Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G02420gna 1ON28928915460.0
Kwal_47.18893na 1ON28928811151e-154
SAKL0F02574gna 1ON2892889841e-134
ABL209Cna 2ON3102767126e-93
KLTH0G05786g7.468ON2862806681e-86
TDEL0C033207.468ON2832676672e-86
ZYRO0G17600g7.468ON2832636646e-86
KNAG0D013707.468ON2822616593e-85
Smik_10.3847.468ON2822626472e-83
Suva_12.1847.468ON2822626411e-82
Kpol_1013.827.468ON2852626393e-82
SAKL0F14278g7.468ON2862806385e-82
KAFR0G009207.468ON2862716361e-81
YJR096W7.468ON2822626351e-81
Kwal_47.182197.468ON2932806361e-81
Skud_10.3187.468ON2822636333e-81
KLLA0F03256g7.468ON2852706333e-81
Ecym_7160na 2ON2712636211e-79
NCAS0H005607.468ON2842636151e-78
CAGL0C04543g7.468ON2872746048e-77
Kwal_33.13276na 3ON3022635136e-63
KLTH0F01892gna 3ON3022634806e-58
NDAI0C016005.434ON3133144276e-50
CAGL0A02816g5.434ON3103204267e-50
Kpol_1062.295.434ON3113224241e-49
TDEL0D00230singletonON3123014242e-49
Smik_15.2985.434ON3123214232e-49
KLLA0B14707gsingletonON3103064162e-48
YOR120W (GCY1)5.434ON3123104092e-47
SAKL0G02530g5.434ON3123014067e-47
NCAS0H020605.434ON3223194051e-46
Suva_8.1735.434ON3123144051e-46
Skud_15.2835.434ON3123144032e-46
TBLA0A065105.434ON3123134006e-46
Kwal_47.18084na 4ON3092773981e-45
KLTH0E15532gsingletonON3092833971e-45
YDR368W (YPR1)5.434ON3122963981e-45
KAFR0E038405.434ON3103153971e-45
CAGL0I01100g5.434ON3103113962e-45
AER401W5.434ON3133183902e-44
Suva_2.5405.434ON3122963892e-44
KLLA0D10109gsingletonON3093043893e-44
KLTH0E00220gsingletonON3062893866e-44
KLTH0A00528gsingletonON3062893866e-44
KLTH0A03476gna 4ON3083043866e-44
Smik_4.6345.434ON3122963832e-43
Skud_4.6375.434ON3122943796e-43
ZYRO0F10032g5.434ON3102863772e-42
KNAG0C049105.434ON3133203772e-42
TBLA0A02825singletonON3112943752e-42
TPHA0E017605.434ON3103193736e-42
TPHA0G00210singletonON3113113614e-40
KLTH0F16060g5.434ON3092933589e-40
TDEL0E019105.434ON3113013543e-39
KAFR0E03850singletonON3112863527e-39
TBLA0A02835singletonON3113183473e-38
Kwal_55.214265.434ON3082883465e-38
NDAI0B056705.434ON3183143353e-36
TDEL0E021505.409ON3293083344e-36
YHR104W (GRE3)5.409ON3273093328e-36
Suva_15.3005.409ON3272913301e-35
Kwal_56.226113.108ON3213163292e-35
KAFR0G013503.108ON3242993231e-34
Suva_4.3983.108ON3443023232e-34
Kwal_55.215365.409ON3292973214e-34
NCAS0F033805.434ON3132983195e-34
Smik_2.2883.108ON3443023215e-34
SAKL0G01914g5.409ON3293083197e-34
KAFR0B012007.285ON3152903179e-34
Smik_8.1825.409ON3273093171e-33
Smik_2.289singletonON3443023172e-33
KLTH0F16610g5.409ON3292953152e-33
YBR149W (ARA1)3.108ON3443023162e-33
Skud_2.2763.108ON3443023144e-33
Skud_8.1655.409ON3273093134e-33
SAKL0C10626gsingletonON3222973082e-32
ACL107C5.409ON3543053083e-32
NCAS0A066605.409ON3263043074e-32
TPHA0E018605.409ON3262863074e-32
KLTH0C10010g3.108ON3212983056e-32
KLTH0G00638gna 5ON3132933039e-32
CAGL0I01122g5.409ON3262923041e-31
KLLA0E21627g5.409ON3293053022e-31
NDAI0D016005.409ON3273093012e-31
KNAG0B03780singletonON3262922995e-31
NDAI0A023007.285ON3132922942e-30
TDEL0D02790singletonON3292932952e-30
KAFR0C05320singletonON3273052942e-30
Ecym_55085.409ON3262912933e-30
KNAG0C041107.285ON3112932914e-30
Kwal_47.19278na 5ON3142992907e-30
NDAI0A070003.108ON3202782891e-29
YDL124W7.285ON3122952891e-29
TBLA0A00630singletonON3282892872e-29
ZYRO0E09614gna 5ON3082922863e-29
Kpol_1020.137.285ON3133002854e-29
Smik_4.1137.285ON3122952845e-29
ZYRO0C09196g7.285ON3123002837e-29
KLLA0F05775g7.285ON3092892821e-28
Kpol_381.8singletonON3092972821e-28
TBLA0F01720singletonON3262922821e-28
SAKL0C09922g3.108ON3222802812e-28
Skud_4.1317.285ON3122942775e-28
NCAS0A137407.285ON3092862741e-27
ZYRO0A06336g5.409ON3273102733e-27
NCAS0I024203.108ON3202972723e-27
KLLA0F02728g3.108ON3302992706e-27
SAKL0F00704gna 5ON3152872681e-26
TBLA0F019807.285ON3022882671e-26
KNAG0K020703.108ON3232742672e-26
TDEL0D051603.108ON3252782653e-26
SAKL0F09746g7.285ON3122972644e-26
ZYRO0B06138g3.108ON3282802646e-26
Ecym_32647.285ON3112922574e-25
CAGL0J09394g7.285ON3112912418e-23
Kwal_33.13274singletonON1081002242e-22
TBLA0G00960singletonON3212971235e-07
Suva_12.272singletonON2651991191e-06
KLTH0E01474gsingletonON3131821192e-06
SAKL0E00264gsingletonON3151991182e-06
NDAI0H02960singletonON3442081173e-06
Kpol_400.9singletonON3413151165e-06
NDAI0C01480singletonON3432941148e-06
Kpol_449.4singletonON3413261121e-05
NDAI0J00730singletonON3432941112e-05
Suva_9.17singletonON3081701083e-05
SAKL0C14058gsingletonON3151991084e-05
KAFR0J00220singletonON3433031067e-05
Kwal_47.16887singletonON3131831059e-05
CAGL0E05214gsingletonON3462991051e-04
KLTH0A08052gsingletonON3382961041e-04
KAFR0D04230singletonON3423011041e-04
NDAI0G01600singletonON3442101032e-04
KAFR0F03890singletonON3193021022e-04
CAGL0E05236gsingletonON3442961023e-04
NCAS0D03150na 6ON338293996e-04
NCAS0C02450singletonON343312987e-04
CAGL0E05192gsingletonON345296988e-04
TBLA0E05040singletonON342302970.001
KAFR0C03670singletonON343302960.001
NCAS0F04070singletonON344339950.002
NCAS0A129502.604ON323134940.002
KNAG0A078403.462ON353219940.002
ZYRO0D02816gsingletonON343304910.005
Smik_3.208singletonON344299910.006
TPHA0H00110singletonON345318900.007
NCAS0A03110singletonON344302900.009
Suva_4.1227.285ON206110880.009
NDAI0D00600singletonON327213890.009
TDEL0A08000singletonON319198890.009
NCAS0C019908.565ON343313890.009
KNAG0M023402.604ON309127880.011
Smik_14.1na 7ON376191890.011
Kwal_26.83772.604ON338123870.017
AAR033W3.462ON341275860.022
KAFR0C04240singletonON343324860.023
TBLA0B10110singletonON345330860.024
SAKL0H09438g8.565ON342296860.025
ABR094W2.604ON359143860.025
Suva_16.2248.565ON342332850.028
KNAG0L01560singletonON340300850.028
TBLA0G01120singletonON343302850.031
KLTH0D08844g2.604ON340127840.036
Kpol_2000.109singletonON342301840.038
Suva_14.10na 7ON376191830.052
NCAS0J01740singletonON345300820.073
YDL243C (AAD4)singletonON32964820.082
KAFR0A023402.604ON329173810.10
CAGL0F06061g2.604ON336128800.12
Kwal_33.149482.618ON885151800.15
YNL331C (AAD14)na 7ON37664790.16
Skud_10.383na 8ON376191780.21
YPL088W8.565ON342292780.21
Kwal_47.166854.367ON8779730.22
SAKL0G18502g4.367ON8779720.30
NCAS0I02160singletonON344314760.39
Smik_16.1498.565ON342245760.44
TDEL0C06010singletonON344301760.44
Smik_13.2112.604ON351127760.46
Skud_3.179singletonON344299731.1
Skud_13.1972.604ON351136721.4
NDAI0A046103.462ON348195721.4
Suva_6.198.25ON20670701.5
YFL056C (AAD6)singletonON21264674.0
Skud_16.4173.462ON345210684.0
ZYRO0C06468g3.462ON341210674.6
Kpol_1018.865.684ON36369675.1
CAGL0K12672g8.25ON20670665.1
YPL127C (HHO1)8.629ON25831675.2
KLLA0F19360gsingletonON344221675.2
NCAS0C037108.25ON21159665.4
ZYRO0F04840gsingletonON379333675.4
KLTH0E16852gsingletonON375137676.1
KLLA0B09658g3.462ON342144666.5
TPHA0P003408.68ON1219100676.9
KLLA0F26851g2.604ON328124658.2
Smik_6.3268.629ON26231658.5
Skud_6.328.25ON20670648.5
Smik_6.408.25ON20670648.5
YFL038C (YPT1)8.25ON20670648.5
Kpol_1023.218.25ON20759649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G02420g
         (289 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   600   0.0  
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   434   e-154
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   383   e-134
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   278   6e-93
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   261   1e-86
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   261   2e-86
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   260   6e-86
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   258   3e-85
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   253   2e-83
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   251   1e-82
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   250   3e-82
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   250   5e-82
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   249   1e-81
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   249   1e-81
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   249   1e-81
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   248   3e-81
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   248   3e-81
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   243   1e-79
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   241   1e-78
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   237   8e-77
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   202   6e-63
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   189   6e-58
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   169   6e-50
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   168   7e-50
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   167   1e-49
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   167   2e-49
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   167   2e-49
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   164   2e-48
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   162   2e-47
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   160   7e-47
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     160   1e-46
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   160   1e-46
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   159   2e-46
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   158   6e-46
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   157   1e-45
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   157   1e-45
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   157   1e-45
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   157   1e-45
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   157   2e-45
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   154   2e-44
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   154   2e-44
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   154   3e-44
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   153   6e-44
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   153   6e-44
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   153   6e-44
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   152   2e-43
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   150   6e-43
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   149   2e-42
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   149   2e-42
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     149   2e-42
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   148   6e-42
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 143   4e-40
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   142   9e-40
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   140   3e-39
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     140   7e-39
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     138   3e-38
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   137   5e-38
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   133   3e-36
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   133   4e-36
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   132   8e-36
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   131   1e-35
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   131   2e-35
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   129   1e-34
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   129   2e-34
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   128   4e-34
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     127   5e-34
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   128   5e-34
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   127   7e-34
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   126   9e-34
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   126   1e-33
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   126   2e-33
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   125   2e-33
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   126   2e-33
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   125   4e-33
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   125   4e-33
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   123   2e-32
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   123   3e-32
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             122   4e-32
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   122   4e-32
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   122   6e-32
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   121   9e-32
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   121   1e-31
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   120   2e-31
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               120   2e-31
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               119   5e-31
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     117   2e-30
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     118   2e-30
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   117   2e-30
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   117   3e-30
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   116   4e-30
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   116   7e-30
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   115   1e-29
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   115   1e-29
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     115   2e-29
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   114   3e-29
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   114   4e-29
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   114   5e-29
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   113   7e-29
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   113   1e-28
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   113   1e-28
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     113   1e-28
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   112   2e-28
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   111   5e-28
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   110   1e-27
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   109   3e-27
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   109   3e-27
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   108   6e-27
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   107   1e-26
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   107   1e-26
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   107   2e-26
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   106   3e-26
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   106   4e-26
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   106   6e-26
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   103   4e-25
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...    97   8e-23
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    91   2e-22
TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON}      52   5e-07
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    50   1e-06
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    50   2e-06
SAKL0E00264g Chr5 complement(12234..13181) [948 bp, 315 aa] {ON}...    50   2e-06
NDAI0H02960 Chr8 (721089..722123) [1035 bp, 344 aa] {ON}               50   3e-06
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    49   5e-06
NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON}               49   8e-06
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    48   1e-05
NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {...    47   2e-05
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     46   3e-05
SAKL0C14058g Chr3 (1248968..1249915) [948 bp, 315 aa] {ON} conse...    46   4e-05
KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON}      45   7e-05
Kwal_47.16887 s47 complement(158953..159894) [942 bp, 313 aa] {O...    45   9e-05
CAGL0E05214g Chr5 complement(508275..509315) [1041 bp, 346 aa] {...    45   1e-04
KLTH0A08052g Chr1 complement(685177..686193) [1017 bp, 338 aa] {...    45   1e-04
KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {O...    45   1e-04
NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON}               44   2e-04
KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON}      44   2e-04
CAGL0E05236g Chr5 complement(509715..510749) [1035 bp, 344 aa] {...    44   3e-04
NCAS0D03150 Chr4 complement(592701..593717) [1017 bp, 338 aa] {O...    43   6e-04
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    42   7e-04
CAGL0E05192g Chr5 complement(506831..507868) [1038 bp, 345 aa] {...    42   8e-04
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             42   0.001
KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {O...    42   0.001
NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {O...    41   0.002
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    41   0.002
KNAG0A07840 Chr1 complement(1245869..1246930) [1062 bp, 353 aa] ...    41   0.002
ZYRO0D02816g Chr4 (221712..222743) [1032 bp, 343 aa] {ON} simila...    40   0.005
Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W ...    40   0.006
TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON}                 39   0.007
NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {O...    39   0.009
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    39   0.009
NDAI0D00600 Chr4 (131820..132803) [984 bp, 327 aa] {ON}                39   0.009
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              39   0.009
NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565     39   0.009
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    39   0.011
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    39   0.011
Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C...    38   0.017
AAR033W Chr1 (401423..402448) [1026 bp, 341 aa] {ON} Syntenic ho...    38   0.022
KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON}               38   0.023
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    38   0.024
SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly...    38   0.025
ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic ho...    38   0.025
Suva_16.224 Chr16 (392092..393120) [1029 bp, 342 aa] {ON} YPL088...    37   0.028
KNAG0L01560 Chr12 (276747..277769) [1023 bp, 340 aa] {ON}              37   0.028
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    37   0.031
KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} simila...    37   0.036
Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]...    37   0.038
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    37   0.052
NCAS0J01740 Chr10 complement(321825..322862) [1038 bp, 345 aa] {...    36   0.073
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    36   0.082
KAFR0A02340 Chr1 complement(485299..486288) [990 bp, 329 aa] {ON...    36   0.10 
CAGL0F06061g Chr6 complement(604063..605073) [1011 bp, 336 aa] {...    35   0.12 
Kwal_33.14948 s33 (883559..886216) [2658 bp, 885 aa] {ON} YKL073...    35   0.15 
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    35   0.16 
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    35   0.21 
YPL088W Chr16 (381965..382993) [1029 bp, 342 aa] {ON} Putative a...    35   0.21 
Kwal_47.16685 s47 (62770..63033) [264 bp, 87 aa] {ON} YJR135W-A ...    33   0.22 
SAKL0G18502g Chr7 (1595090..1595353) [264 bp, 87 aa] {ON} simila...    32   0.30 
NCAS0I02160 Chr9 (407406..408440) [1035 bp, 344 aa] {ON}               34   0.39 
Smik_16.149 Chr16 (265088..266116) [1029 bp, 342 aa] {ON} YPL088...    34   0.44 
TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa] ...    34   0.44 
Smik_13.211 Chr13 complement(344952..346007) [1056 bp, 351 aa] {...    34   0.46 
Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W ...    33   1.1  
Skud_13.197 Chr13 complement(337502..338557) [1056 bp, 351 aa] {...    32   1.4  
NDAI0A04610 Chr1 complement(1035715..1036761) [1047 bp, 348 aa] ...    32   1.4  
Suva_6.19 Chr6 complement(28872..29492) [621 bp, 206 aa] {ON} YF...    32   1.5  
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    30   4.0  
Skud_16.417 Chr16 (749628..750665) [1038 bp, 345 aa] {ON} YPR127...    31   4.0  
ZYRO0C06468g Chr3 (493466..494491) [1026 bp, 341 aa] {ON} simila...    30   4.6  
Kpol_1018.86 s1018 complement(232551..233642) [1092 bp, 363 aa] ...    30   5.1  
CAGL0K12672g Chr11 (1256370..1256990) [621 bp, 206 aa] {ON} high...    30   5.1  
YPL127C Chr16 complement(308828..309604) [777 bp, 258 aa] {ON}  ...    30   5.2  
KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON} high...    30   5.2  
NCAS0C03710 Chr3 complement(747168..747803) [636 bp, 211 aa] {ON...    30   5.4  
ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly...    30   5.4  
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    30   6.1  
KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {...    30   6.5  
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...    30   6.9  
KLLA0F26851g Chr6 complement(2478465..2479451) [987 bp, 328 aa] ...    30   8.2  
Smik_6.326 Chr6 (514568..515356) [789 bp, 262 aa] {ON} YPL127C (...    30   8.5  
Skud_6.32 Chr6 complement(58531..59151) [621 bp, 206 aa] {ON} YF...    29   8.5  
Smik_6.40 Chr6 complement(70749..71369) [621 bp, 206 aa] {ON} YF...    29   8.5  
YFL038C Chr6 complement(55366..55986) [621 bp, 206 aa] {ON}  YPT...    29   8.5  
Kpol_1023.21 s1023 complement(39597..40220) [624 bp, 207 aa] {ON...    29   9.6  

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/289 (100%), Positives = 289/289 (100%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA
Sbjct: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC 120
           TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC
Sbjct: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC 120

Query: 121 AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT 180
           AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT
Sbjct: 121 AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT 180

Query: 181 RKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVP 240
           RKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVP
Sbjct: 181 RKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVP 240

Query: 241 LPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGFDPIETED 289
           LPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGFDPIETED
Sbjct: 241 LPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGFDPIETED 289

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  434 bits (1115), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 201/288 (69%), Positives = 241/288 (83%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           M++T STTKTLTNGVKIPVL  G YE PKE+ E  V  A K GYRHVD AQLY NERE  
Sbjct: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC 120
             +AKFLKE+P VSR ++FYTTKV+GDNHGYEKAKKSII+SLE  KE+EY+DL LIHNP 
Sbjct: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI 120

Query: 121 AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT 180
           A TE+RLGT+KALQE Y  GK++AIGVS+YSIKHLEELY+WEGL+V+PMVNQFELNPWLT
Sbjct: 121 AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLT 180

Query: 181 RKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVP 240
           RK+L +YC+++ +V+EAFSP+TR ++FSDP +Q+L+K SYP +TPAQ+LIRWSLQMGF+P
Sbjct: 181 RKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIP 240

Query: 241 LPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGFDPIETE 288
           LPKS +  R  SNL ALDFEIS +DMK LTHD  +FLA   FDPI+T+
Sbjct: 241 LPKSSNSKRQISNLQALDFEISDKDMKALTHDDTYFLATEDFDPIKTQ 288

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  383 bits (984), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 172/288 (59%), Positives = 224/288 (77%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           M  T  TT  L NGVK+P LG G Y+TPKE+  +IVH A K GYR VD+AQLY NERE  
Sbjct: 1   MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC 60

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC 120
             + KFL+ESPKVSR  +F+TTK+   + GYE AKKSI ESL   KEL+Y+DLFLIH P 
Sbjct: 61  LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL 120

Query: 121 AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT 180
              EKRLGT+KA QE+Y+ GKIKAIGVS+Y I+HLEE+Y W+GL++ PMVNQ+ELNPWLT
Sbjct: 121 TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180

Query: 181 RKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVP 240
           RK+L  YC ++ +VI+A+SP+TR++R  DP + KL+++SYP +T AQ+L+ WSLQMGFVP
Sbjct: 181 RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP 240

Query: 241 LPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGFDPIETE 288
           L K+VHEDR + N+ + DFE+S+ D+K LTHD +++L+QP +DPI+ E
Sbjct: 241 LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIKYE 288

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  278 bits (712), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 123/276 (44%), Positives = 188/276 (68%), Gaps = 2/276 (0%)

Query: 9   KTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLK 68
           + L++G +IP +G G Y+  ++  + +V+ A + GYR  D+AQ Y NE   A  +A +LK
Sbjct: 13  RRLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLK 72

Query: 69  ESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLG 128
            +P   R+ V++TTK+   NHGYE  KKS+ +SL  A  L Y+DL L+H P ++  +RLG
Sbjct: 73  HAPGRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRLG 132

Query: 129 TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYC 188
           T++AL+E    G++++IGVS+Y  +HL EL  WEGL+++P+VNQ E+NPWL R++LV+YC
Sbjct: 133 TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEGLKIRPVVNQVEINPWLCRQELVQYC 192

Query: 189 KERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHED 248
           +E ++ ++AFSP+ R KR  DP++QK+  +   G   AQ+L+RWS+QMGF+ LPK+  ++
Sbjct: 193 RENNIAVQAFSPLMRGKRLDDPILQKVAHQYDKG--VAQILVRWSIQMGFIVLPKAAKKE 250

Query: 249 RAESNLHALDFEISAEDMKTLTHDGEHFLAQPGFDP 284
           R   N    DFE+SAE M  LTH  ++F+  PG  P
Sbjct: 251 RLAPNFDIWDFELSAETMSELTHSDDYFVTVPGGIP 286

