAL)
          Length = 911

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF-LENSKRGGRKRIEWTVDG 77
          R  KAC  C+ RK +CD        + PC+ C + +KEC +  + + R  ++R   ++  
Sbjct: 41 RVQKACEICKRRKVKCD-------GNRPCLNCSKHKKECRYDFKATNRRKKRRQATSLIQ 93

Query: 78 NTD 80
          N D
Sbjct: 94 NVD 96

>TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447
           bp, 1148 aa] {ON} Anc_5.577 YML034W
          Length = 1148

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 6/44 (13%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
           K  +  +ACL CR  K  CD   PD      C  C ++ K C++
Sbjct: 300 KLNKKPRACLTCRKSKIGCDRTKPD------CNNCTKKNKTCIY 337

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 35.8 bits (81), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          + +  C  CR RK +CDLG P       C RC++   +C
Sbjct: 39 KTFTGCWTCRLRKVKCDLGKPS------CQRCEKSGLDC 71

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 7/50 (14%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          K RR  +AC  CR +K +CD          PC+ C     EC +   +KR
Sbjct: 29 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNHPTKR 71

>ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {ON}
           similar to uniprot|P08638 Saccharomyces cerevisiae
           YLR451W LEU3 Zinc-finger transcription factor that
           regulates genes involved in branched chain amino acid
           biosynthesis and ammonia assimilation positively
           regulated by alpha-isopropylmalate an intermediate in
           leucine biosynthesis
          Length = 860

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 62/297 (20%), Positives = 112/297 (37%), Gaps = 41/297 (13%)

Query: 23  ACLNCRSRKTRCDLGPPDSPRDP-PCVRCKRERKECVFLENSKRGGRKRIEWTVDGNTDV 81
           AC+ CR +K++CD       R P PC +C+++   CV  ++ +R  ++            
Sbjct: 45  ACVECRQQKSKCDA----HDRAPEPCTKCQKKGVPCVLKKDFRRTYKR------------ 88

Query: 82  NATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNALEFLAKAAGSAAKEDSRSRIP 141
              AR EA +K     T +  T++    +  ++     AL             D ++   
Sbjct: 89  ---ARNEAIEKRFKELT-RTLTNLSSEEILKKIEQEQQAL------------LDGQNFT- 131

Query: 142 SYERQDKTIREKTYHREESPNQHAS-GSKRASLATPGKL--IEKLSDWKPGSLYDLGDVE 198
               +DK  R K      +P   A+ GS+RA+      +   E + + K  +   L    
Sbjct: 132 ----KDKVKRLKQSGITVTPTSTAADGSQRANPLGSDWIYEFEHMQNVKEMTPEQLKCTP 187

Query: 199 YIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHN 258
              G   ++ ++   L   F    HPF P I       +  +  P L   ++    R   
Sbjct: 188 KTLGDIYMSSEDIAELFQEFAKRYHPFLPVIDITKGAERIYRLSPCLFWVMILTGLRRKF 247

Query: 259 FAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNP 315
            A   +++     ++I     +    +   S S     +  SV ++ AFLL+T W P
Sbjct: 248 GATELMTKLSSMVKSILAEITISPIIRYTPSDSDEPVLNVASVYSVQAFLLYTFWPP 304

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
          (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 4  LATGNDLEVSSQKYR-RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          +A+ +  E+S  K+R R  KAC +CR RK +C    P +P    C  C +    C F
Sbjct: 8  MASESPTELSGGKFRKRVPKACDHCRKRKIKCG---PVNPITGTCENCNKFNTSCTF 61

>AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR098C
          (CHA4)
          Length = 612

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 23 ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWT 74
          AC  CR R+ +CDL         PCV C++   EC+ ++   R  R   ++ 
Sbjct: 13 ACQTCRKRRRKCDL-------QVPCVNCQKFGVECLPVDQDLRKKRYSAQYV 57

>Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106W
          (RDS1) - transcriptional regulator [contig 139] FULL
          Length = 827

 Score = 35.8 bits (81), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 6/58 (10%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
          S +  R    CL CR+RK +CD         P C RCK+    C +  +    G  ++
Sbjct: 5  SPRVNRPRLVCLECRNRKLKCDKA------RPKCTRCKQNLLTCSYANDGNSPGGSKL 56

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON}
          Anc_2.654 YKL015W
          Length = 1037

 Score = 35.8 bits (81), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          K R+  +AC+ CR R  +C       P + PC +C      C F E +K+
Sbjct: 51 KKRKITRACIRCRERHIKC-------PGNDPCQKCLEANHICKFSEPNKK 93

>TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {ON}
           Anc_4.344 YML076C
          Length = 806

 Score = 35.8 bits (81), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%)

Query: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
           + +R   AC++C S K +C    P      PC RC R  K C F
Sbjct: 68  QIKRNSFACVSCHSLKQKCVPSDPHDIYRKPCERCLRNFKLCKF 111

>ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa]
          {ON} conserved hypothetical protein
          Length = 686

 Score = 35.8 bits (81), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLE-NSKR 65
          +R    CL CR+RK +CD         P C  C+R   +C++ + NSKR
Sbjct: 28 KRSKSGCLTCRNRKKKCD------ETKPLCKGCRRNFLQCIWPQGNSKR 70

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa]
          {ON} weakly similar to uniprot|P07272 Saccharomyces
          cerevisiae YLR014C PPR1 Zinc finger transcription
          factor containing a Zn(2)-Cys(6) binuclear cluster
          domain positively regulates transcription of genes
          involved in uracil biosynthesis activity may be
          modulated by interaction with Tup1p
          Length = 775

 Score = 35.8 bits (81), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 13 SSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          SS    R   AC  CR RK +CD       + P C +C + ++ C+ ++ S R
Sbjct: 9  SSGNIYRSVAACKRCRIRKIKCD------NKFPSCTKCIQAQEPCITIDPSTR 55

>SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} similar
          to uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer- mediated
          Activation Ty1 enhancer activator and to YLR098C
          uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4
          Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain DNA-binding transcriptional
          activator or CHA1
          Length = 701

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 7/46 (15%)

Query: 23 ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGR 68
          AC NCR R+ +CDL       + PC  C R R +C   E   R  R
Sbjct: 54 ACSNCRRRRKKCDL-------NYPCSSCVRLRLQCNVNEEDLRKKR 92

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa]
          {ON} Anc_8.845 YMR280C
          Length = 1246

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 7/45 (15%)

Query: 13 SSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          SS  YR   +AC  CRS+KTRCD       R P C +C     EC
Sbjct: 22 SSSNYRVT-QACDRCRSKKTRCD------GRKPQCSQCAAVGFEC 59

>Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 6/39 (15%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          + +  C  CR RK +CDL      R P C RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 6/45 (13%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          QK  R    CL CR RK +CD       + P C++C  +   CV+
Sbjct: 16 QKRNRLSFVCLECRRRKIKCD------KQRPCCIQCAEQGLTCVY 54

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
          {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          S++ R+  +AC NCR RK +C           PC  C+  + +CVF
Sbjct: 13 SKRRRKVNRACDNCRKRKIKCS-------ETTPCTNCQIYQCKCVF 51

>ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON}
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 1036

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 10/64 (15%)

Query: 22 KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDGNTDV 81
          +AC NCR RK +C           PC  C+  + EC++          +   + +GNT+V
Sbjct: 15 RACYNCRRRKIKC-------TGKYPCSSCEAYQCECLYFPGYV---PTKSNTSTNGNTNV 64

Query: 82 NATA 85
          NA A
Sbjct: 65 NAKA 68

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 14/89 (15%)

Query: 12  VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
           +  +K  R    C NCR  K +CD   P+      C RC ++  +CV+ E  +R  R RI
Sbjct: 38  IQLKKRNRISFVCQNCRKSKMKCDREKPE------CTRCLKQGIKCVYDE--ERQPRPRI 89

Query: 72  EWTVDGNTDVNATARFEAEDKYIPVATLK 100
                 N D    A+ E + KY     +K
Sbjct: 90  P-----NKDA-TIAKLERDVKYWQTKAMK 112

>Kwal_33.13118 s33 (80421..82760) [2340 bp, 779 aa] {ON} YDR520C -
           Hypothetical ORF [contig 123] FULL
          Length = 779

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 58/135 (42%), Gaps = 12/135 (8%)

Query: 13  SSQKYRRGYK--ACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70
           SS+K R+  K  +C  CR  KTRCD      P    C RC   + +C   +  +      
Sbjct: 44  SSRKPRKKRKTYSCEVCRKFKTRCDF----EPLVGRCHRCSVLKLQCSLTKEREDEILAA 99

Query: 71  IEWTVDGNTDVNATARFEAEDKYI----PVA-TLKDTTSIKEGSLTPELNSMHNALEFLA 125
           IE + +           +A  K +    PVA TL +  +  E +L   LNS  + L  LA
Sbjct: 100 IETSSNATLTAPGPVGSDASSKDVLVSHPVASTLNNRLNKLEANLN-SLNSKLDLLVLLA 158

Query: 126 KAAGSAAKEDSRSRI 140
           + + SA    + S+I
Sbjct: 159 QGSHSAVANSTGSKI 173

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
          homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 35.8 bits (81), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 9/70 (12%)

Query: 4  LATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENS 63
          L  G   +V  ++ RR    C+ C  RK +C+         P C  C++ R  C +  N 
Sbjct: 19 LEDGTVYKVQHKRQRRVLN-CMPCHKRKVKCNRA------RPVCDHCEKNRYACAYFVND 71

Query: 64 K--RGGRKRI 71
          +  RGG+ ++
Sbjct: 72 RVSRGGQNKV 81

>YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}
          ARG81Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type, involved in
          the regulation of arginine-responsive genes; acts with
          Arg80p and Arg82p
          Length = 880

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 6/39 (15%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          + +  C  CR RK +CDL      R P C RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 35.4 bits (80), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 44/98 (44%), Gaps = 4/98 (4%)

Query: 372 VRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSILSQSLAEVSL----NGHDGDSGLS 427
           +R   +   +    ++F  + I +T  +    Q  I  +++ E S     + H+ DS + 
Sbjct: 369 LRFVSERAVLGEGKEVFMLVTIPDTPGSFKKLQNVIHPRAVTEFSYRYNEHCHENDSDVP 428

Query: 428 SACIEEIFRNEDSKRRWKSYTQQRDSVEGKSVGFCDNE 465
           +ACI   F   D ++  K   QQ  ++  ++V   DNE
Sbjct: 429 TACIYTSFNVVDREKEIKQVVQQLHALGFEAVDISDNE 466

>KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.264
           YDR034C
          Length = 741

 Score = 35.4 bits (80), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 12  VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLEN 62
           +  +KY R    C+ C+ R+ +CD         P C +C R  ++CV++ N
Sbjct: 129 IVKRKYSRN--GCVECKRRRMKCD------ETKPKCWQCDRLNRDCVYVLN 171

>Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}
          YGR288W (REAL)
          Length = 473

 Score = 35.4 bits (80), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 22 KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRI 71
          +AC  CR R+ +CD     S R  PC  C +    C +L+ SK+ G K I
Sbjct: 11 QACDCCRVRRVKCD-----SKR--PCSSCLQNNLSCTYLQPSKKRGPKSI 53

>Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}
          YML099C (REAL)
          Length = 882

 Score = 35.4 bits (80), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 6/39 (15%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKEC 57
          + +  C  CR RK +CDL      R P C RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RRPHCQRCEKSNLPC 48

>KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {ON}
           similar to uniprot|P08638 Saccharomyces cerevisiae
           YLR451W LEU3 Zinc-finger transcription factor that
           regulates genes involved in branched chain amino acid
           biosynthesis and ammonia assimilation positively
           regulated by alpha-isopropylmalate an intermediate in
           leucine biosynthesis
          Length = 925

 Score = 35.4 bits (80), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 63/307 (20%), Positives = 121/307 (39%), Gaps = 44/307 (14%)

Query: 23  ACLNCRSRKTRCDLGPPDSPRDP-PCVRCKRERKECVFLENSKRGGR--------KRIEW 73
           AC+ CR +K++CD       R P PC RC ++   CV  ++ +R  +        K+ + 
Sbjct: 48  ACVECRQQKSKCDA----HERAPEPCSRCLKKGVPCVLQKDFRRTCKRARNEVIAKKFQE 103

Query: 74  TVDGNTDVNA---TARFEAEDKYIPVATLKDTTSIK-EGSLTPELNSMHNALEFLAKAAG 129
                +++ +     + +AE   +P    +D   IK E S   E     N++   +++  
Sbjct: 104 LTQSLSNLGSEELLKKLDAETLRLP----EDLGLIKVETSTGAEAPWDQNSIGTGSRSNS 159

Query: 130 SAAKEDS-RSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATPGKLIEKLSDWKP 188
           +  +E + R+ + + +     +         S N   SG+K   L  P  L ++  + +P
Sbjct: 160 TGGQEIALRTVLSTNDFVSIAV---------SSNTTGSGTK---LDGPITLTKQQLECQP 207

Query: 189 GSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCA 248
            +   LGDV        L+  +       F    HPF P +       +     P L   
Sbjct: 208 KT---LGDVT-------LSSSDIANFFSEFTTKYHPFLPVVDVTKGPERIYSLSPCLFWV 257

Query: 249 ILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFL 308
           I+ +  R    A   +++     ++I     +    +    +S     +  SV ++ AFL
Sbjct: 258 IILVGLRRKFEAIEMMNKLSNMVKSILAEITISPIIRYTPMESDEPVLNVSSVYSVQAFL 317

Query: 309 LFTEWNP 315
           ++T W P
Sbjct: 318 IYTYWPP 324

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 35.4 bits (80), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 9/48 (18%)

Query: 22 KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
          KAC NCR RK +C+          PC  C+    EC F   S++GG +
Sbjct: 41 KACDNCRKRKIKCN-------GKFPCASCEIYSCECTF--TSRQGGHR 79

>Kpol_1057.3 s1057 (3619..6702) [3084 bp, 1027 aa] {ON} (3619..6702)
           [3084 nt, 1028 aa]
          Length = 1027

 Score = 35.4 bits (80), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 24  CLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRK 69
           CLNCR  K +C + P        CVRC+ +  +C  ++N     R+
Sbjct: 161 CLNCRDAKKKCTMMPGSQ----NCVRCETKSLDCRMVDNLNDKKRR 202

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 39/96 (40%), Gaps = 8/96 (8%)

Query: 19  RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDGN 78
           R ++AC+ CR RK RC           PC  C+    EC +    +       E + D +
Sbjct: 53  RAHRACVACRKRKVRCS-------GQTPCRLCQNNSFECKYDRPPRNSSVFDREVSDDSS 105

Query: 79  TDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPEL 114
           +   +    E EDK     T+ +  +I E    PE+
Sbjct: 106 SYPQSIPHQEGEDKRSSTCTI-NYKNIVETIFPPEI 140

>KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa]
          {ON} similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 856

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 7/67 (10%)

Query: 19 RGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTVDGN 78
          + +  C  CRSRK +CDL      R P C RC++    C   +   R  R  I++   GN
Sbjct: 9  KTFTGCWTCRSRKVKCDL------RRPGCERCEKGGLICGGYDVKLRWTRP-IQFDTMGN 61