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  261 bits (668), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 131/280 (46%), Positives = 182/280 (65%), Gaps = 12/280 (4%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           L++G  +P LG GTY+ P+ +   +V+ A K GYRH+DTA LY NERE    V K+LKE 
Sbjct: 12  LSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLKED 71

Query: 71  PKVSRDQ-VFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLGT 129
           PK  R   VFYTTK+    +GY  AK++I E L+  + L Y+D+ LIH+P + T +RL T
Sbjct: 72  PKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLSGTRRRLET 131

Query: 130 YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCK 189
           YKA+QE   AG +++IGVS+Y   H++EL +WE L+ KP+VNQ E++PW+ R+DL  YCK
Sbjct: 132 YKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWEELKHKPVVNQIEISPWVMRQDLADYCK 191

Query: 190 ERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDR 249
            + LV+EAFSP+T   +   P V ++ +E   GR   Q+LIRWSLQ G+VPLPKS   +R
Sbjct: 192 SKGLVVEAFSPLTHGYKIKHPNVVRVAEEV--GRNTGQVLIRWSLQHGYVPLPKSRSVER 249

Query: 250 AESNLHALDFEISAEDMKTLTHDGEHFLAQP-GFDPIETE 288
            + NL   DFE+S E +         FL QP  ++P + E
Sbjct: 250 LKGNLEVYDFELSPEQIT--------FLDQPQAYEPTDWE 281

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  261 bits (667), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 180/267 (67%), Gaps = 3/267 (1%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69
           TL+NGVKIP L  GTY+ PK    +IV+ A K GYRH DTA LY NER+    + ++L+E
Sbjct: 8   TLSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQE 67

Query: 70  SPKVS-RDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLG 128
            PK + R+ VFYTTK+    +GY+ AK++I E L+  ++L Y+DL LIH+P + + KRL 
Sbjct: 68  DPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKRLE 127

Query: 129 TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYC 188
           TYKA+QE    G +K+IGVS+Y   HLEEL SWEGL+ KP+VNQ E++PW  R++L ++C
Sbjct: 128 TYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEGLKYKPVVNQIEISPWCMRQELAQWC 187

Query: 189 KERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHED 248
           + + +V+E ++P+T   +  DP + K+ +E   G+   Q+LIRWSLQ G++PLPK+ + D
Sbjct: 188 QSQGIVVEDYAPLTHGYKLKDPQLVKVAEEV--GKNTGQVLIRWSLQHGYLPLPKTSNVD 245

Query: 249 RAESNLHALDFEISAEDMKTLTHDGEH 275
           R   NL   DF+++   +K   H   H
Sbjct: 246 RLPGNLDVYDFKLTESQIKAFEHPEAH 272

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  260 bits (664), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 174/263 (66%), Gaps = 3/263 (1%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69
           T+ NG+KIP L  G Y+ P+ +  ++V+ A K+GYRH DTA LY NE+E    + K+LKE
Sbjct: 8   TMVNGIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKE 67

Query: 70  SPKVS-RDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLG 128
            P  + R+ VFYTTK+    +GY  AK+ I E +   KEL Y+DL LIH+P +   +RL 
Sbjct: 68  DPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSPLSGPRRRLE 127

Query: 129 TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYC 188
           TY+A+QE    G +K+IGVS+Y  +H+EELY W+ L+ KP+ NQ E++PW  R+DL  +C
Sbjct: 128 TYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDKLKHKPVANQIEISPWCMREDLTSWC 187

Query: 189 KERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHED 248
           + + L++EAFSP+T   +  +P +  L K+   GR   Q+LIRWSLQ G +PLPK+ +  
Sbjct: 188 QSKGLIVEAFSPLTHGYKLKEPGLVSLAKKL--GRDTGQVLIRWSLQRGLLPLPKTQNPA 245

Query: 249 RAESNLHALDFEISAEDMKTLTH 271
           R  SNL   DFE++ ED+K L H
Sbjct: 246 RLSSNLEVYDFELTPEDVKELDH 268

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  258 bits (659), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 168/261 (64%), Gaps = 2/261 (0%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           L +G  IP +G GTY+ P     +IV AA + GYRH+DTA LY NE E A     FL   
Sbjct: 9   LASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFLGRH 68

Query: 71  PKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLGTY 130
           P VSR+ +FYTTK+     GYEKAK++I E +E    L Y+DL L+H+P    + R GT+
Sbjct: 69  PDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPIGGKQVRRGTW 128

Query: 131 KALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKE 190
           KA+QE    G +++IGVSSY  +HLE+L+ W  L+  P VNQ E++PW+ R+ L  YCK 
Sbjct: 129 KAMQEAVDDGLVRSIGVSSYGQRHLEDLFEWSELKHAPAVNQIEISPWIMRQQLADYCKS 188

Query: 191 RDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRA 250
           + +V+EA+SP+T   +  DP + K+ +E+  G+ P Q+L+RWSLQ G+VPLPK+    R 
Sbjct: 189 KGIVVEAYSPLTHGYKLDDPDLLKVAEET--GKNPGQVLLRWSLQHGYVPLPKTKTVSRL 246

Query: 251 ESNLHALDFEISAEDMKTLTH 271
           + NL   D+E+S E MK L H
Sbjct: 247 QLNLDVFDWELSPEHMKLLDH 267

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  253 bits (647), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 171/262 (65%), Gaps = 3/262 (1%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           L+NG+KIP +  GTYE P+ +   IV+   K GYRH DTA LY NE+E    + ++L E 
Sbjct: 8   LSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNED 67

Query: 71  PKVS-RDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLGT 129
           PK + R  +FYTTK+    +GY KAK +I + L     LEY+DL LIH+P   ++ RL T
Sbjct: 68  PKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPLEGSKLRLET 127

Query: 130 YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCK 189
           ++A+QE   AG +K+IGVS+Y  KH++EL +W  L   P+VNQ E++PW+ R++L  YCK
Sbjct: 128 WRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWSELRHYPVVNQIEISPWIMRQELADYCK 187

Query: 190 ERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDR 249
            + L++EAF+P+    + ++P +  + KE    R P Q+LIRWSLQ G++PLPK+    R
Sbjct: 188 SKGLIVEAFAPLCHGYKMTNPDLLIVCKEV--DRNPGQVLIRWSLQHGYLPLPKTRTVKR 245

Query: 250 AESNLHALDFEISAEDMKTLTH 271
            E NL A  FE+S E MKTL H
Sbjct: 246 LEGNLAAYSFELSDEQMKTLDH 267

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  251 bits (641), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 175/262 (66%), Gaps = 3/262 (1%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
            +NG K+P +  GTY+ P+ +   IV+   K GYRH DTA LY NE+E    + K+L E 
Sbjct: 8   FSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHED 67

Query: 71  PKVS-RDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLGT 129
           P+ + R+ VFYTTK+    +GY++AK +I + L     L+Y+DL LIH+P   ++ RL T
Sbjct: 68  PENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPLEGSKLRLET 127

Query: 130 YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCK 189
           ++A+QE    G +K+IGVS+Y  KH++EL +W  L+ KP+VNQ E++PW+ R++L  YCK
Sbjct: 128 WQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWSQLKHKPVVNQIEISPWIMRQELADYCK 187

Query: 190 ERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDR 249
            ++LV+EAF+P+    + +DP + K+ KE    R P Q+LIRWSLQ G++PLPK+    R
Sbjct: 188 SKNLVVEAFAPLCHGYKMTDPDLLKVCKEV--DRNPGQVLIRWSLQHGYLPLPKTKTVKR 245

Query: 250 AESNLHALDFEISAEDMKTLTH 271
            ESNL A +FE+S + MK L H
Sbjct: 246 LESNLAAYNFELSDDQMKILDH 267

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  250 bits (639), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 173/262 (66%), Gaps = 3/262 (1%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           L+NG  IP +G GTY+ P     ++V+ A K GYRH DTA LY NE E    + ++L E 
Sbjct: 11  LSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLLED 70

Query: 71  PKVSR-DQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLGT 129
           P+ +R + VFYTTK+    +GYEKA K+I   L+  K LEY+DL LIH+P   T+ RL T
Sbjct: 71  PENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPLGGTKLRLET 130

Query: 130 YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCK 189
           +KA+QE    G +K+IGVS+Y + H++EL +W+ L+ KP+VNQ E++PWL R++L  YCK
Sbjct: 131 WKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQYLKYKPVVNQIEISPWLMRQELADYCK 190

Query: 190 ERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDR 249
              + +E +SP+T   + +D  ++K+  E+  G+   Q+LIRWSLQ G++PLPK+   +R
Sbjct: 191 SNSIFVECYSPLTHGYKLNDQDLKKVANET--GKNVGQVLIRWSLQHGYIPLPKTRTINR 248

Query: 250 AESNLHALDFEISAEDMKTLTH 271
            ++NL   DF ++++ M  L H
Sbjct: 249 LKTNLDVYDFNLTSDQMTILDH 270

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  250 bits (638), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 177/280 (63%), Gaps = 12/280 (4%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           L++G  +P +G GTY+ P      IV+ A K GYRH+DTA LY NERE    + K+LKE+
Sbjct: 12  LSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKEN 71

Query: 71  PKVS-RDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLGT 129
           P  + R+ VFY TK+    +GY  AK++I E  E  + L Y+DL LIH+P + + KRL T
Sbjct: 72  PSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRLET 131

Query: 130 YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCK 189
           YKA+QE    G +++IGVS+Y + H++EL +W  L+ KP VNQ E++PWL R++L  YCK
Sbjct: 132 YKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLMRQELADYCK 191

Query: 190 ERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDR 249
            R L++EA++P+T   + + P V ++ KE+  G    Q+LIRWSLQ G+VPLPK+    R
Sbjct: 192 SRGLIVEAYAPLTHGYKINHPNVLRVAKEA--GCNSGQVLIRWSLQHGYVPLPKTKSVKR 249

Query: 250 AESNLHALDFEISAEDMKTLTHDGEHFLAQP-GFDPIETE 288
             SNL   + E++ E M         FL QP  ++P + E
Sbjct: 250 LPSNLDVYNIELTQEQMD--------FLDQPDAYEPTDWE 281

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  249 bits (636), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 174/271 (64%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           M ++   T  L++   IP +  GTY+ P  +   IV  A   GYRH DTA LY+NE E A
Sbjct: 1   MKLSIQKTYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVA 60

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC 120
             ++ +L   P+  RD++FYTTK+     GY+ AK++I E ++  ++L+Y+DL L+H+P 
Sbjct: 61  QGISNWLIRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI 120

Query: 121 AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT 180
              + R  T++A+QE    G +K+IGVS++ IKHL+EL+ W+GL+ +P+VNQ E++PWL 
Sbjct: 121 GGPQIREETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQWDGLKYRPVVNQIEISPWLM 180

Query: 181 RKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVP 240
           R++L  +CK   LV+EA++P+T   + + P + K+  E    +   Q+LIRWSLQ G+VP
Sbjct: 181 RQELADFCKMEGLVVEAYAPLTHGYKINHPDLIKISNELNNTKNTGQILIRWSLQHGYVP 240

Query: 241 LPKSVHEDRAESNLHALDFEISAEDMKTLTH 271
           LPK+    R ESNL   DFE++ + MK L H
Sbjct: 241 LPKTKTIGRLESNLDVYDFELTEDQMKFLDH 271

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  249 bits (635), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 173/262 (66%), Gaps = 3/262 (1%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           L+NG KIP +  GTY+ P+ +   IV+   K GYRH DTA LY NE+E    + K+L E 
Sbjct: 8   LSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNED 67

Query: 71  P-KVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLGT 129
           P    R+++FYTTK+    +GY++AK +I + L     L+Y+DL LIH+P   ++ RL T
Sbjct: 68  PGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGSKLRLET 127

Query: 130 YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCK 189
           ++A+QE    G +K+IGVS+Y  KH++EL +W  L+ KP+VNQ E++PW+ R++L  YCK
Sbjct: 128 WRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQELADYCK 187

Query: 190 ERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDR 249
            + LV+EAF+P+    + ++P + K+ KE    R P Q+LIRWSLQ G++PLPK+    R
Sbjct: 188 SKGLVVEAFAPLCHGYKMTNPDLLKVCKEV--DRNPGQVLIRWSLQHGYLPLPKTKTVKR 245

Query: 250 AESNLHALDFEISAEDMKTLTH 271
            E NL A +FE+S E MK L H
Sbjct: 246 LEGNLAAYNFELSDEQMKFLDH 267

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  249 bits (636), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 181/280 (64%), Gaps = 12/280 (4%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           L++G  +P +G GTY+ P+ +   +V+ A K GYRH+DTA LY NE E    + K+L+E 
Sbjct: 19  LSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEED 78

Query: 71  PKVSRDQ-VFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLGT 129
           P+ ++ Q VFYTTK+    +GY  AK++I E +E    L Y+DL LIH+P + T +RL T
Sbjct: 79  PEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRRLET 138

Query: 130 YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCK 189
           YKA+QE    G +++IGVS+Y   H++EL +W+ L+ KP+VNQ E++PW+ R+DL  YCK
Sbjct: 139 YKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCK 198

Query: 190 ERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDR 249
            + LV+EAFSP+T   +   P V  + KE+  G    ++LIRWSLQ G+VPLPKS   +R
Sbjct: 199 SKGLVVEAFSPLTHGYKLKHPDVLLVAKET--GTDAGRVLIRWSLQHGYVPLPKSRSVER 256

Query: 250 AESNLHALDFEISAEDMKTLTHDGEHFLAQP-GFDPIETE 288
            + N+ A DFE+S E +         FL QP  ++P + E
Sbjct: 257 LKGNVKAYDFELSPEQVS--------FLDQPQAYEPTDWE 288

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  248 bits (633), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 174/263 (66%), Gaps = 3/263 (1%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69
            L+NG +IP +  GTY+ P+ +   IV+   K GYRH DTA LY NE+E    + K+L E
Sbjct: 7   NLSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 70  SPKVS-RDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLG 128
           +P+ + R+++FYTTK+    +GY++AK +I + L     L+Y+DL LIH+P   ++ RL 
Sbjct: 67  NPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPLEGSKLRLE 126

Query: 129 TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYC 188
           T++A+QE    G +K+IGVS+Y  KH++EL +W  L  KP+VNQ E++PW+ R++L  YC
Sbjct: 127 TWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPDLTYKPVVNQIEISPWVMRQELADYC 186

Query: 189 KERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHED 248
           K + L++EAF+P+    + ++P + K+ KE    R P Q+LIRWSLQ G++PLPK+    
Sbjct: 187 KSKGLIVEAFAPLCHGYKMTNPDLLKVCKEV--DRNPGQVLIRWSLQHGYLPLPKTKTVK 244

Query: 249 RAESNLHALDFEISAEDMKTLTH 271
           R E NL A DFE+  + MK L H
Sbjct: 245 RLEGNLAAYDFELLDKQMKILDH 267

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  248 bits (633), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 120/270 (44%), Positives = 172/270 (63%), Gaps = 3/270 (1%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           M ++   +  L++G  IP +G GTYE P  K   +VH A + GYRH DTA LY NE E  
Sbjct: 1   MELSVPKSYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVG 60

Query: 61  TAVAKFLKESPKVS-RDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP 119
             + K+L E+P  + R  VFYTTK+    HGYEKAKK+I   L+  ++L Y+DL LIH+P
Sbjct: 61  QGIKKWLNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSP 120

Query: 120 CAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWL 179
               + RL TY+A+QE   AGK+++IGVS+Y  +H+EEL +WE L+ KP+VNQ E++PW 
Sbjct: 121 LGGKKLRLETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNWEKLKYKPVVNQIEISPWC 180

Query: 180 TRKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFV 239
            R++L  +CK++ +++EA++P+T   +  DP + K+  E   G    Q LIRWSLQ G++
Sbjct: 181 MRQELADFCKKKGILVEAYAPLTHGTKLKDPDLVKVANEV--GCDVGQALIRWSLQKGYI 238

Query: 240 PLPKSVHEDRAESNLHALDFEISAEDMKTL 269
           PLPK+    R  SNL    FE + + M  L
Sbjct: 239 PLPKTQSVSRLASNLDVFSFEWTTDQMDQL 268

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  243 bits (621), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 161/263 (61%), Gaps = 3/263 (1%)

Query: 8   TKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
           T TLTNG  +P LG G Y  PK     +VH A K GYRH DTA  Y NE E    +A +L
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 68  KESPKVSRDQ-VFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKR 126
            E P  +R Q VFY TK+    +GY +AK +I + L+    L Y+DL LIH+P   + KR
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKR 124

Query: 127 LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVK 186
           L TY+A+QE   AG +K+IGVS+Y   HL+ELY+   L+  P+VNQ E+ PWL R DLV 
Sbjct: 125 LATYEAMQESVDAGIVKSIGVSNYERHHLQELYAMPNLKHNPVVNQIEVTPWLPRNDLVD 184

Query: 187 YCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVH 246
           YCK   L I+A+SP+    R +DP +  L  +     TPAQ+LI WSL  G+ PLPK+ +
Sbjct: 185 YCKSIGLAIQAYSPLGCGDRVNDPYIASLATQK--NCTPAQILIAWSLAKGYAPLPKTQN 242

Query: 247 EDRAESNLHALDFEISAEDMKTL 269
             R +SNL + +  ++AE++  +
Sbjct: 243 IQRLQSNLDSYNVSLTAEELTNI 265

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  241 bits (615), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 169/263 (64%), Gaps = 3/263 (1%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69
           T  NG +IP +  GTY+ P+     IV+ A K GYRH DTA LY NE +    + ++++E
Sbjct: 9   TFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQE 68

Query: 70  SPKVS-RDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLG 128
            P+ + R  VFYTTK+    +GY +A+ +I E L     L+Y+D+ LIH+P     KRL 
Sbjct: 69  DPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRLE 128

Query: 129 TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYC 188
           T++A+QE  ++G +K IGVS+Y  +H+EEL  WE L +KP+VNQ E++PW+ R +L  YC
Sbjct: 129 TWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRSELADYC 188

Query: 189 KERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHED 248
           K   LV+EAF+P+T   +  D  + ++ KE   GR+  Q+LIRWSLQ G++PLPK+    
Sbjct: 189 KSVGLVVEAFAPLTHGYKLHDADLVRVSKEV--GRSTVQVLIRWSLQHGYLPLPKTKTVK 246

Query: 249 RAESNLHALDFEISAEDMKTLTH 271
           R E NL A +F+++ E M+ + H
Sbjct: 247 RLEENLEAYNFQLTTEQMQLIDH 269

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  237 bits (604), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 115/274 (41%), Positives = 172/274 (62%), Gaps = 5/274 (1%)

Query: 1   MSITASTTK--TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERE 58
           MS+T    K   L +G KIP L  GTY+ P      +V  A K GYRH DTA LY NERE
Sbjct: 1   MSVTVDVPKYYELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNERE 60

Query: 59  CATAVAKFLKESPKVS-RDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIH 117
               +  ++ E    + R+ VFYTTK+    +GY +AK++I E ++    L Y+D+ LIH
Sbjct: 61  VGQGIVNWINEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIH 120

Query: 118 NPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNP 177
           +P +   +RL T+KA+QE    G +K+IGVS+Y   H+EEL  W+ L+ KP+VNQ E++P
Sbjct: 121 SPLSGQRRRLETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWDELKYKPVVNQIEISP 180

Query: 178 WLTRKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMG 237
           W+ R++L  YCK  +LV+EA++P+    + +DP ++++ KE+  G  P QLLIRWSLQ G
Sbjct: 181 WVMRQELADYCKSVNLVVEAYAPMAHGYKMNDPGLREISKET--GMNPGQLLIRWSLQHG 238

Query: 238 FVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH 271
           ++PLPK+    R  SNL   + +++ + +K + H
Sbjct: 239 YLPLPKTKTVARLASNLDVYNHKLTLDQVKRMDH 272

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  202 bits (513), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 165/263 (62%), Gaps = 11/263 (4%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           + I   T   L NG +IPV+GFG YE PKE    +V++A K GYRH+DTA LY+N++E A
Sbjct: 5   IDINRETRYKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAA 64

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE-LEYVDLFLIHNP 119
             V K+L E+ + +R+ +++TTK+     G E+ +K++ E     KE + YVDL L+H+P
Sbjct: 65  QGVRKYLDETGE-ARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSP 123

Query: 120 CAETEKRLGTYKALQEFY-----KAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFE 174
               ++RL T+  L++       KA +IK+IGVS++ + HLEEL   +  +VKP+++Q E
Sbjct: 124 RGGAKRRLETWAILEQAVQEPGSKALEIKSIGVSNFGVDHLEELL--KVAKVKPVLDQLE 181

Query: 175 LNPWLTRKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSL 234
           L+PWL R +L KY KE+D+  EA+SP+T+  R  DP +  L  E+  G   A +L+RWS 
Sbjct: 182 LHPWLPRVELRKYLKEKDIFAEAYSPLTQGYRLQDPELLAL--EAKTGINKAVILLRWSF 239

Query: 235 QMGFVPLPKSVHEDRAESNLHAL 257
             GFV L KS + +R   NL  L
Sbjct: 240 LQGFVVLVKSSNPERIRQNLAVL 262

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  189 bits (480), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 99/263 (37%), Positives = 159/263 (60%), Gaps = 11/263 (4%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           + I   T   L NG ++PV+GFG Y+ P E+    V+ A ++GYRH+DTA +YEN+++ A
Sbjct: 5   IDINRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAA 64

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE-LEYVDLFLIHNP 119
             V +FL+E+    R++V++TTK+     G +   +++ E     KE + YVDL L+H+P
Sbjct: 65  QGVHRFLEET-GTPREEVWFTTKLWNTQQGRDATPRALEEIAADVKEFIGYVDLLLLHSP 123

Query: 120 CAETEKRLGTYKALQEFYK-----AGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFE 174
             + ++RL T+  L+   +     A +I+AIGVS++ ++HL+EL   E   VKP+V+Q E
Sbjct: 124 LTDAQRRLETWAVLERAVQEPASSALEIRAIGVSNFGVRHLQELL--EVATVKPVVDQLE 181

Query: 175 LNPWLTRKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSL 234
           L+PWL R +L  + +E  ++ EA+SP+T+  R  DP  + L  E+  G +  ++L+RWS 
Sbjct: 182 LHPWLPRAELRAFLRENGILAEAYSPLTQGVRLQDP--ELLALEAKSGLSKGEILLRWSF 239

Query: 235 QMGFVPLPKSVHEDRAESNLHAL 257
             GF  L KS +  R   NL  L
Sbjct: 240 LQGFAVLVKSNNPQRIRDNLAVL 262

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  169 bits (427), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 169/314 (53%), Gaps = 45/314 (14%)

Query: 4   TASTTKTLTNGVKIPVLGFGTYETPKEK-AESIVHAAFKQGYRHVDTAQLYENERECATA 62
            ++ T  L  G  IP +G GT+++  E      V  A K GYRH+DTA +Y+NE +   A
Sbjct: 7   NSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNEDQVGKA 66

Query: 63  VAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA- 121
           +         + R+++F TTK+ G  H     + ++ +SLE    L+YVDL+L+H P A 
Sbjct: 67  I-----NDSGIPREEIFVTTKLWGTQH--RDPETALNQSLERLG-LDYVDLYLMHWPVAF 118

Query: 122 -------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLE 156
                                     T   + T++ +QE  K GK +A+GVS++SI +L+
Sbjct: 119 KPDSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLK 178

Query: 157 ELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQK 214
            L S  G ++ P  NQ E +P L + +L K+CKE+ +++EA+SP+  T +   ++P + +
Sbjct: 179 ALLSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIE 238

Query: 215 LLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH--- 271
           + K+      PAQ++I W +Q G V LPKSVHE+R ++N     FE+S ++M +L +   
Sbjct: 239 IAKKH--NVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQT--FELSKDEMDSLNNLSK 294

Query: 272 -DGEHFLAQPGFDP 284
             GE  + QP + P
Sbjct: 295 EKGERRIVQPNWAP 308

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  168 bits (426), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 117/320 (36%), Positives = 168/320 (52%), Gaps = 45/320 (14%)

Query: 1   MSITAST-TKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENEREC 59
           MS+  ST T  L  G +IPV+G GT+ +        V AA K GYRH+D A +Y NE + 
Sbjct: 1   MSLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQV 60

Query: 60  ATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP 119
             A+    K+S  V R ++F TTK+ G  H      K++  SL+    L+YVDL+L+H P
Sbjct: 61  GRAI----KDS-GVPRQEIFITTKLWGTEH--RNPAKALDSSLKRLG-LDYVDLYLMHWP 112

Query: 120 CA--------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIK 153
            A                          E    + T++ +QE  K GK KAIGVS++SI 
Sbjct: 113 VALKAHGSEEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSIN 172

Query: 154 HLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR--FSDPV 211
           +L+ L +       P  NQ E++P   + +L++YCK  +++IEA+SP   +      +P 
Sbjct: 173 NLKALKNSPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPE 232

Query: 212 VQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH 271
           + K L E Y   T AQL+I WS+Q G+V LPKSVH +R E+NL  L  +   EDM+T+T+
Sbjct: 233 LHK-LAEKYNIST-AQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLK--DEDMETITN 288

Query: 272 ----DGEHFLAQPGFDPIET 287
                GE  L Q  + P  T
Sbjct: 289 LSKVKGEKRLVQLDWSPFPT 308

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  167 bits (424), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 114/322 (35%), Positives = 175/322 (54%), Gaps = 48/322 (14%)

Query: 1   MSITASTTKT-LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENEREC 59
           MS+    T+  L  G ++P +G GT+++ +  A   V  A K GYRH+D A +Y NE E 
Sbjct: 1   MSLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGE- 59

Query: 60  ATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP 119
              V K +++S  V R+++F TTK+ G        + ++ +SLE    L+YVDL+LIH P
Sbjct: 60  ---VGKAIRDS-GVPRNEIFVTTKLWGTQQ--RTPQLALEQSLERLG-LDYVDLYLIHWP 112

Query: 120 -------CAETEKRLG--------------------TYKALQEFYKAGKIKAIGVSSYSI 152
                  C E+   L                     T++ +QE    GK KA+GVS++SI
Sbjct: 113 IPLNPAQCEESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSI 172

Query: 153 KHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDP 210
            +++EL S  G ++ P VNQ EL+P L + +LV +CKE+ +V+EA+SP+  T +    +P
Sbjct: 173 NNIKELLSSPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEP 232

Query: 211 VVQKLLKE-SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
           +V++L K+ + P    A L++ W +Q G V LPKSV E R  SNL  L   ++ ED++ +
Sbjct: 233 LVEELAKKYNIPA---ANLVVSWDVQRGVVVLPKSVTESRIISNLQTLT--LAPEDVEKI 287

Query: 270 TH----DGEHFLAQPGFDPIET 287
           T+     GE     P F P  T
Sbjct: 288 TNLSKEKGEKRTCAPDFSPFNT 309

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  167 bits (424), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 105/301 (34%), Positives = 170/301 (56%), Gaps = 41/301 (13%)

Query: 1   MSITASTTKT--LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERE 58
           M++T++ T +  L  G  +P +G GT+++ +E A + V +A K GY+H+DTA +Y NER 
Sbjct: 1   MTVTSTKTPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNER- 59

Query: 59  CATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHN 118
              AV K +++S  + RD++F TTK+    H   KA  ++  SLE    L+YVDL+LIH 
Sbjct: 60  ---AVGKAIRDS-GIPRDELFITTKLWSTQHRDPKA--ALDGSLERLG-LDYVDLYLIHY 112

Query: 119 PCAETEKRL--------------------------GTYKALQEFYKAGKIKAIGVSSYSI 152
           P A    R+                           T++ +Q   ++GK KA+GVS++SI
Sbjct: 113 PVAFKTDRIEDGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSI 172

Query: 153 KHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDP 210
            +L+ L   +     P VNQ E++P L + +L+ +CK +D+V+EA+SP+  T S+  +D 
Sbjct: 173 NNLKTLLESDEKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDD 232

Query: 211 VVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLT 270
            +QK+ ++    + PAQ+LI W +  G+  LPKSV   R E+N   +D  I  ED+  +T
Sbjct: 233 TLQKIAEKXXDAQ-PAQILINWGISRGYCVLPKSVTPKRIEANARIID--IKKEDLLKVT 289

Query: 271 H 271
           +
Sbjct: 290 N 290

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  167 bits (423), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 176/321 (54%), Gaps = 47/321 (14%)

Query: 1   MSIT---ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENER 57
           MS T   ++ T +L  G +IP +G GT+++    A   V AA K GY+H+DTA +Y NE 
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIH 117
           +   A+    K+S  V R+++F TTK+    H +E A K++ ESL+    L+YVDL+LIH
Sbjct: 61  QVGQAI----KDS-GVPREEIFVTTKLWSTQH-HEPA-KALDESLQRLG-LDYVDLYLIH 112

Query: 118 NPC------------------AETEKR--------LGTYKALQEFYKAGKIKAIGVSSYS 151
            P                   A+  +         + T++ +QE  K GK KAIGVS++S
Sbjct: 113 WPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFS 172

Query: 152 IKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSD 209
           I +L++L +  G ++ P  NQ E++P L + +L+ +CK + ++IEA+SP+  T +    +
Sbjct: 173 INNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKE 232

Query: 210 PVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
           P + K+ K++     P  ++I W  Q G+V LPKSV+ DR E+N     F +S ED + +
Sbjct: 233 PTILKIAKKN--NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAI 288

Query: 270 TH----DGEHFLAQPGFDPIE 286
            +     GE  +  P + P E
Sbjct: 289 NNISKEKGEKRVVNPNWSPFE 309

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  164 bits (416), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/306 (34%), Positives = 164/306 (53%), Gaps = 44/306 (14%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           L  G  IPV+G GT+++P+E A + V +A + GYRH+DTA +Y NE     AV K +++S
Sbjct: 12  LNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEE----AVGKGIRDS 67

Query: 71  PKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA--------- 121
             V R+++F TTK+ G      +A   +  SL+    L+YVDL+LIH P           
Sbjct: 68  -GVPREEIFVTTKLWGTQQRDPEAALDL--SLQRLG-LDYVDLYLIHWPVPLNASSITDG 123

Query: 122 -----------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGL 164
                            E    + T++ +Q   K+GK KAIGVS++SIK++E L +    
Sbjct: 124 NYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPD 183

Query: 165 EVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR--FSDPVVQKLLKESYPG 222
            + P  NQ E++P L + +L+ YCK + ++IEA+SP+  S     +DP ++ +   S   
Sbjct: 184 FIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGI--ASKYN 241

Query: 223 RTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQ--- 279
             PA +LI W    G+V LPKSV+  R ++NL  LD  +S ED++ +    E   A+   
Sbjct: 242 AEPANILISWGASRGYVVLPKSVNPQRIKTNLKLLD--LSTEDLEKINKLTESVGAKRYV 299

Query: 280 -PGFDP 284
            P F P
Sbjct: 300 APDFSP 305

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  162 bits (409), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 171/310 (55%), Gaps = 44/310 (14%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69
           +L  G +IP +G GT+++ +  A   V  A K GYRH+DTA +Y NE +   A+    K+
Sbjct: 13  SLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI----KD 68

Query: 70  SPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC--------- 120
           S  V R+++F TTK+    H   + + ++ +SL+    L+YVDL+L+H P          
Sbjct: 69  S-GVPREEIFVTTKLWCTQH--HEPEVALDQSLKRLG-LDYVDLYLMHWPARLDPAYIKN 124

Query: 121 -----AETEKR------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEG 163
                  T+K             + T++ +QE  K GK KA+GVS++SI +L++L + +G
Sbjct: 125 EDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQG 184

Query: 164 LEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLKESYP 221
            ++ P  NQ E++P L + +L+ +CK + +V+EA+SP+  T +    +PV+ ++ K++  
Sbjct: 185 NKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN-- 242

Query: 222 GRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH----DGEHFL 277
              P  ++I W +Q G+V LPKSV+ DR ++N     F +S ED + + +     GE  +
Sbjct: 243 NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAINNISKEKGEKRV 300

Query: 278 AQPGFDPIET 287
             P + P E 
Sbjct: 301 VHPNWSPFEV 310

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  160 bits (406), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 108/301 (35%), Positives = 165/301 (54%), Gaps = 45/301 (14%)

Query: 1   MSI---TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENER 57
           MSI    +S T  L  G  IP LG GT+ +  E+A + V +A K GYRH+D+A +Y NE 
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAG-DNHGYEKAKKSIIESLEMAKELEYVDLFLI 116
                V K +++S  V R+++F TTK+ G      EKA  + ++ L     L+YVDL+LI
Sbjct: 61  ----PVGKAIRDS-GVPRNELFVTTKLWGTQQRNPEKALDASLKRL----GLDYVDLYLI 111

Query: 117 HNPCAETEKRL--------------------------GTYKALQEFYKAGKIKAIGVSSY 150
           H P A     +                           T++ +QE    GK KA+GVS++
Sbjct: 112 HWPIAFKTDNIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNF 171

Query: 151 SIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFS 208
           S+ +L+EL +  G ++ P  NQ EL+P L + +L+++ K + +VIEA+SP+    S    
Sbjct: 172 SVNNLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLK 231

Query: 209 DPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKT 268
           +PV+ ++ K+   G  PAQ+LI W +Q G+V LPKSV+  R ESN     F++S ED+  
Sbjct: 232 EPVIIEVAKKY--GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV--FDLSKEDVDR 287

Query: 269 L 269
           +
Sbjct: 288 I 288

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  160 bits (405), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/319 (32%), Positives = 176/319 (55%), Gaps = 48/319 (15%)

Query: 1   MSITASTTK-TLTNGVKIPVLGFGTYETPKEKA--ESIVHAAFKQGYRHVDTAQLYENER 57
           MS + STT   L  G  I  +G GT+++  E    E+++ AA K GYRH+DTA +Y NE 
Sbjct: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVI-AALKAGYRHIDTAAIYGNEG 70

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIH 117
           +   A+         V R+++F TTK+    H    A   + +SL+    L+YVDL+L+H
Sbjct: 71  QVGKAI-----NDSGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLG-LDYVDLYLMH 122

Query: 118 NPCA--------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYS 151
            P                            +T   + T++ +QE  K GK +A+GVS++S
Sbjct: 123 WPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFS 182

Query: 152 IKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSD 209
           I +L+++ S  G +V P VNQ E++P L +++L+++C  + +++EA+SP+  T +   ++
Sbjct: 183 INNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTE 242

Query: 210 PVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
           PV+  L K+   G   AQ++I W +Q G++ LPKSVH +R ++N   L  ++S E+M+ +
Sbjct: 243 PVLINLAKKH--GVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTL--KLSDEEMREI 298

Query: 270 TH----DGEHFLAQPGFDP 284
            +     GE  + QP ++P
Sbjct: 299 NNISKEKGERRIVQPHWEP 317

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  160 bits (405), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/314 (33%), Positives = 171/314 (54%), Gaps = 44/314 (14%)

Query: 5   ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVA 64
           ++ T  L  G KIP +G GT+++    A   V AA K GYRH+DTA +Y NE +   A+ 
Sbjct: 8   STKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNEDQVGQAI- 66

Query: 65  KFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC---- 120
              K+S  V R+++F TTK+    H +E AK ++ +SL+    L+YVDL+L+H P     
Sbjct: 67  ---KDS-GVPREEIFVTTKLWCTQH-HEPAK-ALDQSLKRLG-LDYVDLYLMHWPVRLDP 119

Query: 121 -------------AETEKR---------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL 158
                         E   R         + T++ +QE  K  K +A+GVS++SI +L++L
Sbjct: 120 NYIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDL 179

Query: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLL 216
            +  G ++ P  NQ EL+P L + +L+ +CK + +++EA+SP+  T +    +PVV ++ 
Sbjct: 180 LASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIA 239

Query: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH----D 272
           K++     P  ++I W  Q G+V LPKSV+ DR ++N     F +S ED + + +     
Sbjct: 240 KKN--NVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKV--FTLSDEDFEAINNISKEK 295

Query: 273 GEHFLAQPGFDPIE 286
           GE  +  P + P E
Sbjct: 296 GEKRVVNPDWSPFE 309

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  159 bits (403), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 102/314 (32%), Positives = 170/314 (54%), Gaps = 44/314 (14%)

Query: 5   ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVA 64
           ++ T +L  G +IP +G GT+++    A   V AA K GYRH+DTA +Y NE +   A+ 
Sbjct: 8   STRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI- 66

Query: 65  KFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC---- 120
                   V R+++F TTK+    H +E A K++ +SL     L+YVDL+L+H P     
Sbjct: 67  ----RDSGVPREKIFVTTKLWCTQH-HEPA-KALDQSLRRLG-LDYVDLYLMHWPVRLDP 119

Query: 121 ---------AETEKRLG-------------TYKALQEFYKAGKIKAIGVSSYSIKHLEEL 158
                    +   K+ G             T++ +QE  K GK KA+GVS++SI +L++L
Sbjct: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179

Query: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLL 216
            + +G ++ P  NQ E++P L + +L+ +C+ + ++IE +SP+  T +    +PV+ ++ 
Sbjct: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239

Query: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH----D 272
           K++     PA ++I W  Q G+V LPKSV+ DR ++N     F +S ED + +       
Sbjct: 240 KKN--NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAINGISKAK 295

Query: 273 GEHFLAQPGFDPIE 286
           GE  +  P + P E
Sbjct: 296 GEKRVVHPNWSPFE 309

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  158 bits (400), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 106/313 (33%), Positives = 167/313 (53%), Gaps = 44/313 (14%)

Query: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63
            + T  TL NG KIP +G GT+++ +    + V  A K GYRH+DTA +Y NE E   A+
Sbjct: 7   NSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEGEVGRAI 66

Query: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA-- 121
               K+S  V RDQ+F TTK+      ++  K+++  SL+    L+YVDL+L+H P    
Sbjct: 67  ----KDS-GVPRDQIFITTKLWCTE--FQNPKRALESSLKRLG-LDYVDLYLMHWPVVLN 118

Query: 122 ------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                                   ET   + T++ +QE    G  +++GVS++SI +LE+
Sbjct: 119 PRYIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEK 178

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLK 217
           + S  G ++ P VNQ EL+P L + +L KYC  + + +EA+SP       +  + QK + 
Sbjct: 179 VLSSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDN--APNLKQKTIV 236

Query: 218 E--SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH---- 271
           +  +  G +PAQ++  W +Q   V LPKSVHE+R  SN     F++S ED+  +      
Sbjct: 237 DIAAKNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKV--FDLSKEDIAEIDALAKV 294

Query: 272 DGEHFLAQPGFDP 284
           +GE  + +P +DP
Sbjct: 295 NGEKRINKPDWDP 307

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  157 bits (398), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 155/277 (55%), Gaps = 37/277 (13%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           L  G  IP+LGFGT+ + +E+  + V +A K GYRH+D+A +Y NE     AV + +++S
Sbjct: 13  LNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNE----AAVGRAIRDS 68

Query: 71  PKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLG-- 128
             V R+++F TTK+   N    +  K++ +SL+    L+YVDL+LIH P      R+   
Sbjct: 69  -GVPREELFVTTKLW--NTQQREPAKALDQSLQRLG-LDYVDLYLIHWPLPIKTDRITDG 124

Query: 129 -----------------------TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLE 165
                                  T++ +QE    GK +A+GVS+ S+  LE+L + +G +
Sbjct: 125 NLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKGNK 184

Query: 166 VKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQKLLKESYPGR 223
           V P V Q E +P L +  L+ +C + D+++EA+SP+    S    +PV++++ K+     
Sbjct: 185 VVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKY--NA 242

Query: 224 TPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFE 260
            PAQ++I W ++ G+V LPKSV   R +SNL  LD E
Sbjct: 243 DPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLE 279

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  157 bits (397), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 150/283 (53%), Gaps = 37/283 (13%)

Query: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63
            +S    L  G  IP+LGFGT+ + +E   + V  A K GYRH+DTA +Y NE     AV
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNE----AAV 61

Query: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAET 123
            + +++S  V RDQ+F TTK+    H     + ++ +SL+    L+YVDL+LIH P    
Sbjct: 62  GRAIRDS-GVPRDQLFVTTKLWNTQH--RDPRLALDQSLQRLG-LDYVDLYLIHWPLPLR 117

Query: 124 EKRLG-------------------------TYKALQEFYKAGKIKAIGVSSYSIKHLEEL 158
            +R+                          T++ +Q+     K +A+GVS++S+  L+ L
Sbjct: 118 TQRITDGNLFTVPTKEDGKPDVDEQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNL 177

Query: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQKLL 216
            +  G +V P VNQ E +P L +  L K+C E ++++EA+SP+    S    +P V+++ 
Sbjct: 178 LAASGTKVIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEI- 236

Query: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDF 259
             S     PAQ+LI W ++ G+V LPKSV   R ESN   +D 
Sbjct: 237 -ASKHNADPAQVLISWGIKRGYVILPKSVTPSRIESNFKIVDL 278

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  157 bits (398), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 157/296 (53%), Gaps = 40/296 (13%)

Query: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63
            +S T  L  G  IPVLGFGT+ +        V AA K GYRH+D A +Y NE E   A+
Sbjct: 7   NSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66

Query: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAET 123
               K+S  V R+++F TTK+ G      +A  ++ +SL+    L+YVDL+L+H P    
Sbjct: 67  ----KDS-GVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLG-LDYVDLYLMHWPVPLK 118

Query: 124 EKR--------------------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
             R                          + T++ +QE  K GK KA+GVS++SI +++E
Sbjct: 119 TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKE 178

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKL 215
           L      +V P  NQ E++P L + +L+ +CKE+ +V+EA+SP     +    +  +  +
Sbjct: 179 LLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDM 238

Query: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH 271
            K+   G  PAQL+I WS+Q G+V L KSV+ +R  SN     F +  +D KT+++
Sbjct: 239 AKKH--GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISN 290

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  157 bits (397), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 102/315 (32%), Positives = 172/315 (54%), Gaps = 46/315 (14%)

Query: 6   STTKTL--TNGVKIPVLGFGTYETPKEK-AESIVHAAFKQGYRHVDTAQLYENERECATA 62
           ++TKTL   +G +IP++G GT++   E+ A + V AA   GYRH+DTA +Y+NE +   A
Sbjct: 7   NSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEA 66

Query: 63  VAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA- 121
           +         V R+++F TTK+    H   + + ++ ESL+    L+YVDL+L+H P + 
Sbjct: 67  I-----RDSGVPREEIFVTTKLWNAQH--HEPEVALDESLQRLG-LDYVDLYLMHWPVSL 118

Query: 122 ----------ETEKR-------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL 158
                     E  KR             + T++ +Q+  K  K+++IGVS++S+ +L++L
Sbjct: 119 DKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177

Query: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLL 216
                  V P +NQ EL+P L + +LV YC++  + +EA+SP+  T +   S+P+V  + 
Sbjct: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237

Query: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL----THD 272
           K++  G  PA +++ W +Q   + LPKSVH +R  +NL    F +  ED   +       
Sbjct: 238 KKN--GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPEEDFDAIGKISQQR 293

Query: 273 GEHFLAQPGFDPIET 287
           GE  +  P F+P +T
Sbjct: 294 GERRINNPNFEPFKT 308

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  157 bits (396), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 166/311 (53%), Gaps = 45/311 (14%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           ++T  L  G  IPV+G GT+++ + +  +    A K GYRH+DTA +Y+NE E   A+  
Sbjct: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI-- 65

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA---- 121
                  + R+++F TTK+ G  H      +++ +SL+    L+YVDL+L+H P A    
Sbjct: 66  ---RDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTD 119

Query: 122 ----------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELY 159
                                 E    + T++ +QE  K  K +AIGVS++SI +L+EL 
Sbjct: 120 LIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELL 178

Query: 160 SWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLK 217
           + +G +V P  NQ E++P L + +L+ +CKE+ +V+EA+SP+  T +    +  + ++ K
Sbjct: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAK 238