Query: 79 TDVNATA 85
               T 
Sbjct: 62 VTATPTG 68

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 8/45 (17%)

Query: 18  RRGYKACLNCRSRKTRCDLGPPDSPRDP---PCVRCKRERKECVF 59
           +R  +AC +CR RK +C     D  RDP    C  C +   EC F
Sbjct: 247 KRVSRACDHCRKRKIKC-----DEKRDPNTNKCSNCIKYNSECTF 286

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 35.4 bits (80), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKR 65
          S K R    AC+ CR R  +C  G P       C RC +   +C ++E SK+
Sbjct: 19 SSKRRPKSLACILCRKRHIKCSGGNP-------CARCIKHDLKCEYIEPSKK 63

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 35.0 bits (79), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 18 RRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENS 63
          +R  KAC  CR  KT+CD        + PC RC  E K C +  +S
Sbjct: 5  KRVSKACDTCRKSKTKCD-------GERPCQRCLSENKICTYSNSS 43

>NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa]
          {ON} Anc_1.199
          Length = 995

 Score = 35.4 bits (80), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 7/39 (17%)

Query: 14 SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKR 52
          S+K  R    C NC+ RK++CD       R  PC  CKR
Sbjct: 62 SRKRHRSTVVCTNCKKRKSKCD-------RSRPCGTCKR 93

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
          YOR363C
          Length = 951

 Score = 35.4 bits (80), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 6/45 (13%)

Query: 15 QKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59
          +K  R    C  CR  KT+CD         P C RC+++  ECV+
Sbjct: 56 KKRNRISFVCQACRKAKTKCD------KEKPMCSRCRKQDLECVY 94

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 35.4 bits (80), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 29/76 (38%), Gaps = 7/76 (9%)

Query: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75
          K  R  +AC  CR RK RCD          PC+ C      C +   S+   R R + + 
Sbjct: 24 KRLRVSRACDVCRQRKVRCD-------GRQPCIHCTVYSYNCTYNPTSRTRKRVRAKESA 76

Query: 76 DGNTDVNATARFEAED 91
            + D    A   A D
Sbjct: 77 QPDDDGATAASVTAAD 92

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
          PDR1Zinc cluster protein that is a master regulator
          involved in recruiting other zinc cluster proteins to
          pleiotropic drug response elements (PDREs) to fine tune
          the regulation of multidrug resistance genes
          Length = 1068

 Score = 35.4 bits (80), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 10/51 (19%)

Query: 22 KACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIE 72
          KAC NCR RK +C+          PC  C+    EC F   S R G  RI+
Sbjct: 44 KACDNCRKRKIKCN-------GKFPCASCEIYSCECTF---STRQGGARIK 84

>Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa]
          {ON} YOR380W (RDR1) - Transcriptional repressor (zinc
          cluster protein) [contig 358] FULL
          Length = 552

 Score = 35.0 bits (79), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 4  LATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPP 39
          +ATG D  V   K  R  KACL CR RK +CD G P
Sbjct: 2  VATGAD--VPRNKRLRVRKACLPCRQRKRKCDSGFP 35

>NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa]
           {ON} Anc_3.264
          Length = 759

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 12  VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFL 60
           ++ +KY R    C  C+ R+ +CD         P C +C R  +ECV++
Sbjct: 121 IAKRKYSRN--GCTECKRRRMKCD------ETKPICWQCARLNRECVYI 161

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 89,706,699
Number of extensions: 3853552
Number of successful extensions: 12120
Number of sequences better than 10.0: 463
Number of HSP's gapped: 12086
Number of HSP's successfully gapped: 481
Length of query: 857
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 739
Effective length of database: 39,950,811
Effective search space: 29523649329
Effective search space used: 29523649329
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)