Query: 218 ESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH----DG 273
           ++  G    QL+I W  Q G+V LPKSV  +R   N     F++S ED  TL++     G
Sbjct: 239 KN--GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSNYAKKHG 294

Query: 274 EHFLAQPGFDP 284
           E  +  P + P
Sbjct: 295 ERRVVSPNWGP 305

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  154 bits (390), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 118/318 (37%), Positives = 169/318 (53%), Gaps = 50/318 (15%)

Query: 2   SITAST-TKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           ++ AST T TL  G KIP+ G GT+++  + A S V AA K GY+H+DTA  Y+NE    
Sbjct: 6   TLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEE--- 62

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMA-KEL--EYVDLFLIH 117
             V K +KES  + R+++F TTKV  D       ++    +L+++ K+L  EYVDL L+H
Sbjct: 63  -LVGKAVKES-GIPREELFITTKVWNDQ------QRDPAGALDLSLKKLGTEYVDLLLMH 114

Query: 118 NPCAETEKR-------------------------LGTYKALQEFYKAGKIKAIGVSSYSI 152
            P    E                           + T+  +Q+    GK+KAIGVS++SI
Sbjct: 115 WPVPFKEPENSTLDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSNFSI 174

Query: 153 KHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR--FSDP 210
            +LEEL + EG  V P VNQ EL+  L + +LV+YC+++ +V+EA+SP+  S      D 
Sbjct: 175 NNLEELLNAEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDA 234

Query: 211 VVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLT 270
            V K + E Y G TPA +L+ +    G V LPKSV E R  SN     F++  ED+K L 
Sbjct: 235 TVNK-VAEKY-GVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEY--FKMDEEDIKLLN 290

Query: 271 H----DGEHFLAQPGFDP 284
                +G      P F P
Sbjct: 291 DIHKKEGVQRFVDPDFSP 308

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  154 bits (389), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 159/296 (53%), Gaps = 40/296 (13%)

Query: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63
            +S T  L  G  IPVLGFGT+ +        V AA K GYRH+D A +Y NE E    V
Sbjct: 7   NSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEEE----V 62

Query: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP---- 119
            K +K+S  V R+++F TTK+ G      +A  ++ +SL+    L+YVDL+L+H P    
Sbjct: 63  GKAIKDS-GVPREEIFITTKLWGTEQRDPEA--ALDKSLKRLG-LDYVDLYLMHWPVPLK 118

Query: 120 ----------CAETEKR------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                     C  T +             + T+  +Q+  K GK KA+GVS++SI +++E
Sbjct: 119 TDTITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKE 178

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKL 215
           L      ++ P  NQ E++P L + +L+ +CKE+ +V+EA+SP     +    +  +  +
Sbjct: 179 LLKSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDM 238

Query: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH 271
            K+   G  PAQL+I WS+Q G+V L KSV+ +R  SN     F +  +D KT+++
Sbjct: 239 AKKH--GVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKTISN 290

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  154 bits (389), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 155/304 (50%), Gaps = 42/304 (13%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           L  G  IP LGFGT+ +    A + V  A K GYRH+D A +Y NE     AV K +++S
Sbjct: 13  LNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNE----AAVGKGIRDS 68

Query: 71  PKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC---------- 120
             + R+++F TTK+   N        ++ ESLE    L+YVDLFLIH P           
Sbjct: 69  -GIPREEIFVTTKLW--NTQQRDPASALDESLERLG-LDYVDLFLIHWPVPLKPVGGPEN 124

Query: 121 --------------AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEV 166
                          E    + T++ +Q   K GK +A+GVS++SIK+LE+L +     +
Sbjct: 125 LLKYPTPGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVL 184

Query: 167 KPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLKESYPGRT 224
            P VNQFE++P L + +L+ YCK + +V+EA+ P+  + S   SDP + ++  + +    
Sbjct: 185 VPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYH--VK 242

Query: 225 PAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHF----LAQP 280
           PA +LI W +  G+  LPKS    R  SN   +   +S ED + +T   E         P
Sbjct: 243 PANVLINWGISRGYCVLPKSFTPARIASNKTPV--HLSREDTERITKLSETLGVKRYVHP 300

Query: 281 GFDP 284
            F+P
Sbjct: 301 DFEP 304

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  153 bits (386), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 161/289 (55%), Gaps = 42/289 (14%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           +  G  IPVLG GT++         V AA + GYRH+DTA +Y NE     AV + +++S
Sbjct: 8   MNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNE----AAVGRAIRDS 63

Query: 71  PKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA--------- 121
             V R+++F TTK+          + ++  SLE    L+YVDL+L+H P A         
Sbjct: 64  -GVPREKIFVTTKLWCTQQ--RDPQSALNASLERLG-LDYVDLYLMHFPVALKTDLIKDG 119

Query: 122 -----------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWE-G 163
                            +    + T++ +Q+  K+GK KAIGVS++SIK++EE+   E G
Sbjct: 120 NVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELG 179

Query: 164 LEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLKESYP 221
           L V P  NQ E++P L + +L++YCK + +++EA+SP+  + S   +DP + KL ++   
Sbjct: 180 LSV-PAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQ- 237

Query: 222 GRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLT 270
              PAQ+LI W +  G+  LPKSV+  R +SNL  +  ++S+ D++ ++
Sbjct: 238 -VEPAQILISWGVTRGYCILPKSVNSKRVQSNLKIV--KLSSNDVQQIS 283

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  153 bits (386), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 161/289 (55%), Gaps = 42/289 (14%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           +  G  IPVLG GT++         V AA + GYRH+DTA +Y NE     AV + +++S
Sbjct: 8   MNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNE----AAVGRAIRDS 63

Query: 71  PKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA--------- 121
             V R+++F TTK+          + ++  SLE    L+YVDL+L+H P A         
Sbjct: 64  -GVPREKIFVTTKLWCTQQ--RDPQSALNASLERLG-LDYVDLYLMHFPVALKTDLIKDG 119

Query: 122 -----------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWE-G 163
                            +    + T++ +Q+  K+GK KAIGVS++SIK++EE+   E G
Sbjct: 120 NVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELG 179

Query: 164 LEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLKESYP 221
           L V P  NQ E++P L + +L++YCK + +++EA+SP+  + S   +DP + KL ++   
Sbjct: 180 LSV-PAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQ- 237

Query: 222 GRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLT 270
              PAQ+LI W +  G+  LPKSV+  R +SNL  +  ++S+ D++ ++
Sbjct: 238 -VEPAQILISWGVTRGYCILPKSVNSKRVQSNLKIV--KLSSNDVQQIS 283

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  153 bits (386), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 160/304 (52%), Gaps = 38/304 (12%)

Query: 5   ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVA 64
           +++   L  G  IP++G GTY +  E     V  A K GYRH+D A LY+NE      V 
Sbjct: 7   STSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNE----DFVG 62

Query: 65  KFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETE 124
           + +++S  V R+++F TTKV    H   +  K++ ESL     L+YVDLFL+H P A   
Sbjct: 63  RAIRDS-GVPREELFVTTKVWNTQH--REPAKALEESLSRLG-LDYVDLFLMHWPQALRT 118

Query: 125 KRLG-------------------------TYKALQEFYKAGKIKAIGVSSYSIKHLEELY 159
           +R+                          T+  +Q+   +GK KA+GVS++S+K LE+L 
Sbjct: 119 ERITDGNMITVPKREDEKPDVDTEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLL 178

Query: 160 SWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR--FSDPVVQKLLK 217
           +  G +V P  NQ E++P L +  L  +CK++++++ A+SP+   K     DPV+ ++  
Sbjct: 179 ADPGSKVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAA 238

Query: 218 ESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEIS-AEDMKTLTHDGEHF 276
           +      PAQ++I W ++ G+V LPKSV   R ESNL  ++   S  E +  +   GE  
Sbjct: 239 KH--KADPAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHKKGEKR 296

Query: 277 LAQP 280
           +  P
Sbjct: 297 VVDP 300

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  152 bits (383), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 157/296 (53%), Gaps = 40/296 (13%)

Query: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63
            +S +  L  G  IPVLGFGT+ + +      V AA K GYRH+D A +Y NE E    V
Sbjct: 7   NSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEE----V 62

Query: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC--- 120
            + +K+S  V R+ +F TTK+ G      +A  ++ ESL+    L+YVDL+L+H P    
Sbjct: 63  GRAIKDS-GVPREDIFITTKLWGTEQRDPEA--ALNESLKRLG-LDYVDLYLMHWPVPLK 118

Query: 121 -------------------AETEKR----LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                               + + R    + T+  +QE  K GK KA+GVS++SI +++ 
Sbjct: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKL 215
           L      ++ P  NQ E++P L + +L+ +CKE+ +V+EA+SP     +    +  +  +
Sbjct: 179 LLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDM 238

Query: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH 271
            K+   G  PAQL+I WS+Q G+V L KSV+ +R  SN     F +  +D K +++
Sbjct: 239 AKKH--GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  150 bits (379), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 156/294 (53%), Gaps = 40/294 (13%)

Query: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63
            +S T  L  G  IP LGFGT+ +        V AA K GYRH+D A +Y NE E    V
Sbjct: 7   NSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEE----V 62

Query: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP---- 119
            + +K+S  ++R+++F TTK+ G      +A  ++ ESL+    L+YVDL+L+H P    
Sbjct: 63  GRAIKDS-GIAREEIFITTKLWGTEQRDPEA--ALNESLKRLG-LDYVDLYLMHWPVPLK 118

Query: 120 ----------CAETEKR------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                     C  T +             + T+  +QE  K GK +A+GVS++SI +++E
Sbjct: 119 TDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKE 178

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR--FSDPVVQKL 215
           L      ++ P  NQ E++P L + +L+ +CKE+ +V+EA+SP   +      +  +  +
Sbjct: 179 LLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDM 238

Query: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
            K+   G  P+QL+I WS+Q G+V L KSV+ +R  SN     F +  +D K +
Sbjct: 239 AKKH--GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKAI 288

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  149 bits (377), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 151/286 (52%), Gaps = 37/286 (12%)

Query: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63
            +++T  L  G  IP +G GT+ + + +    V  A K GYRH+D A +Y NE E   A+
Sbjct: 6   NSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI 65

Query: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAE- 122
                +   V R+++F TTK+          ++++ +SL+    L+YVDL+LIH P    
Sbjct: 66  -----QDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLG-LDYVDLYLIHWPVPLR 117

Query: 123 ------------TEKRLG------------TYKALQEFYKAGKIKAIGVSSYSIKHLEEL 158
                        EK  G            T++ +Q+  ++GK KAIGVS++S+ +L++L
Sbjct: 118 TENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177

Query: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPIT--RSKRFSDPVVQKLL 216
            +    +V P VNQ EL+P L ++DL+K+ KE  +VIEA+SP+    +   SDP VQ++ 
Sbjct: 178 LAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIA 237

Query: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEIS 262
           K +  G     ++I W++Q G V LPKSV   R   NL  L    S
Sbjct: 238 KAN--GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDS 281

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  149 bits (377), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/320 (31%), Positives = 177/320 (55%), Gaps = 48/320 (15%)

Query: 1   MSITASTTKTL---TNGVKIPVLGFGTYETPKE-KAESIVHAAFKQGYRHVDTAQLYENE 56
           MS T S   +L     G  I  +G GT+ +     A   V AA + GYRH+DTA +Y NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 57  RECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLI 116
            E    V + ++ES  V R ++F TTK+    H  ++ + ++ +SL+    L+YVDL+L+
Sbjct: 61  AE----VGRAIRES-GVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLG-LDYVDLYLM 112

Query: 117 HNPC-----------------AETEKR---------LGTYKALQEFYKAGKIKAIGVSSY 150
           H P                      KR         + T++ +Q+  + GK +AIGVS++
Sbjct: 113 HWPVRMRGENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNF 172

Query: 151 SIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR--FS 208
           SI +L++L +  G ++ P  NQ E++P L +++LV +C  + +VIEA+SP+  +      
Sbjct: 173 SINNLKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILK 232

Query: 209 DPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKT 268
           +PV+ ++ K++  G + AQ++I W++Q G++ LPKSV+++R E+NL  L F +++ED + 
Sbjct: 233 EPVIIEIAKKN--GVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEA 288

Query: 269 LTH----DGEHFLAQPGFDP 284
           + +     G   +  P ++P
Sbjct: 289 VNNISKVQGTKRIIDPDWEP 308

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  149 bits (375), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 151/294 (51%), Gaps = 39/294 (13%)

Query: 5   ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVA 64
            + T  L  G  IP +G GT+ +        V AA K GYRH+DTA +Y NE +   A+ 
Sbjct: 8   CTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNEDQVGKAIN 67

Query: 65  KFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA--- 121
           +       V+R ++F TTK+ G        + ++ +SL+    L+YVDL+LIH P A   
Sbjct: 68  EC-----GVTRSELFVTTKLWGTQQ--RDPETALNQSLKRLG-LDYVDLYLIHWPVAFKT 119

Query: 122 ETEKR----------------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELY 159
           +T K                       + T++ +Q   K GK KAIG+S++SI +++EL 
Sbjct: 120 DTIKDGNLLTIPKKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 160 SWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLK 217
           +     V P  NQ E++P L + +L+ +CKE+ +VIEA+SP+    +    D  + ++ K
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 218 ESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH 271
            +       Q++  W +Q G+V LPKSV E R  SNL    F +S +DM  + +
Sbjct: 240 RN--NVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKT--FTLSDDDMTKINN 289

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  148 bits (373), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 105/319 (32%), Positives = 175/319 (54%), Gaps = 49/319 (15%)

Query: 1   MSITASTTK-TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENEREC 59
           M+++ ST K TL +G ++P +G GT+++ +  A   V AA K GYRH+DTA +Y NE E 
Sbjct: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEE- 59

Query: 60  ATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP 119
              V + +K+S  V R ++F TTK+ G  H +     ++ +SLE    L+YVDL+L+H P
Sbjct: 60  ---VGRAIKDS-GVRRSEIFVTTKLWGTQHRH--PDDALNQSLERLG-LDYVDLYLMHWP 112

Query: 120 CAETEKR---------------------------LGTYKALQEFYKAGKIKAIGVSSYSI 152
               + +                           + T++ +Q   K+ K+K+IGVS++SI
Sbjct: 113 VPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSI 171

Query: 153 KHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDP 210
            ++++L +  G +  P+VNQ EL+P L + +LV++CK +++V+EA+SP+  T +      
Sbjct: 172 NNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELG 231

Query: 211 VVQKLLKE-SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
            + ++ K+ + P   PA ++  W +Q   V LPKSV E R  SNL  +  E+ AE+   L
Sbjct: 232 TINEVSKKLAIP---PANVVFSWLIQRKIVVLPKSVTESRIISNLQTM--ELPAEEFSKL 286

Query: 270 THD----GEHFLAQPGFDP 284
            +     GE    +P + P
Sbjct: 287 NNISSEVGEKRSVKPNWTP 305

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  143 bits (361), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 98/311 (31%), Positives = 159/311 (51%), Gaps = 46/311 (14%)

Query: 1   MSITAST---TKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENER 57
           MS+TA     T  +    KIP +  GT++    +  + V  A K GYRH+D A +Y NE 
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAG-DNHGYEKAKKSIIESLEMAKELEYVDLFLI 116
           E    V K +++S  + R  +F TTK+ G +     +A  S ++ L     L+YVDL+L+
Sbjct: 61  E----VGKAIRDS-GIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLG----LDYVDLYLM 111

Query: 117 HNPCA--------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSY 150
           H P A                          E    + T++ +QE     K KAIGVS++
Sbjct: 112 HWPVALKADSITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQEL-PTSKAKAIGVSNF 170

Query: 151 SIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSK--RFS 208
           SI +L EL +    +  P  NQFE++P L + +L+KYC+++ +++EA+ P+  S     +
Sbjct: 171 SINNLNELLAAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVT 230

Query: 209 DPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKT 268
           +PV+ ++  +   G    QLLI W +Q G+V LPKSV ++R  +N   +   I AE+ + 
Sbjct: 231 NPVITEIATKL--GVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTI--TIPAEEFEK 286

Query: 269 LTHDGEHFLAQ 279
           + +  + F  Q
Sbjct: 287 MNNLTKEFGVQ 297

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  142 bits (358), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 90/293 (30%), Positives = 155/293 (52%), Gaps = 39/293 (13%)

Query: 5   ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVA 64
            + T  L  G +IP+LG GT+ + KE   +   AA K GYRH+D A +  NE+     V 
Sbjct: 8   CTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ----VVG 63

Query: 65  KFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA--- 121
           + +++S  V R+++F TTK+    H     K ++ +SL+    L+YVDL+++H P A   
Sbjct: 64  RAIRDS-GVPREELFVTTKLWCTQH--RDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRS 119

Query: 122 ----------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELY 159
                                 E    + T++ +QE    GK  A+GV+++S+  L++L 
Sbjct: 120 EQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179

Query: 160 SWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQKLLK 217
              G ++ P  +Q E +P+L +  ++ +CK+ ++++EA+SP+    +    +PVV+++ K
Sbjct: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239

Query: 218 ESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLT 270
           + +    PAQLL+ W LQ G   L KS    R E+NLH   F+I   D++ + 
Sbjct: 240 KLH--VEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT--FDIPEGDLRRIN 288

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  140 bits (354), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 157/301 (52%), Gaps = 46/301 (15%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           +S   ST K L  G  IP +G GT+ + +      V AA K GYRH+D A +Y NE E  
Sbjct: 5   LSNNTSTVK-LNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEE-- 61

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE---LEYVDLFLIH 117
             V K +++S  + R+++F TTK+      +   +++  E+LE + E   LEYVDL+L+H
Sbjct: 62  --VGKAIRDS-GIPREELFITTKL------WNTQQRNPQEALEQSLERLGLEYVDLYLMH 112

Query: 118 NPCAETEKRLG-------------------------TYKALQEFYKAGKIKAIGVSSYSI 152
            P     KR+                          T++ +QE  K  K +++GVS++SI
Sbjct: 113 WPVPLKTKRITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSI 172

Query: 153 KHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPIT--RSKRFSDP 210
            +L+EL +  G ++ P V Q E++P L +  L  +CKE ++ +EA+SP+    +    DP
Sbjct: 173 NNLKELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDP 232

Query: 211 VVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLT 270
           +++++            +++ W +Q G V LPKS   +R  SNL    F++S E+M ++ 
Sbjct: 233 IIKQIADRH--NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSIN 288

Query: 271 H 271
           +
Sbjct: 289 N 289

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  140 bits (352), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 154/286 (53%), Gaps = 41/286 (14%)

Query: 14  GVKIPVLGFGTYE-TPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPK 72
           G  +P+LG GT+  T  ++  + V +A + GYRH+DTA +Y+NE      V + ++ES  
Sbjct: 17  GASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNEE----VVGRAIRES-G 71

Query: 73  VSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKR------ 126
           + RD++F TTK+ G  H    A  ++ +SLE    L+YVDL+L+H P     K       
Sbjct: 72  IPRDEIFVTTKLWGTQHRDPAA--ALDQSLERLG-LDYVDLYLMHWPVPMEAKYSKSSSL 128

Query: 127 -------------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVK 167
                              + T++ +QE  K  K +AIGVS++SI ++ +L    G ++ 
Sbjct: 129 LEFPYRPDGSLAVESDWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDLLKSPGNKIV 187

Query: 168 PMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLKESYPGRTP 225
           P  NQ EL+P L + +LV +C+E+ +V+EA+SP     +   S+  + ++ K+     + 
Sbjct: 188 PAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAKKH--DVSA 245

Query: 226 AQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH 271
           AQ+++ W ++ G   LPKSVH++R  SN     F +  +D  T+ +
Sbjct: 246 AQVILSWHIKRGIAVLPKSVHKERVVSNFKT--FSLPEDDFATINN 289

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  138 bits (347), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 165/318 (51%), Gaps = 46/318 (14%)

Query: 1   MSIT---ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENER 57
           M++T    + T TL NG KIPV+G GTY + + +    V  A K GYRHVDTA  Y+NE 
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIH 117
           +   AV     +   V R +++ TTKV          + ++ +SL+    LEY+DL+L+H
Sbjct: 61  QVGKAV-----KDCGVPRSEMYVTTKVWPTE--LRDPEAALDKSLKRLG-LEYIDLYLMH 112

Query: 118 NPC----------------------AETEKR---LGTYKALQEFYKAGKIKAIGVSSYSI 152
            P                       A+ +K    +  ++A+Q+  K+GK+K+IGVS++SI
Sbjct: 113 WPVTLKTDTIKDGELMCIPRLPDGNADVDKDWTFVQAWEAMQKLLKSGKVKSIGVSNFSI 172

Query: 153 KHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR--FSDP 210
            +++EL +     V P+VNQ E+ P L   +L+++C+ +D++ +A+ P   S+     D 
Sbjct: 173 NNIKELLAAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDA 232

Query: 211 VVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLT 270
            V ++ K +  G    Q++  W +Q G+V LPKSV E R  SNL    F +S  DM  + 
Sbjct: 233 TVVEIAKGN--GVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKT--FTLSDADMTKMN 288

Query: 271 H----DGEHFLAQPGFDP 284
           +     GE  L    F P
Sbjct: 289 NISKTQGEKRLNNVNFSP 306

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  137 bits (346), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 154/288 (53%), Gaps = 40/288 (13%)

Query: 5   ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVA 64
            + T TL  G KIP+LG GT+   KE     + AA K GYRH+D+A +  NE+     + 
Sbjct: 8   CTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ----VIG 63

Query: 65  KFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA--- 121
           K +++S  V RD++F TTK+    H    A  ++ +SL+    LEYVDL+++H P A   
Sbjct: 64  KAIRDS-GVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLG-LEYVDLYMMHWPLAFRV 119

Query: 122 -------------ETEKR---------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELY 159
                         +E +         + T++ +Q+     K +AIGV+++S+  L  L 
Sbjct: 120 DQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTSLL 178

Query: 160 SWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLK 217
                ++ P  +Q E +P+L   +++ +C+E+ +++EA+SP+         +PV++++ K
Sbjct: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238

Query: 218 ESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAED 265
           + +    PAQLLI W L+ G   LPKS  + R ESNL    F++S ED
Sbjct: 239 KLH--VEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDED 282

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  133 bits (335), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 93/314 (29%), Positives = 158/314 (50%), Gaps = 53/314 (16%)

Query: 11  LTNGVKIPVLGFGTYET-PKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69
           L+ G  IP +G GT+ +     A   V AA K GYRH+DTA +Y NE +    V K +++
Sbjct: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQ----VGKAIRD 68

Query: 70  SPKVSRDQVFYTTKV-AGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA------- 121
           S  V R+++F T+K+     H  + A    ++ L     L+Y+DL+L+H P         
Sbjct: 69  S-GVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLG----LDYIDLYLMHWPVTFNPRSIK 123

Query: 122 ------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                                   +T   + T++ +Q   ++GK KA+GVS++SI +L +
Sbjct: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKL 215
           L +    +V P  NQ EL+P L + +L++YCKE+++++EA+SP     +    D  +  +
Sbjct: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAI 243

Query: 216 LKESYPGRTPAQLLIRWSLQM-GFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH--- 271
            K+        Q+++ W +Q  G+V LPKSVHE+R  +N   +   +  ED + + +   
Sbjct: 244 AKKL--DIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVV--TLPDEDFQAINNLVK 299

Query: 272 -DGEHFLAQPGFDP 284
             GE  +  P + P
Sbjct: 300 EKGELRVVDPDWSP 313

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  133 bits (334), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 154/308 (50%), Gaps = 47/308 (15%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           S   TL NG+K+P++G G ++ P E   S V+ A K GYR  D AQ Y NE+E    + K
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA---- 121
            + E   V R+++F  +K+    H  +  K ++  +L+  K L+Y+DLF IH P A    
Sbjct: 62  AIDEG-IVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMK-LDYLDLFYIHFPIALKFV 119

Query: 122 --------------ETEKR----------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                         + EK+          + TY+AL++    G IK+IG+S++S   + +
Sbjct: 120 PFKEKYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMD 179

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--------------TR 203
           L    G  +KP+  Q E +P+LT++ LV Y K + L + A+S                T 
Sbjct: 180 LL--RGCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTT 237

Query: 204 SKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALD-FEIS 262
              F +P + ++ K      +P+Q+L+RW+ Q     +PKS  ++R   NLH  D   ++
Sbjct: 238 PPLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLT 297

Query: 263 AEDMKTLT 270
            +++K ++
Sbjct: 298 DQELKEIS 305

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  132 bits (332), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 91/309 (29%), Positives = 161/309 (52%), Gaps = 50/309 (16%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           S+  TL NG+K+P++G G ++  K+   + ++ A K GYR  D A  Y NE+E    + K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESL-EMAKELEYVDLFLIHNPC---- 120
            + E   VSR  +F  +K+  + H  +  K ++ ++L +M   L+Y+DL+ IH P     
Sbjct: 62  AISEG-LVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMG--LDYLDLYYIHFPIAFKY 118

Query: 121 --------------AETEKR----------LGTYKALQEFYKAGKIKAIGVSSYSIKHLE 156
                         A+ EK+          + TY+AL+E    G IK+IGVS++    ++
Sbjct: 119 VPFEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQ 178

Query: 157 ELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--------------T 202
           +L    G  +KP+  Q E +P+LT++ LV++CK  D+ + A+S                T
Sbjct: 179 DLL--RGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKT 236

Query: 203 RSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHA-LDFEI 261
               F + V++K + +++PG T +Q+L+RW+ Q G   +PKS  ++R   NL     F +
Sbjct: 237 TPTLFENDVIKK-VSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTL 295

Query: 262 SAEDMKTLT 270
           + +++K ++
Sbjct: 296 TEQELKDIS 304

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  131 bits (330), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 148/291 (50%), Gaps = 47/291 (16%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           S+  TL NG K+P++G G ++   +   + ++ A K GYR  D A  Y NE+E    + K
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC----- 120
            + E   V+R  +F T+K+  + H  +  K ++ ++L+    L+Y+DL+ IH P      
Sbjct: 62  AISEG-LVTRKDIFVTSKLWNNFHHPDHVKLALKKTLD-DMGLDYLDLYYIHFPIAFKYV 119

Query: 121 -------------AETEKR----------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                        AE +KR          + TY+AL+     G IK+IG+S++    +++
Sbjct: 120 PFEEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQD 179

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--------------TR 203
           L    G  +KP+  Q E +P+LT++ LV YCK  D+ + A+S                + 
Sbjct: 180 LL--RGCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKST 237

Query: 204 SKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNL 254
              F + VV+K + E++PG T +Q+L+RW+ Q G   +PKS  ++R   NL
Sbjct: 238 PTLFENDVVKK-VSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNL 287

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  131 bits (329), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/316 (32%), Positives = 159/316 (50%), Gaps = 53/316 (16%)

Query: 10  TLTNGVKIPVLGFGTYETPKE--KAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
           TL NGVK+P LG GT    ++  + +  V AA K GYRH+DTA  Y  E     A+ +  
Sbjct: 12  TLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKELF 71

Query: 68  KESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA------ 121
           +E   + R+ +F TTKV   N  +++A +SI  SLE    ++YVDL L H P        
Sbjct: 72  EEG-VIKREDIFITTKVWPTN--WDRADESISRSLENLG-VDYVDLVLQHWPLCFNRLQD 127

Query: 122 ---------------------ETEKRLGTYKALQEFY--KAGKIKAIGVSSYSIKHLEEL 158
                                E    L T+K+L++ Y  K  + ++IGVS+Y +++LE L
Sbjct: 128 PEGIDGICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYLERL 187

Query: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLL 216
              +  +V P VNQ E++P L + +L  +C + ++ +EAFSP   T S    + +VQK+ 
Sbjct: 188 L--KECKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQKVA 245

Query: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH----- 271
           ++     TP  +LI + L+ G V +P+SV+     SN+  +   +S ED+  L       
Sbjct: 246 QKY--SCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFV--PLSKEDIDELNKFGVEN 301

Query: 272 -----DGEHFLAQPGF 282
                D E  +A PGF
Sbjct: 302 PKRLVDEEFAVAIPGF 317

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  129 bits (323), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/299 (33%), Positives = 160/299 (53%), Gaps = 47/299 (15%)

Query: 11  LTNGVKIPVLGFGTYETPKEK---AESIVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
           L NG  IP LGFGTY  P+E+    +  V AA K GYRH+DTA +YE+E     A+ + +
Sbjct: 13  LNNGTTIPALGFGTY-APRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGEAIKEMI 71

Query: 68  KESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA----ET 123
           +E  +VSR  +F TTKV      ++  +KS+ ESLE A  L+YVDL L H P      E 
Sbjct: 72  EEG-EVSRSDLFVTTKVWPVY--WDNVEKSLNESLE-ALGLDYVDLLLQHWPLCFPRVED 127

Query: 124 EKR------------------------LGTYKALQEFY---KAGKIKAIGVSSYSIKHLE 156
           EK                         L TY+ +++ Y      +++AIGVS+Y+I++LE
Sbjct: 128 EKNGVNGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIEYLE 187

Query: 157 ELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQK 214
            L+  +  +VKP+VNQ E++P L + +L K+C    +++ A+SP+    +     P+V +
Sbjct: 188 ALF--KECKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPLVHQ 245

Query: 215 LLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
            L E Y   +   +LI + ++ G   +P+S++  R  S +    F  + E++K L + G
Sbjct: 246 -LAEKY-DMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPF--TQEELKQLDNVG 300

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  129 bits (323), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 164/302 (54%), Gaps = 46/302 (15%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAES--IVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
           TL NGV++P LG GT    ++ AE+   V AA K GYRH+DTA  YE E     A+ + L
Sbjct: 26  TLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 68  KESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP-CAETEKR 126
           +E   + R+ +F TTKV      +++ ++S+ ESL+ A  L+YVDLFL H P C E  K 
Sbjct: 86  EEG-SIKREDLFITTKVWPV--LWDEVERSLSESLK-AMGLDYVDLFLQHWPLCFEKVKD 141

Query: 127 --------------------------LGTYKALQEFY---KAGKIKAIGVSSYSIKHLEE 157
                                     + TYK L++ Y      +++AIGVS++SI++LE 
Sbjct: 142 PKGISGLVKTPVHKSGEAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLER 201

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKL 215
           L   +   VKP VNQ E +P L + +L K+C   D+++ A+SP+    +     P+V+KL
Sbjct: 202 LV--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKL 259

Query: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFE-ISAEDMKTLTHDGE 274
           + E Y   T   +LI + ++ G + +P+S++  R  S   +++F  ++ ++++ L   GE
Sbjct: 260 V-EKY-NVTGNDVLISYHIRQGTIVIPRSLNPVRISS---SIEFACLTKDELQELNDFGE 314

Query: 275 HF 276
            +
Sbjct: 315 KY 316

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  128 bits (321), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 91/297 (30%), Positives = 147/297 (49%), Gaps = 49/297 (16%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           M+ T+ T K L NG+++P++G G ++ P E   S V+ A K GYR  D AQ Y NE+E  
Sbjct: 1   MTYTSETVK-LNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVG 59

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC 120
             + K + E   V R+ +F  +K+    H  +  KK++  +LE   ELEY+DLF IH P 
Sbjct: 60  QGIHKAIDEG-IVKREDLFVVSKLWNSYHDPKNVKKALKRTLE-DMELEYLDLFYIHFPL 117

Query: 121 ------------------AETEKR----------LGTYKALQEFYKAGKIKAIGVSSYSI 152
                             AE  K+          + TY+AL+E  K G IK+IG+S++  
Sbjct: 118 AFKYVPFEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRG 177

Query: 153 KHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI----------- 201
             + +L +  G  +KP+  Q E +P+LT++ L++YC +  + + A+S             
Sbjct: 178 ILIHDLLA--GATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSE 235

Query: 202 ---TRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLH 255
              +    F    +QK+      G + +Q+L+RW+ Q     +PKS  ++R   NL 
Sbjct: 236 LAKSTPTLFEHEGIQKIATNH--GVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQ 290

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  127 bits (319), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 94/298 (31%), Positives = 158/298 (53%), Gaps = 40/298 (13%)

Query: 1   MSITAST-TKTLTNGVKIPVLGFGTYET--PKEKAESIVHAAFKQGYRHVDTAQLYENER 57
           +++ AST T  L  G  IP +  GT+ +    +  +S++ AA K GYRH+DTA +Y NE 
Sbjct: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVI-AALKAGYRHIDTAAIYGNED 61

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAG-DNHGYEKAKKSIIESLEM------------ 104
           +    V K +++S  + R+++F T+K+     H    A K  +  L +            
Sbjct: 62  Q----VGKAIRDS-GIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPV 116

Query: 105 ---AKELEYVDLFLI-----HNPCAE--TEKRLGTYKALQEFYKAGKIKAIGVSSYSIKH 154
               + ++  D  +I       P  E  T   + T++ +QE    G  KA+GVS++SI +
Sbjct: 117 TFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINN 176

Query: 155 LEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVV 212
           L+EL +  G ++ P  NQ E++P L   DL+K+C+E+ ++IEA+SP+    +    +P +
Sbjct: 177 LKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKI 236

Query: 213 QKLLKE-SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
            ++ K+   P   PAQL+I W +Q G+V L KS HE+R  +N     F +S ED + +
Sbjct: 237 IEISKKLDVP---PAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKEDFEAI 289

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  128 bits (321), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 160/302 (52%), Gaps = 46/302 (15%)

Query: 10  TLTNGVKIPVLGFGTYETPKEK---AESIVHAAFKQGYRHVDTAQLYENERECATAVAKF 66
           +L NGV+IP LG GT   P+EK    +  V AA K GYRH+DTA  YE E     A+ + 
Sbjct: 26  SLNNGVRIPALGLGT-ANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 67  LKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP-C----- 120
           L+E   + R+ +F TTKV      +++  +S+ ESL+ A  L+YVDL L H P C     
Sbjct: 85  LEEG-TIQREDLFITTKVWP--VLWDEVDRSLNESLK-ALGLDYVDLLLQHWPICFGKVK 140

Query: 121 ---------------------AETEKRLGTYKALQEFY---KAGKIKAIGVSSYSIKHLE 156
                                A     L TYK L++ Y      +++AIGVS++SI++LE
Sbjct: 141 DPEGISGYMKLPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLE 200

Query: 157 ELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQK 214
            L   +  +VKP VNQ E +P L + +L K+C   D+++ A+SP+    +     P+V+K
Sbjct: 201 RLI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKK 258

Query: 215 LLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGE 274
           L  E Y   T   LLI + ++ G + +P+S++  R  SN+  +   ++ ++++ L   GE
Sbjct: 259 LC-EKY-NVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVC--LTKDELQELNEFGE 314

Query: 275 HF 276
            +
Sbjct: 315 KY 316

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  127 bits (319), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 93/308 (30%), Positives = 156/308 (50%), Gaps = 49/308 (15%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           S T TL NG+++P++G G ++ P +   S V+ A K GYR  D AQ Y NE+E    + K
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKK 64

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC----- 120
            + E   V R+ +F  +K+    H  +  K ++ ++L+    L+Y+DLF IH P      
Sbjct: 65  AIAEG-IVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIG-LDYLDLFYIHFPLAFKFV 122

Query: 121 -------------AETEKR----------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                        AE EK           + TY+AL++    G IK+IG+S+++   +++
Sbjct: 123 PFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQD 182

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--------------TR 203
           L    G  +KP+  Q E +P+LT+++LVKYCK   + + A+S                T 
Sbjct: 183 LL--RGARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKTT 240

Query: 204 SKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALD-FEIS 262
              F +  V KL+  ++   T +Q+L+RW+ Q G   +PKS  ++R   NL   D   +S
Sbjct: 241 PTLFRNDTV-KLIANNHKVST-SQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLS 298

Query: 263 AEDMKTLT 270
            +++K ++
Sbjct: 299 DKELKAIS 306

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  126 bits (317), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 152/290 (52%), Gaps = 34/290 (11%)

Query: 10  TLTNGVKIP---VLGFGTY-----ETP----KEKAESIVHAAFKQGYRHVDTAQLYENER 57
           TL NG K+P   ++G GT      ETP    +E  + I +A    G  H+D A++Y    
Sbjct: 10  TLNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYP 69

Query: 58  ECATAVAKFLKESPKVS-RDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLI 116
           E    V K L+ES  V  RD++F T K +      E     +   L+    L+YVDL+L+
Sbjct: 70  E----VGKALRESHNVKPRDEIFITDKYSTQLKISENPMVGLTNGLKKLG-LDYVDLYLL 124

Query: 117 HNPCAETEKRLGT----YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQ 172
           H+P    EK   T    +K +++ YKAGK+K IGVS++S+  L+ +   +  EVKP VNQ
Sbjct: 125 HSPFISKEKNGFTMEEAWKYMEDLYKAGKVKNIGVSNFSMADLQRIL--KSCEVKPQVNQ 182

Query: 173 FELNPWLTRK--DLVKYCKERDLVIEAFSPI----TRSKRFSDPVVQKLLK---ESYPGR 223
            E N +L  +   +V +C+E D+ + A++P+     +SK F      K +K   E Y  +
Sbjct: 183 IEFNAFLQNQTPGIVNFCRENDIQVVAYTPLGPLQRKSKNFEQENFHKFVKQLAEKY-DK 241

Query: 224 TPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
           + AQ+L+RW  + G +P+  S  E R +   +   F+++  +++ +T  G
Sbjct: 242 SEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTDSEVEKITQLG 291

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  126 bits (317), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 160/309 (51%), Gaps = 50/309 (16%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           S+  TL NG+K+P++G G ++  K+   + ++ A K GYR  D A  Y NE+E    + +
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESL-EMAKELEYVDLFLIHNPCA--- 121
            + E   V+R  VF  +K+  + H  +  K ++ ++L +M   L+Y+DL+ IH P A   
Sbjct: 62  AISEG-LVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMG--LDYLDLYYIHFPIAFKY 118

Query: 122 ---------------ETEKR----------LGTYKALQEFYKAGKIKAIGVSSYSIKHLE 156
                          + EK+          L TY+AL+E    G IK+IG+S++    ++
Sbjct: 119 VPFEEKYPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQ 178

Query: 157 ELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--------------T 202
           +L    G  +KP+  Q E +P+LT++ LV++C+  ++ + A+S                T
Sbjct: 179 DLL--RGCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKT 236

Query: 203 RSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHA-LDFEI 261
               F + V++K +  ++PG T +Q+L+RW+ Q G   +PKS  ++R   NL     F +
Sbjct: 237 TPTLFENDVIKK-ISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTL 295

Query: 262 SAEDMKTLT 270
           + +++K ++
Sbjct: 296 TEQELKEIS 304

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  126 bits (317), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 160/302 (52%), Gaps = 46/302 (15%)

Query: 10  TLTNGVKIPVLGFGTYETPKEK---AESIVHAAFKQGYRHVDTAQLYENERECATAVAKF 66
           +L NGV+IP LG GT   P+EK    +  V AA K GYRH+DTA  Y  E     A+ + 
Sbjct: 26  SLNNGVRIPALGLGT-ANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVGEAIKEL 84

Query: 67  LKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP-CAETEK 125
           L+E   + R+ +F TTKV      +++  +S+ ESL+ A  L+YVDL L H P C E  K
Sbjct: 85  LEEG-TIQREDLFITTKVWP--VLWDEVDRSLNESLK-ALGLDYVDLLLQHWPLCFEKVK 140

Query: 126 R--------------------------LGTYKALQEFY---KAGKIKAIGVSSYSIKHLE 156
                                      L TYK L++ Y      +++AIGVS++SI++LE
Sbjct: 141 DPKGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLE 200

Query: 157 ELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQK 214
            L   +  +VKP VNQ E +P L + +L K+C   D+++ A+SP+    +     P+V+K
Sbjct: 201 RLI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKK 258

Query: 215 LLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGE 274
           L  E Y   T   LLI + ++ G + +P+S++  R  SN+  +   ++ ++++ L   GE
Sbjct: 259 LC-EKY-NVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVC--LTKDELQELNEFGE 314

Query: 275 HF 276
            +
Sbjct: 315 KY 316

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  125 bits (315), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 146/295 (49%), Gaps = 48/295 (16%)

Query: 3   ITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATA 62
           +  S T  L NG+++P++G G ++ P E   S V+ A K GYR  D AQ Y NE+E    
Sbjct: 2   VYVSETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQG 61

Query: 63  VAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC-- 120
           + K + E   V R+ +F  +K+    H  +  KK++  +L+    LEY+DLF IH P   
Sbjct: 62  IRKAIDEGI-VKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLG-LEYLDLFYIHFPLAF 119

Query: 121 ----------------AETEKR----------LGTYKALQEFYKAGKIKAIGVSSYSIKH 154
                           AE EK+          L TY+AL++    G IKAIGVS++    
Sbjct: 120 KFVPFEERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGIL 179

Query: 155 LEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI------------- 201
           L +L +  G ++ P   Q E +P+LT++ LV+YCK++ + + A+S               
Sbjct: 180 LHDLLA--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLA 237

Query: 202 -TRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLH 255
            +    F   VV+K+      G + +++L+RW+ Q     +PKS  ++R  +NL 
Sbjct: 238 KSTPTLFEHDVVKKVANNH--GVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQ 290

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  126 bits (316), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 161/302 (53%), Gaps = 46/302 (15%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAES--IVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
           +L NGV+IP LG GT    ++ AE+   V AA K GYRH+DTA  YE E     A+ + L
Sbjct: 26  SLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 68  KESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP-CAETEKR 126
           ++   + R+ +F TTKV      +++  +S+ ESL+ A  LEYVDL L H P C E  K 
Sbjct: 86  EDG-SIKREDLFITTKVWP--VLWDEVDRSLNESLK-ALGLEYVDLLLQHWPLCFEKIKD 141

Query: 127 --------------------------LGTYKALQEFY---KAGKIKAIGVSSYSIKHLEE 157
                                     L TYK L++ Y      +++AIGVS++SI++LE 
Sbjct: 142 PKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLER 201

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQKL 215
           L   +   VKP VNQ E +P L + +L K+C   D+++ A+SP+    +     P+V+K 
Sbjct: 202 LI--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLVKK- 258

Query: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDF-EISAEDMKTLTHDGE 274
           L E Y   T   LLI + ++ G + +P+S++  R  S   +++F  ++ ++++ L   GE
Sbjct: 259 LAEKY-NVTGNDLLISYHIRQGTIVIPRSLNPVRISS---SIEFASLTKDELQELNDFGE 314

Query: 275 HF 276
            +
Sbjct: 315 KY 316

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  125 bits (314), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 161/302 (53%), Gaps = 46/302 (15%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAES--IVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
           +L NGV+IP LG GT    ++ AE+   V AA K GYRH+DTA  YE E     A+ + L
Sbjct: 26  SLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 68  KESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP-CAETEKR 126
           ++   + R+ +F TTKV      +++  +S+ ESL+ A  L+YVDLFL H P C E  K 
Sbjct: 86  EDG-SIKREDLFITTKVWP--VLWDEVDRSLNESLK-ALGLDYVDLFLQHWPLCFEKVKD 141

Query: 127 --------------------------LGTYKALQEFY---KAGKIKAIGVSSYSIKHLEE 157
                                     L TYK L++ Y      +I+AIGVS++SI++LE 
Sbjct: 142 PKGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEYLER 201

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKL 215
           L   +   VKP VNQ E +P L +  + K+C   D+++ A+SP+    +     P+V+K 
Sbjct: 202 LI--KECRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKK- 258

Query: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFE-ISAEDMKTLTHDGE 274
           L E Y   T   +LI + ++ G + +P+S++  R  S   +++F  ++ ++++ L   GE
Sbjct: 259 LTEKY-NLTGNDVLISYHIRQGTIVIPRSLNPVRISS---SIEFSCLTKDELQELNDFGE 314

Query: 275 HF 276
            +
Sbjct: 315 KY 316

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  125 bits (313), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 158/309 (51%), Gaps = 50/309 (16%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           S+  TL NG+K+P++G G ++  K    + ++ A K GYR  D A  Y NE+E    + K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESL-EMAKELEYVDLFLIHNPCA--- 121
            + E   V+R  VF  +K+  + H  +  K ++ ++L +M   L+Y+DL+ IH P A   
Sbjct: 62  AIYEG-LVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMG--LDYLDLYYIHFPIAFKY 118

Query: 122 ---------------ETEKR----------LGTYKALQEFYKAGKIKAIGVSSYSIKHLE 156
                          E E++          + TY+AL++    G IK+IG+S++    ++
Sbjct: 119 IPFEEKYPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQ 178

Query: 157 ELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--------------T 202
           +L    G  +KP+  Q E +P+LT++ LV++CK  D+ + A+S                 
Sbjct: 179 DLL--RGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKA 236

Query: 203 RSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHA-LDFEI 261
               F + V++K + E++ G T +Q+L+RW+ Q G   +PKS  ++R   NL     F +
Sbjct: 237 TQTLFENDVIKK-VSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSL 295

Query: 262 SAEDMKTLT 270
           + +++K ++
Sbjct: 296 TEQELKKIS 304

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  123 bits (308), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 154/297 (51%), Gaps = 44/297 (14%)

Query: 10  TLTNGVKIPVLGFGTYETPKE--KAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
            L  G KIP LG GT   P++  + +  V  A K GYR +DTA +Y +E     A+ +  
Sbjct: 12  NLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQELF 71

Query: 68  KESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA------ 121
           +E   V R+ +F TTKV   +  Y   ++S+ ESL+  K L+YVDL L H P        
Sbjct: 72  EEG-VVKREDLFITTKVWPCH--YNTVEQSLQESLKQLK-LDYVDLLLQHWPLCFVKQYD 127

Query: 122 --------------------ETEKRLGTYKALQEFYK--AGKIKAIGVSSYSIKHLEELY 159
                               E    L T+K L++ YK  +G+++ IGVS+Y +++LE L 
Sbjct: 128 EHGKLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLL 187

Query: 160 SWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRS--KRFSDPVVQKLLK 217
             +  EV P++NQ EL+P L +++L +YC    +++E+FSP+  S       P+V++L K
Sbjct: 188 --KETEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSK 245

Query: 218 ESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDF-EISAEDMKTLTHDG 273
           +      P  +L+ + ++ G V +P+S++  R   N    DF  +S ED+  L+  G
Sbjct: 246 KY--DCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKN---ADFVALSEEDLDKLSGLG 297

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  123 bits (308), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/305 (28%), Positives = 148/305 (48%), Gaps = 45/305 (14%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           M +   T K L NG  +P++G G ++ P E A   V+ A K GYR +D A+ Y NERE  
Sbjct: 26  MVMNVRTIK-LNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVG 84

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC 120
             + + + E   V R+++F  +K+  + H  E   K++  +L     L+Y+DLF IH P 
Sbjct: 85  QGIRRAIDEG-LVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLG-LDYLDLFYIHFPL 142

Query: 121 A--------------------ETEKRLG--------TYKALQEFYKAGKIKAIGVSSYSI 152
           A                    E   RL         TY+AL++    G+I+AIG+S++  
Sbjct: 143 AFKFVPLEERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQG 202

Query: 153 KHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI---------TR 203
             +++L    G  ++P   Q E +P+LT++ LV+Y K   L +  +S +           
Sbjct: 203 CLVQDLL--RGCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNT 260

Query: 204 SKRFSDPVVQKLLKESYPGR---TPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFE 260
           + + + P++Q  +      R   TPA++L+RW+ Q     +PKS  ++R  +NL   +  
Sbjct: 261 AAQNAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEAL 320

Query: 261 ISAED 265
             A+D
Sbjct: 321 TLADD 325

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  122 bits (307), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 85/304 (27%), Positives = 149/304 (49%), Gaps = 49/304 (16%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69
           TL NG+K+P +G G ++ P +     V+ A K GYR  D A  Y NE E    + + + +
Sbjct: 6   TLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMDD 65

Query: 70  SPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA-------- 121
              V R  +F  +K+  + H  +  K ++  +L+    L+Y+DL+ IH P A        
Sbjct: 66  G-IVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLG-LDYLDLYYIHFPIAFKFVPMEE 123

Query: 122 --------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSW 161
                               E    L TY+AL+E  + G IK+IG+S+++   + ++   
Sbjct: 124 RYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADIL-- 181

Query: 162 EGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--------------TRSKRF 207
            G  +KP+  Q E +P+LT++ L++YCK  D+ +  +S                     F
Sbjct: 182 RGCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPLF 241

Query: 208 SDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALD-FEISAEDM 266
             PV++K+ ++     + A++L+RW+ Q G   +PKS H+ R  SNL+  D   ++ ED+
Sbjct: 242 DHPVIKKIAEKH--NVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDL 299

Query: 267 KTLT 270
           K+++
Sbjct: 300 KSIS 303

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  122 bits (307), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 140/286 (48%), Gaps = 46/286 (16%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69
           TL NG+K+P++G G ++ P +   + V+ A K GYR  D AQ Y NE+E    + + + E
Sbjct: 6   TLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQAISE 65

Query: 70  SPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA-------- 121
              V R+++F  +K+    H  +  K ++  +L   K L+Y+DL+ IH P A        
Sbjct: 66  G-IVKREELFVISKLWNSYHDPKHVKMALQRTLSDMK-LDYLDLYYIHFPIAFKFVPFEE 123

Query: 122 --------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSW 161
                               E    + TY+A+++    G IK+IG+S+++   +++L   
Sbjct: 124 KYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDLL-- 181

Query: 162 EGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLK---- 217
              ++KP   Q E +P+LT+  L++YCK  D+ + A+S     + F +  VQK L     
Sbjct: 182 RSCKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFG-PQSFLELNVQKALDAKVL 240

Query: 218 ---------ESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNL 254
                     +     P+Q+L+RW+ Q G   +PKS  ++R   NL
Sbjct: 241 FEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENL 286

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  122 bits (305), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/298 (30%), Positives = 151/298 (50%), Gaps = 45/298 (15%)

Query: 10  TLTNGVKIPVLGFGTYETPKE--KAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
           TL NGV++P +G GT    ++  + +  V AA K GYRH+DTA  Y+ E     A+ +  
Sbjct: 12  TLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVGEALKELF 71

Query: 68  KESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA------ 121
           +E   V R+ +F TTKV   N  +++  +SI  SLE    L++VDL L H P        
Sbjct: 72  EEG-VVKREDIFVTTKVWPTN--WDRVDESISRSLENLG-LDHVDLVLQHWPLCFNRLED 127

Query: 122 ---------------------ETEKRLGTYKALQEFY--KAGKIKAIGVSSYSIKHLEEL 158
                                E    L T+K L++ Y  K  + +AIGVS+Y +++LE L
Sbjct: 128 PDGIDGVRRNPYHEDGSPHYNEKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEYLERL 187

Query: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKE 218
              +  +V P +NQ E +P L + +L  +C + ++ +EA+SP+  +   + P++   L +
Sbjct: 188 L--KECQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGAT---NAPLIDNELVK 242

Query: 219 SYPGR---TPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
              G+   +   +LI + ++ G V +P+SV+     SN+  +   +S ED+ TL   G
Sbjct: 243 KIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFV--ALSKEDIDTLNKFG 298

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  121 bits (303), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 152/293 (51%), Gaps = 34/293 (11%)

Query: 7   TTKTLTNGVKIPVLGFGT---YETPKEKAE----------SIVHAAFKQGYRHVDTAQLY 53
           T +   +G K+PV+GFG+   +   K + E            V  A K G+ H+D A+ Y
Sbjct: 7   TVELKGSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAY 66

Query: 54  ENERECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMA---KELEY 110
           +   E    +A     +  V R++++ T K    +  + K K  + ESLE++    +++Y
Sbjct: 67  KTHPEVGAGIA-----NSGVPREKLWVTDKYTPWSWTWRKGKGPL-ESLELSLGKMQMQY 120

Query: 111 VDLFLIHNPCAETEKR----LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEV 166
           VDL+L+H P    E         ++ ++E Y  G  K IGVS++ ++ LE + +    + 
Sbjct: 121 VDLYLVHVPFINPETAGIDLKEAWRQMEEIYDRGWAKNIGVSNFDVESLEYIRTIG--KY 178

Query: 167 KPMVNQFELNPWLTRKD--LVKYCKERDLVIEAFSPI---TRSKRFSDPVVQKLLKESYP 221
           +P+VNQ E + ++ ++   ++ YCK+  + IE +SP+   T+ K      +  L+ + Y 
Sbjct: 179 QPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGKPGPLDDILPLMAKKY- 237

Query: 222 GRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGE 274
           G++  Q+L+RW +Q G + +  S  + R + +L   DFE+S+ED  ++T  G+
Sbjct: 238 GKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFTSITEVGK 290

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  121 bits (304), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 147/292 (50%), Gaps = 50/292 (17%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           S+  TL NG+K+P++G G ++ P +     V+ A K GYR  D A+ Y NE+E    + K
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESL-EMAKELEYVDLFLIHNPCA--- 121
            + E   V R+ VF  +K+    H  +  K ++  +L +M   L+Y+DLF IH P A   
Sbjct: 62  AIDEG-VVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMG--LDYLDLFYIHFPIAFKY 118

Query: 122 ---------------ETEKR----------LGTYKALQEFYKAGKIKAIGVSSYSIKHLE 156
                          E EK           + TY+AL++  + G IK+IG+S++S   ++
Sbjct: 119 VPFEEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQ 178

Query: 157 ELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFS------------PITRS 204
           +L      ++KP+  Q E +P+LT++ LV+YCK+  + + A+S            P+ ++
Sbjct: 179 DLL--RQCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKN 236

Query: 205 --KRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNL 254
               F    ++++          +Q+L+RW+ Q G   +PKS  ++R + NL
Sbjct: 237 TPNLFHHDTIKQIANNH--NVATSQVLLRWATQRGIAIIPKSSKKERLQDNL 286

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  120 bits (302), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/305 (29%), Positives = 148/305 (48%), Gaps = 51/305 (16%)

Query: 8   TKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
           T TL NG K+P++G G ++ P +     ++ A K GYR  D AQ Y NE+E    V + +
Sbjct: 7   TVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAI 66

Query: 68  KESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA------ 121
           KE   V R+ +   +K+    H  +   +++  +L    +L+YVD+F IH P A      
Sbjct: 67  KEG-LVKREDLVVVSKLWNSFHHPDNVPRALERTLS-DLQLDYVDIFYIHFPLAFKPVPF 124

Query: 122 ------------ETEKR----------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELY 159
                       E E +          L T++AL++    GKIK++G+S++S   +++L 
Sbjct: 125 DEKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLL 184

Query: 160 SWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFS---PIT-----RSKRFSDPV 211
              G  +KP+  Q E +P+LT++ L+KY K   + + A+S   P++       K  + P 
Sbjct: 185 --RGARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPT 242

Query: 212 V--QKLLKE--SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMK 267
           +     +K   S    TP Q+L+RW+ Q G   +PKS  ++R   NL          D  
Sbjct: 243 LFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLR-------INDAL 295

Query: 268 TLTHD 272
           TLT D
Sbjct: 296 TLTDD 300

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  120 bits (301), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/309 (27%), Positives = 150/309 (48%), Gaps = 50/309 (16%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           S   TL NG+K+P++G G ++ P       ++ A K GYR  D A  Y NE+E    + +
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA---- 121
            + E   V R+ +F  +K+  + H  +  K ++  +L+    L+YVDL+ IH P A    
Sbjct: 62  AIDEG-LVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLG-LDYVDLYYIHFPIAFKFV 119

Query: 122 ------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                                   E    + TY+A+++    G IK+IG+S+Y+   + +
Sbjct: 120 SPDERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVAD 179

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--------------TR 203
             +  G  +KP+  Q E +P+LT++ L++YCK  D+ + A+S                  
Sbjct: 180 --TLRGCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNT 237

Query: 204 SKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISA 263
              F  P ++K + + Y   T +Q+L+RW+ Q G   +PKS  ++R   NL  +D +++ 
Sbjct: 238 PPLFDHPTIKK-IADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENL-TIDQKVTL 295

Query: 264 --EDMKTLT 270
             ED++ ++
Sbjct: 296 AEEDLREIS 304

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  119 bits (299), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 82/292 (28%), Positives = 139/292 (47%), Gaps = 48/292 (16%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           S T TL NG+ +P++G G ++   +     V+ A K GYR  D A  Y NE++    + +
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA---- 121
            + E   V R+ +F  +K+    H  +  K ++  +L+  K LEY+DL+ IH P A    
Sbjct: 62  AIDEG-IVKREDLFVVSKLWNTYHDPKHVKLALQRTLDDMK-LEYLDLYYIHFPLAFKFV 119

Query: 122 ------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                                   E    + TY+A++E    G  K+IG+S+Y+   +++
Sbjct: 120 PFEERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQD 179

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSK------------ 205
             +  G  +KP+  Q E +P+LT++ LV+YCK   + + A+S                  
Sbjct: 180 --TLRGCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHT 237

Query: 206 --RFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLH 255
              F  PV++K+ +E     T +Q+++RW+ Q G   +PKS H+ R   NL 
Sbjct: 238 PPLFDHPVIKKIAQEH--KVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQ 287

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  117 bits (294), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 156/292 (53%), Gaps = 39/292 (13%)

Query: 10  TLTNGVKIP---VLGFGT------YETPK---EKAESIVHAAFKQGYRHVDTAQLYENER 57
           TL NG KIP   ++G GT       E+ K   E  + + +A    G  H+D A++Y    
Sbjct: 9   TLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEMYNTYP 68

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKV-AGDNHGYEKAKKSIIESLEMAKELEYVDLFLI 116
           E    V K LK + KV RD++F T K  +G     E     + +SL+   EL+YVDL+L+
Sbjct: 69  E----VNKALKSTSKV-RDEIFITDKYYSGSPKLTENPIAGLTKSLKEL-ELDYVDLYLL 122

Query: 117 HNP------CAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMV 170
           H+P      C  T +    +K +++ YK GK K IGVS++S+  L+ +      E+KP +
Sbjct: 123 HSPFITKESCGYTMEE--AWKQMEKLYKDGKAKNIGVSNFSVDDLKRILKI--CEIKPQI 178

Query: 171 NQFELNPWLTRK--DLVKYCKERDLVIEAFSPI--TRSK---RFSDPVVQKL--LKESYP 221
           NQ E N +L  +   +VK+C++ D+++EA+SP+   R K   R   P  Q +  L + Y 
Sbjct: 179 NQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLGPLRKKPTDRDPGPFYQYIEELAKKY- 237

Query: 222 GRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
           G++  Q+L+RW  +   +P+  S  E+R +       F++++E+++ +T  G
Sbjct: 238 GKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSFDLTSEEVEKITKLG 289

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  118 bits (295), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 155/293 (52%), Gaps = 44/293 (15%)

Query: 10  TLTNGVKIP---VLGFGTY-----ET----PKEKAESIVHAAFKQGYRHVDTAQLYENER 57
           TL NG KIP   V+G GT      ET     KE  E I +A    G  H+D A+ Y   +
Sbjct: 28  TLNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQ 87

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAG--DNHGYEKAKKSIIESLEMAKE---LEYVD 112
           E   A    L+ESPK  RD++F T K +    NHG       ++E  E   +   ++YVD
Sbjct: 88  ELGQA----LRESPK-PRDEIFITDKFSPTPKNHG------GVLERFESGIKKMGVDYVD 136

Query: 113 LFLIHNPCAETEKRLGT----YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKP 168
           L+LIH+P  E EK   T    +K L++ Y+AGK K IGVS++ ++ L+ +   +  +VKP
Sbjct: 137 LYLIHSPLIEKEKNGVTLEEVWKDLEKLYEAGKAKNIGVSNFRVEDLQRIL--KVAKVKP 194

Query: 169 MVNQFELNPWLTRK--DLVKYCKERDLVIEAFSPITRSKRFSDPV------VQKLLKESY 220
            VNQ E + +L  +   +VK+ ++ ++ +EA++P+   +R           V++L K+  
Sbjct: 195 QVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLGPLQRKQSDAGDFYNYVEELAKKY- 253

Query: 221 PGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
            G+T AQ+L+RW  +   +P+  S    R ++      F+++ E++K +T  G
Sbjct: 254 -GKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKKITELG 305

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  117 bits (294), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 147/305 (48%), Gaps = 54/305 (17%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69
           TL NG K+P++G G ++   +     V+ A K GYR  D A  Y NE E    + K + E
Sbjct: 6   TLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAIDE 65

Query: 70  SPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA-------- 121
              V R  +F  +K+    H  +  K ++  +L+    L+Y+DL+ IH P A        
Sbjct: 66  G-LVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLG-LDYIDLYYIHFPIAFKFVPFEE 123

Query: 122 -----------------ETEKR---LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSW 161
                             +E +   L TY+AL+E    G IK+IG+S+++   +++L + 
Sbjct: 124 KYPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLLN- 182

Query: 162 EGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--------------TRSKRF 207
            G  +KP+  Q E +P+LT++ LV+YCK + + + A+S                +     
Sbjct: 183 -GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSLL 241

Query: 208 SDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMK 267
             P+++K +  ++   TP+++L+RW+ Q G   +PKS  ++R   NL       + ED  
Sbjct: 242 EHPIIKK-IAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNL-------NVEDSI 293

Query: 268 TLTHD 272
           TLT +
Sbjct: 294 TLTEE 298

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  117 bits (293), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 151/291 (51%), Gaps = 44/291 (15%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           + T TL NG+K+PV+G G ++   + A + V+ A K GYR  D A  Y NE+E    + +
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC----- 120
            + E   V R+ +F  +K+  + H  +  K ++  +L     L+YVDL+ IH P      
Sbjct: 64  AINEG-LVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLG-LDYVDLYYIHFPLPIKYV 121

Query: 121 ------------AETEKR-----------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                        E ++R           L TY+A+++    G +K++G+S++    +++
Sbjct: 122 PLEEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQD 181

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFS---PIT------RSKRFS 208
           L    G  +KP+  Q EL+P+L+++ LV Y + +D+ + A+S   P++       + +  
Sbjct: 182 LL--RGARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDV 239

Query: 209 DPVVQKLLKESYPGR---TPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHA 256
            P+++  +  +   +   TP+Q+++RW+ Q G   +PKS  ++R  +NL++
Sbjct: 240 TPLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNS 290

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  116 bits (291), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 89/293 (30%), Positives = 152/293 (51%), Gaps = 42/293 (14%)

Query: 10  TLTNGVKIP---VLGFGT-YETPKEKAESIVHAAFKQ--------GYRHVDTAQLYENER 57
           TL NG K+P   ++G GT +   KEK  ++ H   +Q        G  H+D A++Y    
Sbjct: 9   TLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEMYGTYP 68

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKA-KKSIIESLE---MAKELEYVDL 113
           E + A+   + E P   R ++F T     D H    A  K  I  LE    A  L+YVDL
Sbjct: 69  ELSAALR--MTEKP---RSEIFIT-----DKHALHAAMSKDPIAGLEDSLKANNLDYVDL 118

Query: 114 FLIHNPCAETEK----RLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPM 169
           +L+H+P    EK      G ++ +++ YK GK K IGVS++S++ L+ + S    E+KP 
Sbjct: 119 YLLHSPFVAKEKPGLTLEGAWRQMEQLYKDGKAKNIGVSNFSVEDLKRVLSVA--EIKPQ 176

Query: 170 VNQFELNPWLTRK--DLVKYCKERDLVIEAFSPI----TRSKRFSDPVVQKLLKESYPGR 223
           VNQ E +P+L  +   ++K+C++ ++ +EAF+P+     +++   +    K +  S  G+
Sbjct: 177 VNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVKTQEDENDEFFKYIS-SLSGK 235

Query: 224 ---TPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
              T AQ+++RW  + G +P+  S   DR     +  +F++  E++  +T  G
Sbjct: 236 YQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLEDEEVTKITRLG 288

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  116 bits (290), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 86/299 (28%), Positives = 150/299 (50%), Gaps = 36/299 (12%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGT---YETPKEKAE----------SIVHAAFKQGYRHV 47
           M+    T +   +G +IP++GFG+   +   K   E            V +A   G+ H+
Sbjct: 1   MNSKIPTLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHI 60

Query: 48  DTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE 107
           D A+ Y+   E    V     ++  V RD+++ T K    +  + K    + ESL ++ E
Sbjct: 61  DAAEAYKTHPEVGRGV-----KNSGVPRDKLWITDKYTPWSWDWRKGTGPL-ESLSLSLE 114

Query: 108 ---LEYVDLFLIHNPCAETEKRLG-----TYKALQEFYKAGKIKAIGVSSYSIKHLEELY 159
              + YVDL+L+H P   T +  G      ++ ++E Y  G  K IGVS++ ++ LE  Y
Sbjct: 115 KMQMSYVDLYLLHVPFI-TVQTAGIDLKEAWRQMEEIYDRGLAKNIGVSNFDVESLE--Y 171

Query: 160 SWEGLEVKPMVNQFELNPWLTRKD--LVKYCKERDLVIEAFSPITRSKRFSDPVVQKLL- 216
             +  +  P+VNQ E N +L ++   ++ YCK+ D+V+E +SP+    +     + KLL 
Sbjct: 172 ITKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGRPGPLDKLLP 231

Query: 217 --KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
              E Y  ++  Q+L+RW  Q G V +  S  + R + +++  DFE++AED  ++T  G
Sbjct: 232 ALAEKYH-KSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAEDFDSITKIG 289

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  115 bits (289), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 144/278 (51%), Gaps = 42/278 (15%)

Query: 10  TLTNGVKIPVLGFGTYETPKEK---AESIVHAAFKQGYRHVDTAQLYENERECATAVAKF 66
            L NG +IP +G GT  +PK++    +  V AA + GYRH+DTA  Y+ E     A+ K 
Sbjct: 12  NLNNGTRIPAIGLGT-ASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQAL-KE 69

Query: 67  LKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA--ETE 124
           L ES ++ R+++F TTKV      +     SI +SL+    ++YVDL L H P    + E
Sbjct: 70  LFESAEIKREELFITTKVWPT--FWNNPSDSIDQSLKDLG-IDYVDLVLQHWPVCFQKVE 126

Query: 125 KRLG-----------------------TYKALQEFY---KAGKIKAIGVSSYSIKHLEEL 158
              G                       TYKAL++ Y   K  +++AIGVS+Y I++LE L
Sbjct: 127 NSQGNIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERL 186

Query: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQKLL 216
           +  +  +V P +NQ E++P L + +L K+C +  +++ A+SP+    +       VQ L 
Sbjct: 187 F--KECKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLA 244

Query: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNL 254
           K+      PA +L  + +  G V LP+S++  R  +N+
Sbjct: 245 KKY--KVEPADILTSYHISKGNVVLPRSLNPKRIAANV 280

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  115 bits (289), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 156/295 (52%), Gaps = 41/295 (13%)

Query: 10  TLTNGVKIP---VLGFGT--YETPKEKA-------ESIVHAAFKQGYRHVDTAQLYENER 57
           TL NG KIP   ++G GT  Y+  +  A       E IV+A    G  H+D A++Y    
Sbjct: 9   TLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYP 68

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE---LEYVDLF 114
           E   A++  L E P   R+ +F T K +       K   S  + L++A +    +YVDL+
Sbjct: 69  EVGKALS--LTEKP---RNAIFLTDKYSPQI----KMSDSPADGLDLALKKMGTDYVDLY 119

Query: 115 LIHNPCAETEKRLGT----YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMV 170
           L+H+P    E    +    +K +++ YK+GK K IGVS+++++ L+ +   +  EVKP V
Sbjct: 120 LLHSPFVSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRIL--KVAEVKPQV 177

Query: 171 NQFELNPWLTRK--DLVKYCKERDLVIEAFSPI-----TRSKRFSDPVVQ--KLLKESYP 221
           NQ E +P+L  +   + K+C+E D+++EA+SP+       ++  S P  +  K L E Y 
Sbjct: 178 NQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQPFFEYVKELSEKYI 237

Query: 222 GRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG-EH 275
            ++ AQ+++RW  + G +P+  S    R     +   F+++AE++  +T  G EH
Sbjct: 238 -KSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKITELGLEH 291

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  115 bits (287), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 136/289 (47%), Gaps = 46/289 (15%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69
           TL NG+K+P++G G ++ P +   S V+ A K GYR  D A  Y NE+E    + K L E
Sbjct: 6   TLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINKALSE 65

Query: 70  SPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA-------- 121
              V R  +F  +K+    H  +  K ++  +L     L+Y+DL+ IH P A        
Sbjct: 66  G-IVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLG-LDYLDLYYIHFPLAFKYVPFEE 123

Query: 122 --------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSW 161
                               +    L TY+A+++    G  K+IGVS+     L+++   
Sbjct: 124 KYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVLM- 182

Query: 162 EGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI-------TRSKR-------F 207
            G  ++P   Q E +P+LT++ LV++CK  ++ + ++S           SKR       F
Sbjct: 183 -GCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPALF 241

Query: 208 SDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHA 256
             PV++K+        T +++L+RW+ Q     +PKS  ++R   NL+ 
Sbjct: 242 DHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNV 290

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  114 bits (286), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 86/292 (29%), Positives = 151/292 (51%), Gaps = 46/292 (15%)

Query: 17  IPVLGFGT---YETPKEKAES----------IVHAAFKQGYRHVDTAQLYENERECATAV 63
           IPVLGFGT   +   K + E+           +  A   G+ H+DTA+ Y    E   A+
Sbjct: 18  IPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEEVGEAL 77

Query: 64  AKFLKESPKVSRDQVFYTTK------VAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIH 117
            +      ++ RD++F T K         D  G  +A K  +E+L     ++Y DL+++H
Sbjct: 78  RR-----SQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALG----IKYFDLYMLH 128

Query: 118 NPCAETEKRLG-----TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQ 172
            P   T++  G      ++ ++E Y+AG  KAIGVS++ ++ L+++ S+      PMV+Q
Sbjct: 129 RPDI-TKENAGIDLQEAWRQVEELYEAGIAKAIGVSNFPLETLKQMESY--CRYLPMVHQ 185

Query: 173 FELNPWLTRKD--LVKYCKERDLVIEAFSPITRSKRFS----DPVVQKLLKESYPGRTPA 226
            E +P+L  +   +V++C+ + +V+EA+SP+    R      D ++  L+K+   G++  
Sbjct: 186 VEFHPYLQNQSPGVVEWCQNKHIVVEAYSPLAPLFRARPGPLDDILPNLMKKY--GKSET 243

Query: 227 QLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG--EHF 276
           Q+++RW +  G V L  S  E+R    L  LDFE+   D++ +   G  +HF
Sbjct: 244 QIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKSDVELINEVGSKKHF 295

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  114 bits (285), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 148/300 (49%), Gaps = 42/300 (14%)

Query: 11  LTNGVKIP---VLGFGT--YETP-------KEKAESIVHAAFKQGYRHVDTAQLYENERE 58
           L NG +IP   ++G GT  ++ P        E  E I +A    G  H+D A+ Y    E
Sbjct: 10  LNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTYPE 69

Query: 59  CATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE---LEYVDLFL 115
            A A    LKES K  R ++F T K +       K     IE L    +   L+YVDL+L
Sbjct: 70  LAKA----LKESSK-PRSEIFITDKYSTQT----KFTNDPIEGLNTGLKTLGLDYVDLYL 120

Query: 116 IHNPCAETEKRLG-----TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMV 170
           IH+P  + E +        +K ++  YK GK K+IGVS++S+K++EE+    G  +KP V
Sbjct: 121 IHSPFFDPEFKGSLTLEKVWKDMETLYKEGKAKSIGVSNFSVKNIEEILKIAG--IKPQV 178

Query: 171 NQFELNPWLTRK--DLVKYCKERDLVIEAFSPI----TRSKRFSDPVVQKLLKE--SYPG 222
           NQ E N +L  +   +V YC++ ++ +EA+SP+     R +  ++      + E  S  G
Sbjct: 179 NQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLGPLQKRPENSNELPFYNYIDELASKYG 238

Query: 223 RTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGF 282
           +T +Q+L+ W    G +P+  S    R     +   F ++ +++ TLT  G   L QP  
Sbjct: 239 KTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTKDEVDTLTKLG---LEQPAL 295

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  114 bits (284), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 154/295 (52%), Gaps = 41/295 (13%)

Query: 10  TLTNGVKIP---VLGFGTYETPKEK---------AESIVHAAFKQGYRHVDTAQLYENER 57
           TL NG KIP   ++G GT    +E+          E IV+A    G  H+D A++Y    
Sbjct: 9   TLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYP 68

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE---LEYVDLF 114
           E   A++  L E P   R+++F T K +       K  +S    L++A +    +YVDL+
Sbjct: 69  EVGKALS--LTEKP---RNEIFLTDKYSTQI----KVSESPAVGLDIALKKMGTDYVDLY 119

Query: 115 LIHNPCAETEKRLGT----YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMV 170
           L+H+P    E    T    +K +++ Y++GK K IGVS++++K LE +   +  E++P V
Sbjct: 120 LLHSPFVSKETNGFTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDLERIL--KVAEIRPQV 177

Query: 171 NQFELNPWLTRK--DLVKYCKERDLVIEAFSPI-----TRSKRFSDPVVQ--KLLKESYP 221
           NQ E +P+L  +   + K+C+E D+++EA+SP+       +K  S P  +  K L E Y 
Sbjct: 178 NQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDESLPFFEYVKELSEKYI 237

Query: 222 GRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG-EH 275
            ++ AQ+ +RW  + G +P+  S    R     +   F+++ E++  +T  G EH
Sbjct: 238 -KSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVNQITELGLEH 291

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  113 bits (283), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 154/300 (51%), Gaps = 41/300 (13%)

Query: 10  TLTNGVKIP---VLGFGTYETPKEKAES-IVHAAFKQ--------GYRHVDTAQLYENER 57
           TL NG KIP   V+G GT    KE+ ++   HA  KQ        G  HVD A++Y    
Sbjct: 9   TLNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYP 68

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIH 117
           E + A+     ++ K  R+++F T K +         ++ +   L+    LEYVDL+L+H
Sbjct: 69  EFSEAL-----KNTKKPRNEIFVTDKYSVQEKITNDPREGLDTGLKRTG-LEYVDLYLLH 122

Query: 118 NPCAETEKRLGT----YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQF 173
           +P A  EK   T    +  L+E Y  GK K IGVS++ ++ LE++   +  +VKP VNQ 
Sbjct: 123 SPFASKEKNGFTIEEAWAQLEELYHEGKAKNIGVSNFRVEDLEKIL--KVAKVKPQVNQI 180

Query: 174 ELNPWLTRK--DLVKYCKERDLVIEAFSPIT---------RSKRFSDPVVQKLLKESYPG 222
           E + +L  +   +VK+ ++ D+ +EA++P+          ++K F D +  K L E Y  
Sbjct: 181 EFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKPFYDYI--KKLTEKY-S 237

Query: 223 RTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGF 282
           +T AQ+L+RW  + G +P+  S    R E   +   F+++ +++  +T  G   LA P  
Sbjct: 238 KTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVDEITKLG---LAHPAL 294

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  113 bits (282), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 155/289 (53%), Gaps = 35/289 (12%)

Query: 10  TLTNGVKIP---VLGFGTY-----ETPKEKAESIVHAAFKQ-----GYRHVDTAQLYENE 56
           TL+NG KIP   ++G GT      ET    ++ +V    K      G  H+D A++Y   
Sbjct: 8   TLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTY 67

Query: 57  RECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLI 116
            E   A    LK++ K  RD++F T K +      E  K ++  SL+    ++YVDL+L+
Sbjct: 68  PELGAA----LKDTKK-PRDEIFITDKYSTLKQLSENPKVALETSLKKLG-VDYVDLYLL 121

Query: 117 HNPCAETEKRL---GTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQF 173
           H+P  + E +L     +K L+E YK+GK K IGVS++++K LE+L +    EVKP VNQ 
Sbjct: 122 HSPIIK-ESKLDVEANWKYLEELYKSGKAKNIGVSNFAVKDLEKLLAVA--EVKPQVNQI 178

Query: 174 ELNPWLTRK--DLVKYCKERDLVIEAFSPITRSKRFSD-----PVVQKL--LKESYPGRT 224
           E +P+L  +   +V++ ++  +++EA+SP+   +R  +     P  Q +  L + Y  ++
Sbjct: 179 EFSPFLQNQTPGIVEFSQKNGILLEAYSPLGPLQRRPEDADKLPFYQYIAELSKKY-NKS 237

Query: 225 PAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
            AQ+L+ W  + G +P+  S   +R +       F ++ E+++ +T  G
Sbjct: 238 EAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEEVQKITQLG 286

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  113 bits (282), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 97/297 (32%), Positives = 150/297 (50%), Gaps = 38/297 (12%)

Query: 10  TLTNGVKI---PVLGFGTYETPKEKAESIVHAAFKQ--------GYRHVDTAQLYENERE 58
           TL NG KI    ++G GT    + +A  + +    Q        G  HVD A+ Y    E
Sbjct: 9   TLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRTYPE 68

Query: 59  CATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE---LEYVDLFL 115
              A    LKES K  R+++F T K +       K   + IE+L  A +   L+YVDL++
Sbjct: 69  LNKA----LKESSK-PRNEIFITDKFST----LLKITANPIEALNTALDSLGLDYVDLYV 119

Query: 116 IHNPCAETE-KRLGTYKALQEF-YKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQF 173
           +H P  + E K L    A  E  YK GK K IGVS++SI+HLE +      +VKP VNQ 
Sbjct: 120 LHFPEFDPEYKDLSIETAWMELLYKEGKAKNIGVSNFSIEHLERVMKIA--DVKPQVNQI 177

Query: 174 ELNPWLTRK--DLVKYCKERDLVIEAFSPIT----RSKRFSDPVVQKLLKE--SYPGRTP 225
           E N +L  +   +VKYC++    +EA+SP+     + K F++    K + E  +  G+T 
Sbjct: 178 EFNAFLQNQTPGIVKYCQQNGFQLEAYSPLAPLQRKPKNFNELPFYKYIDEVSAKYGKTD 237

Query: 226 AQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGF 282
           +++L+RW  + G VP+  S   +R  +  +   F+++ E++  +T  G   L QP  
Sbjct: 238 SEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTDEEVDKITKLG---LEQPAL 291

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  113 bits (282), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 137/292 (46%), Gaps = 48/292 (16%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           S+   L NG+K+P++G G ++ P       V+ A K GYR  D A+ Y NE+E    + +
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA---- 121
            + E   V R  +F  +K+    H  +  K ++ ++L     L+Y+DL+ IH P A    
Sbjct: 62  AIDEK-IVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLG-LDYLDLYYIHFPLAFKFV 119

Query: 122 ------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157
                                   +    L TY A++   + G IK+IGVS+     L++
Sbjct: 120 PIEEKYPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQD 179

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRS------------- 204
           +    G ++KP+  Q E +P+LT+  LV YCK   +++ A+S   +              
Sbjct: 180 VLM--GCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDT 237

Query: 205 -KRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLH 255
              F  PV++++   S    T +++L+RW+ Q G   +PKS  ++R   NL+
Sbjct: 238 PNLFDHPVIKRI--ASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLN 287

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  112 bits (281), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 143/280 (51%), Gaps = 44/280 (15%)

Query: 10  TLTNGVKIPVLGFGTYETPKEK---AESIVHAAFKQGYRHVDTAQLYENERECATAVAKF 66
            L NG +IP +G GT   PK+K    +  V AA K G+R +DTA  Y  E     A+ + 
Sbjct: 12  NLNNGTRIPAVGLGT-ANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQEL 70

Query: 67  LKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKR 126
             E   V R+ +F TTKV  +   +++A+KS+ ESL+   +L+YVDL L H P    +K+
Sbjct: 71  FAEG-VVKREDLFITTKVWPNY--WDQAEKSLNESLKRL-QLDYVDLLLQHWPFCFVKKQ 126

Query: 127 ---------------------------LGTYKALQEFYKA---GKIKAIGVSSYSIKHLE 156
                                      L TYK ++  Y A    +++AIGVS+Y I++LE
Sbjct: 127 DPEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLE 186

Query: 157 ELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQK 214
            L+  +  +  P +NQ EL+P L +++L  YC +  +++ ++SP+    +     P+VQ+
Sbjct: 187 RLF--KECKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQE 244

Query: 215 LLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNL 254
           L  +         +L+ + ++ G + +P+S++ +R    L
Sbjct: 245 LASKY--NANGNDVLVSYHIRQGTIVIPRSLNLERISKGL 282

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  111 bits (277), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 91/294 (30%), Positives = 151/294 (51%), Gaps = 44/294 (14%)

Query: 10  TLTNGVKIP---VLGFGT-----YET----PKEKAESIVHAAFKQGYRHVDTAQLYENER 57
            L NG KIP   ++G GT      ET         E I++A    G  H+D A++Y    
Sbjct: 9   VLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYP 68

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE---LEYVDLF 114
           E   A++  L + P   RD++F T K +       K   S    LE++ +    +YVDL+
Sbjct: 69  EVGKALS--LTKKP---RDEIFLTDKYSTQI----KVSDSPAAGLEVSLKKMGTDYVDLY 119

Query: 115 LIHNPCAETEKRLGT----YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMV 170
           L+H+P    E    T    +K +++ YKAGK K IGVS++++K LE++   +  EVKP V
Sbjct: 120 LLHSPFVSKEANGFTLEEAWKDMEQLYKAGKAKNIGVSNFAVKDLEKIL--KIAEVKPQV 177

Query: 171 NQFELNPWLTRK--DLVKYCKERDLVIEAFSPIT---------RSKRFSDPVVQKLLKES 219
           NQ E +P+L  +   + K+C++ ++++EA+SP+           SK F + V  K L E 
Sbjct: 178 NQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDSKPFFEYV--KELSEK 235

Query: 220 YPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
           Y  ++ AQ+++RW  + G +P+  S    R     +   F+++ E++  +T  G
Sbjct: 236 Y-FKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVDEITELG 288

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  110 bits (274), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 145/286 (50%), Gaps = 31/286 (10%)

Query: 10  TLTNGVKIP---VLGFGTY-----ETPKEKAESIVH----AAFKQGYRHVDTAQLYENER 57
           TL NG KIP   V+G GT      ET    ++ +V     A    G  H+D A++Y    
Sbjct: 9   TLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYP 68

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIH 117
           E A A    L+ES +  RD++F T K +      +     +  SL+    L+YVDL+L+H
Sbjct: 69  EVAAA----LRESNR-PRDEIFITDKYSTQLKLSDDPIAGLNISLKTLG-LDYVDLYLLH 122

Query: 118 NPCAETEKRLG-TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELN 176
           +P  +    L   +K +++ YK+GK K IGVS++ ++ LE++       +KP +NQ E N
Sbjct: 123 SPFIKNGSTLEECWKQMEKLYKSGKAKNIGVSNFRVEDLEKILKIA--TIKPQINQIEFN 180

Query: 177 PWLTRKD--LVKYCKERDLVIEAFSPITRSKRFSD-----PVVQKL--LKESYPGRTPAQ 227
             L  +   +VK+CKE ++ +EA++P+   +R  D     P    +  L + Y  +T AQ
Sbjct: 181 AALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKPFYDYIAELSKKY-NKTEAQ 239

Query: 228 LLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
           +L+RW  + G +P+  S    R     +   F++ + ++  +T  G
Sbjct: 240 ILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVDKITELG 285

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  109 bits (273), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 88/310 (28%), Positives = 147/310 (47%), Gaps = 57/310 (18%)

Query: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65
           ++   L NG K+P++G G ++ P E     ++ A   GYR  D AQ Y NE+E    V +
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESL-EMAKELEYVDLFLIHNPCA--- 121
            +K+   V R+++F  +K+    H  +  K ++  +L +M   L+Y+DLF IH P A   
Sbjct: 62  AIKDG-LVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMG--LDYLDLFYIHFPIALKP 118

Query: 122 --------------ETEKRLG-----------TYKALQEFYKAGKIKAIGVSSYSIKHLE 156
                         E + + G           TY+AL+E  + G IK+IGVS++S   + 
Sbjct: 119 VSFEEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIML 178

Query: 157 ELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--------------T 202
           +L    G  + P   Q EL+P+LT++  VK+ + + + + A+S                 
Sbjct: 179 DLL--RGARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKA 236

Query: 203 RSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEIS 262
               F   VV+K+  +     + +Q+L+RW+ Q     +PKS  ++R   NL  +D E+ 
Sbjct: 237 TPPLFEHDVVKKIAAKH--NVSTSQVLLRWATQQKVAVIPKSSKKERLRQNL-LVDQEV- 292

Query: 263 AEDMKTLTHD 272
                TLT D
Sbjct: 293 -----TLTGD 297

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  109 bits (272), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/297 (28%), Positives = 154/297 (51%), Gaps = 44/297 (14%)

Query: 10  TLTNGVKIPVLGFGTYETPKEK---AESIVHAAFKQGYRHVDTAQLYENERECATAVAKF 66
            L NG +IP +G GT  +PK +    +  V AA + GYR +DTA  Y+ E     A+ + 
Sbjct: 12  NLNNGGRIPAIGLGT-ASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKEL 70

Query: 67  LKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP-C----- 120
            ++  ++ R+ +F TTKV      ++    SI ESL+ +  ++YVD+ L H P C     
Sbjct: 71  FRDG-EIKREDLFITTKVWPCY--WDDPSTSINESLK-SLGIDYVDMVLQHWPLCYKKTY 126

Query: 121 -------------------AETEKRLGTYKALQEFY---KAGKIKAIGVSSYSIKHLEEL 158
                              AE    + TY+ +++ Y   K  +++AIGVS+Y I++LE +
Sbjct: 127 DENGTIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLERV 186

Query: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQKLL 216
              +  +V P++NQ EL+P L + +L  +C +  +++ A+SP+    +     P+VQ+  
Sbjct: 187 I--KECKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEYA 244

Query: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
           K+      PA +L  + ++ G V +P+S++ +R  SN++     ++  +MK+L   G
Sbjct: 245 KKH--EVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFA--PLTKNEMKSLDDFG 297

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  108 bits (270), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 88/299 (29%), Positives = 145/299 (48%), Gaps = 44/299 (14%)

Query: 10  TLTNGVKIPVLGFGTYETPKEKAES--IVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
           T  NG K+P  G GT    +  AE+   V AA K GYRH+DTA  Y  E     A+ +  
Sbjct: 12  TFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELF 71

Query: 68  KESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA------ 121
           +E   V R+ +  T+KV   +  +    KS+ ESL   K ++YVDLFL H P        
Sbjct: 72  EER-VVKREDLHITSKVW--HTMWNDVDKSLNESLARLK-VDYVDLFLQHWPLCTQKVPD 127

Query: 122 ---------------------ETEKRLGTYKALQEFY---KAGKIKAIGVSSYSIKHLEE 157
                                E    + TYK +++ Y      +++AIGVS++ I++L+ 
Sbjct: 128 PHGVDKIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKR 187

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKL 215
           +   +     P  NQ EL+P L +++L ++C E  +++ A+SP+    +     P+++ L
Sbjct: 188 VL--KECRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGL 245

Query: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGE 274
             E Y   +P  +L  + L+ G + +P+S++  R  SNL  +   +S ED+  L   G+
Sbjct: 246 C-EKY-NASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFV--PLSEEDVNKLNEFGQ 300

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  107 bits (268), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 150/287 (52%), Gaps = 36/287 (12%)

Query: 13  NGVKIPVLGFGT-------YETPKEKAESI------VHAAFKQGYRHVDTAQLYENEREC 59
           +G  +P +GFG+         + K K   I      V  A + G+ H+DTA+ Y+  +E 
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 60  ATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMA---KELEYVDLFLI 116
            T ++     + +V R+ ++ T K    +  + K    + ESL ++     L+YVDL++I
Sbjct: 74  GTGIS-----NAQVPRETLWITDKYTPWSWEWRKGSGPL-ESLTLSLKEMNLDYVDLYMI 127

Query: 117 HNPCAETEKRLG-----TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVN 171
           H P   T K  G      +  ++E Y     + IGVS++ ++ LE + S+   + +P+VN
Sbjct: 128 HVPNITT-KTAGIDLKEAWLQMEEIYTRKMARNIGVSNFDVESLEYIKSFA--KYQPVVN 184

Query: 172 QFELNPWLTRKD--LVKYCKERDLVIEAFSPIT-RSKRFSDPVVQKL--LKESYPGRTPA 226
           Q E + ++ ++   ++KYC+E ++V+E +SP+   +K    P+ + L  +   Y G++  
Sbjct: 185 QIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKPGPLDEILPGIAAKY-GKSQL 243

Query: 227 QLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
           Q+L+RW  Q G V +  +  ++R   +L+  DFE+S ED   +T+ G
Sbjct: 244 QVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQITNVG 290

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  107 bits (267), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/288 (29%), Positives = 144/288 (50%), Gaps = 32/288 (11%)

Query: 10  TLTNGVKIP---VLGFGT--YE-TPKEK-----AESIVHAAFKQGYRHVDTAQLYENERE 58
           TL NG KIP   ++G GT  Y+  P++K      + I +A    G  H+D A++Y+   E
Sbjct: 9   TLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQTHAE 68

Query: 59  CATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHN 118
              A+      + K  RD++F T K A         K+ +  +LE    LEYVDL+L+H 
Sbjct: 69  VGEAL-----RNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMG-LEYVDLYLLHF 122

Query: 119 PCAETEKRLGT----YKALQEFYKAGKIKAIGVSSYSIKHLEELY-SWEGLEVKPMVNQF 173
           P  + +    T    +K +++ Y  G  K IGVS++ ++ LE+L  SW    +KP +NQ 
Sbjct: 123 PIIDPKLYDFTLEEAWKMMEDLYNEGLAKNIGVSNFRVEDLEQLSKSWV---IKPQINQI 179

Query: 174 ELNPWLTRK--DLVKYCKERDLVIEAFSPITRSKRFSD----PVVQKLLKESYPGRTPAQ 227
           E N +L  +   +  YC + ++ +EAF P+   +  ++    P+  K L + Y  +T  Q
Sbjct: 180 EFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKDLLPLYVKQLAQKY-SKTENQ 238

Query: 228 LLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEH 275
           +++RW  Q   +P+  S   +R         FE++ ++++ +T  G  
Sbjct: 239 IMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDEVEFITKLGSQ 286

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  107 bits (267), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 138/274 (50%), Gaps = 43/274 (15%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAES--IVHAAFKQGYRHVDTAQLYENERECATAVAKFLK 68
           L NGV +P LG GT    +  AE+   V AA K GYRH+DTA  Y  E     A+ + L 
Sbjct: 13  LNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKELL- 71

Query: 69  ESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA------- 121
           E+  V R  +F T+KV      ++    S+ ESL+ +  L+YVDL+L H P         
Sbjct: 72  ENGDVKRSDLFITSKVWPVY--WDDVDLSLNESLK-SLGLDYVDLYLQHWPLCFQKIEDS 128

Query: 122 ---------------------ETEKRLGTYKALQEFY---KAGKIKAIGVSSYSIKHLEE 157
                                E    L TYK +++ Y   K  +++AIGVS+Y +++L+ 
Sbjct: 129 KDGVNGLKGKPIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLDR 188

Query: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR--FSDPVVQKL 215
           L   +   VKP VNQ E++P L + +L ++C+  D+ + A+SP+  S       P+V++ 
Sbjct: 189 LL--KVCTVKPAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPLVKE- 245

Query: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDR 249
           L E Y   T   +LI + ++ G   +P+S++  R
Sbjct: 246 LSEKYQ-VTLNDVLISYHIRKGSFVIPRSLNPVR 278

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  106 bits (265), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 147/278 (52%), Gaps = 42/278 (15%)

Query: 11  LTNGVKIPVLGFGTYETPKEKAES--IVHAAFKQGYRHVDTAQLYENERECATAVAKFLK 68
           L NGV++P +G GT   P++ AE+   V AA K GYR++DTA  Y +E     A+ + ++
Sbjct: 13  LNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVGEAIKELIE 72

Query: 69  ESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA------- 121
           E   + R+ +F T+KV      ++ A++S+ ESL+ +  ++Y+DL+L H P         
Sbjct: 73  EG-AIKREDLFITSKVWP--VLWDDAERSLQESLK-SLGVDYIDLWLQHWPLCYNRREDP 128

Query: 122 --------------------ETEKRLGTYKALQEFY---KAGKIKAIGVSSYSIKHLEEL 158
                               E    L TYK ++  Y   K  +++AIGVS++ +++L+ +
Sbjct: 129 HGINGLARNPEKADGSPDFNEKADWLDTYKQMERIYSNPKDNRVRAIGVSNFPVEYLKRV 188

Query: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQKLL 216
              +   VKP++NQ E++P L + +L ++C + D+ + A+SP+    +     P+++++ 
Sbjct: 189 L--KECPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHPLIKEMS 246

Query: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNL 254
           ++         +L  + ++ G   +P+S++  R  SN+
Sbjct: 247 QKYKASEN--DILTSFHIRQGNTVVPRSINSVRIASNI 282

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  106 bits (264), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 91/297 (30%), Positives = 154/297 (51%), Gaps = 50/297 (16%)

Query: 10  TLTNGVKIP---VLGFGT--YETPK-------EKAESIVHAAFKQGYRHVDTAQLYENER 57
           TL NG KIP   V+G GT  ++T +       E  + + +A    G  H+D A++Y    
Sbjct: 9   TLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYP 68

Query: 58  ECATAVAKFLKESPKVSRDQVFYTTKVA-----GDNH--GYEKAKKSIIESLEMAKELEY 110
           E   A    L+E+ K  R++++ T K +      DN   G+E   K +         ++Y
Sbjct: 69  ELGKA----LRETKK-PRNEIWITDKYSTSLKLSDNPIVGFENGLKEL--------GVDY 115

Query: 111 VDLFLIHNPCAETEKRLG-----TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLE 165
           +DL+L+H+P   TE R G      +K L+E YK+GK K IGVS+++ + LE +   +  E
Sbjct: 116 IDLYLLHSPFI-TEGRNGFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERIL--KIAE 172

Query: 166 VKPMVNQFELNPWLTRK--DLVKYCKERDLVIEAFSPITRSKRF-----SDPVVQKL--L 216
           +KP VNQ E + +L  +   +  + KE D+++EA+SP+   +R      S P  + +  L
Sbjct: 173 IKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADSLPFYKYINEL 232

Query: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
            E Y G++ AQ+L+RW  + G +P+  S    R     H   F++++ +++ +T  G
Sbjct: 233 AEKY-GKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVEKITELG 288

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  106 bits (264), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 145/280 (51%), Gaps = 44/280 (15%)

Query: 10  TLTNGVKIPVLGFGTYETPKE--KAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFL 67
           TL NGV++P LG GT     E  + +  V AA K GYRH+DTA  Y +E     A+ + +
Sbjct: 15  TLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKELM 74

Query: 68  KESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKR- 126
           +E   + R+ +F T+KV      ++  ++S+ ESLE +  ++Y+DL+L H P    ++  
Sbjct: 75  EEG-VIRREDIFITSKVWPV--LWDDVERSLNESLE-SLGVDYIDLWLQHWPLCYVKQED 130

Query: 127 --------------------------LGTYKALQEFY---KAGKIKAIGVSSYSIKHLEE 157
                                     L TY  +++ Y      ++++IGVS++ +++LE 
Sbjct: 131 THGINGLARNPETPNGEPYYEVDGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQYLER 190

Query: 158 -LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPIT--RSKRFSDPVVQK 214
            L+      VKP VNQ E++P L + +L K+C+  ++++EA+SP+    +      +VQ 
Sbjct: 191 TLFE---CAVKPAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLVQD 247

Query: 215 LLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNL 254
            L E Y   +P+ +L  + ++ G   + +SV+  R  SN+
Sbjct: 248 -LAEKY-SMSPSGILNSYHIRQGNAVVSRSVNTMRIASNV 285

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  103 bits (257), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 144/292 (49%), Gaps = 40/292 (13%)

Query: 10  TLTNGVKIPVLG-----------FGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERE 58
           TL NG  IP +            +G  +  K   E +       G+ H+ TA+ Y N   
Sbjct: 10  TLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNGL 69

Query: 59  CATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE---LEYVDLFL 115
            + A    LK S K  R +++ T K         K   S IE+LE + +    +YVDL+L
Sbjct: 70  LSAA----LKASQK-PRHEIWITDKYCSQC----KLSSSPIEALERSLDRLGFDYVDLYL 120

Query: 116 IHNPCAETEKRL----GTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVN 171
           IHNPC ++          +K ++  YK GK+K IGVS++ I+ LE L   +  E+KP VN
Sbjct: 121 IHNPCLDSSPNGISLEKAWKQMELLYKTGKVKNIGVSNFRIEDLERL---KDAEIKPQVN 177

Query: 172 QFELNPWLTRK--DLVKYCKERDLVIEAFSPI----TRSKRFSD-PVVQKL--LKESYPG 222
           + E + +L  +  ++ +Y K  DL++  +SP+    T+++ F D P  + +  L E Y  
Sbjct: 178 EIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDFPFYRYIIGLAEKY-N 236

Query: 223 RTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGE 274
           +T AQ+L+ W   +G +P+  +      +     + FE+++E++  +T  G+
Sbjct: 237 KTEAQILLHWMNCLGVLPVITNTKVKWYKEASDIISFELTSEELDMITELGK 288

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score = 97.4 bits (241), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 145/291 (49%), Gaps = 40/291 (13%)

Query: 11  LTNGVKIP---VLGFGT-----YETPKEKAESIV----HAAFKQGYRHVDTAQLYENERE 58
           L NG ++P   ++G GT      ET +  ++++V    +A    G  H+D A+ Y   RE
Sbjct: 9   LNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTYRE 68

Query: 59  CATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE---LEYVDLFL 115
              A+A+  K      RD++F T K         K  ++ I  LE   +   LEYVDL+L
Sbjct: 69  VGRALAETSK-----PRDEIFITDKYWT----LSKVTENPIVGLETGLKRLGLEYVDLYL 119

Query: 116 IHNPCAETEKRLGT----YKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVN 171
           +H+P    E    +    +  ++E Y +GK K IGVS+++ + LE +   +  +VKP VN
Sbjct: 120 LHSPFISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLERVL--KVCKVKPQVN 177

Query: 172 QFELNPWLTRK--DLVKYCKERDLVIEAFSPIT-RSKRFSDPVVQKL------LKESYPG 222
           Q E N +L  +   +  +CK+ D+ + A+SP+    K+ +D   Q        L + Y  
Sbjct: 178 QIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPADGNSQPFYSYINKLAQHY-N 236

Query: 223 RTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDG 273
           +TP Q+L+RW  + G V +  S  ++R +      +F++  +++  +T  G
Sbjct: 237 KTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEVTEITKLG 287

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 90.9 bits (224), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 1/100 (1%)

Query: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
           + I   T   L NG +IPV+GFG YE PKE     V++A K GYRH+DTA LY N++E A
Sbjct: 5   IDINRETRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAA 64

Query: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIE 100
             V K+L E+ + +R+ +++TTK+     G E+ KK++ E
Sbjct: 65  QGVRKYLDETGE-ARENIWFTTKLWDSQFGREETKKALQE 103

>TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 120/297 (40%), Gaps = 58/297 (19%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV---- 84
           K+K+  I+  A+  G R  DTA LY N +     + +FLKE   +SR+ V   TK+    
Sbjct: 16  KQKSYKILKRAYDLGLRTYDTADLYSNGQSEIIILGEFLKEY-NISRETVVIMTKLFAPV 74

Query: 85  ---------AGDNHGYEK---------AKKSIIESLE--MAKELEYVDLFLIHNPCAETE 124
                     G  HG +          +KK IIE+ +  + +   Y+D++ +H    +T 
Sbjct: 75  DDTLPDYQPTGGLHGNQTIHFANQRGLSKKHIIEACKNSLRRLGTYIDVYQVHRADPDTP 134

Query: 125 KRLGTYKALQEFYKAGKIKAIGVSSY-SIKHLEELYSWEGLEVKPMVNQFELNPWLTR-- 181
               T +AL +  + G  + IG SS    K  E  +  E       VN  +    L R  
Sbjct: 135 ME-ETMRALNDVVQQGLTRYIGASSMLGTKFAEYQFIAEKNGWSKFVNMQDCYNLLYREE 193

Query: 182 -KDLVKYCKERDLVIEAFSPITRS---------------------------KRFSDPVVQ 213
            ++++ Y K+  +    +SP+ R                            + F   +++
Sbjct: 194 EREMIPYIKKHGIAQTPWSPLQRGLLSRPVEGSSYREDNDRVLKGQRLNQYEDFEIEIIK 253

Query: 214 KLLKESYPGRTPAQLL-IRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
           ++ + S     P  ++   W L  G  P+      +R E  + AL+ E++ E++K L
Sbjct: 254 RVEEISKKRNNPMAVISTAWVLSKGTFPILGLNSVERMEDAVRALNIELTEEELKYL 310

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 96/199 (48%), Gaps = 23/199 (11%)

Query: 15  VKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLY-ENERECATAVAKFLKESPKV 73
           +KI   G+ T+     +  + +    K G + +DTA++Y +NE+    A+ +   + P  
Sbjct: 1   IKIIYGGY-TFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNEK----AIGEL--QLP-- 51

Query: 74  SRDQVFYTTKVAGDNHG---YEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLGTY 130
             D+    TK +G + G    +   KSI ESL +   +  V+ FL+H+P  E      T 
Sbjct: 52  --DRFTIHTKASGFSGGCLTRDNINKSIEESLSLLG-VPSVETFLLHSPDPEIPLE-ETL 107

Query: 131 KALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLE--VKPMVNQFELNPWLTR---KDLV 185
            A+   Y+ GK +  G+S++S + ++ +Y +   +  V P V Q   N  L+R    DL 
Sbjct: 108 DAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNA-LSRAIVNDLF 166

Query: 186 KYCKERDLVIEAFSPITRS 204
              KE  + + A+SPI R 
Sbjct: 167 PLLKELHISLYAYSPIARG 185

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 83/182 (45%), Gaps = 20/182 (10%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDN 88
           +E+A   V    K     +DTA++Y    E   A+ KF  E PK         TK  G  
Sbjct: 19  QEEASKFVDVLEKYKVEELDTARIYPGSEE---AIGKF--ELPK----SFIIDTKARGFG 69

Query: 89  HGYEKAKKSIIESLEMAKEL---EYVDLFLIHNPCAETEKRLGTYKALQEFYKAGKIKAI 145
            G    K+SI ES+E +  L   E V++F +H P   T     T  A+   YK GK K  
Sbjct: 70  EG-TLTKESINESIEESFGLLGVESVEIFYLHCPDPATPLE-ETLDAIDALYKEGKFKKF 127

Query: 146 GVSSYSIKHLEELYSW--EGLEVKPMVNQFELNPWLTRK---DLVKYCKERDLVIEAFSP 200
           GVS++S + + ++YS+  E   V P V Q   N  + RK    L    +E  L   A+SP
Sbjct: 128 GVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNA-VGRKIETSLFPVLRELGLSFYAYSP 186

Query: 201 IT 202
           I 
Sbjct: 187 IA 188

>SAKL0E00264g Chr5 complement(12234..13181) [948 bp, 315 aa] {ON}
           conserved hypothetical protein
          Length = 315

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 87/199 (43%), Gaps = 20/199 (10%)

Query: 12  TNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESP 71
            N VKI    F     PK++ E ++    K   + +DTA++Y    +    +        
Sbjct: 3   NNHVKIIYGAFPITHLPKDQLEDVLQLLEKYNVKDLDTARIYPGSEKSIGEL-------- 54

Query: 72  KVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKEL---EYVDLFLIHNPCAETEKRLG 128
            +S     +T  VA        +K+SI+ES+  +  L   E V+ F +H P   T     
Sbjct: 55  NLSASYTIHTKAVAFQERSL--SKESIVESIGESLSLLKTEKVETFYLHCPDPATPIE-E 111

Query: 129 TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLE--VKPMVNQFELNPWLTR---KD 183
           T +A+ E YK GK    G+S+Y    + ++Y +   +  V P V Q   N  ++R   KD
Sbjct: 112 TLEAINELYKDGKFVHFGLSNYPASDVRKIYEYAASKGYVLPTVYQGNYNA-VSRKIEKD 170

Query: 184 LVKYCKERDLVIEAFSPIT 202
           L    +E  +   A+SPI 
Sbjct: 171 LFPVLRELKITFYAYSPIA 189

>NDAI0H02960 Chr8 (721089..722123) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 41/208 (19%)

Query: 26  ETPKEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKFLKESPKVSRDQVFYTT 82
           E  KEK   I+   +  G+R  DTA +Y N   ER     + KF      + R+ V   T
Sbjct: 37  EDDKEKVFQILKHCYDIGFRTFDTADVYSNGKSERLLGEFLRKF-----NIRRETVVILT 91

Query: 83  KV-----------AGDNHGYEK-----------AKKSIIESLEMAKEL--EYVDLFLIHN 118
           K             GD +  E            ++K I++S++ + E    Y+D+  IH 
Sbjct: 92  KTNFPVDETLVLPIGDANRSENDTLDLVNQQGLSRKHILQSVKNSVERLGTYIDVLQIHR 151

Query: 119 PCAETEKRLGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMVNQ 172
               T  +  T KAL +  + G ++ IG SS        ++ + + Y W   +   + +Q
Sbjct: 152 FDPNTPIK-ETMKALNDVVEKGDVRYIGASSMLPTQFVEMQGVADKYDW--FQFVNVQSQ 208

Query: 173 FELNPWLTRKDLVKYCKERDLVIEAFSP 200
           + L      +DL+KYCK+ ++ +  +SP
Sbjct: 209 YNLLYREDERDLMKYCKKHNIALTPWSP 236

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 127/315 (40%), Gaps = 63/315 (20%)

Query: 15  VKIPVLGFGT------YETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLK 68
           + I  + FG+       E  +EK   I+  A+ +G R  DTA +Y N  E    + +FLK
Sbjct: 19  IIIGCMSFGSKKWSEWVEDDREKIFKILKYAYDKGLRTYDTANVYSNG-ESEIILGEFLK 77

Query: 69  ESPKVSRDQVFYTTKV---AGDNHGYE-----------------KAKKSIIESL-EMAKE 107
            + K+ R+ V   TK+     DN  Y+                  ++K+II S  +  + 
Sbjct: 78  -NYKIPRETVIIMTKLYFPTNDNADYDIFSMTPEAILNNVNITGLSRKNIINSARDSVRR 136

Query: 108 L-EYVDLFLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSY-SIKHLEELYSWEGLE 165
           L  Y D+  IH    +T     T +AL +    G  + IG SS  + + +E  +  E  +
Sbjct: 137 LGTYADIIQIHRADPDTPFE-ETMRALNDIVVDGLTRYIGASSMLATEFVEMQFIAEKND 195

Query: 166 VKPMVNQFELNPWLTRKD---LVKYCKERDLVIEAFSPITR----------SKRF----- 207
               +N       L R+D   L+ + K  ++ +  +SP+ R          S RF     
Sbjct: 196 WFKFINSQSCYNLLYREDERELIPFAKRHNIALTPWSPLQRGVLCRPVGETSTRFEKDQF 255

Query: 208 -----------SDPVVQKLLKESYPGRTP--AQLLIRWSLQMGFVPLPKSVHEDRAESNL 254
                      SD  +   ++E    R    A + + W +Q G  P+      DR +  +
Sbjct: 256 MSIGNIKDINSSDEEIITRVEEIAKKRNTKMATVALYWVIQKGCFPIVGMSKIDRIDEAI 315

Query: 255 HALDFEISAEDMKTL 269
            AL+  ++ ++M  L
Sbjct: 316 AALEINLTKDEMTYL 330

>NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 119/294 (40%), Gaps = 54/294 (18%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKF-LKESPKVSRDQVFYTTKV 84
           KEK  SI+   +  G R  DTA +Y N   ER     + K+ ++    V   ++FY    
Sbjct: 39  KEKIFSILKHCYDNGLRTFDTADVYSNGLSERIIGEFLKKYNIRRETVVILTKIFYPVDE 98

Query: 85  AGD-NHGYEK--------------AKKSIIESLEMAKEL--EYVDLFLIHNPCAETEKRL 127
             D +HG                 ++K II  ++ + E    Y+D+  IH    +T K  
Sbjct: 99  TLDLHHGNSTNERNALDLVNQNGLSRKHIITGVKNSVERLGTYIDVLQIHRLDHDTPKE- 157

Query: 128 GTYKALQEFYKAGKIKAIGVSSYSIKHLEEL-YSWEGLEVKPMVNQFELNPWLTRKD--- 183
              +AL +    G ++ IG SS       EL ++ E       V+       L R+D   
Sbjct: 158 EIMRALNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLLNREDERE 217

Query: 184 LVKYCKERDLVIEAFSPITR-----------SKRFSDPVVQKL----LKE---------- 218
           L+ +CK+  + +  +SP  R           +++ +DP   ++    L E          
Sbjct: 218 LIPFCKKHGVGLIPWSPNARGVLTRPLEQQTTRKLTDPTFIRMGLDKLSEDQKEIVRRVE 277

Query: 219 ---SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
              +    + A L I W+L  G  P+      +R +  + A+D E++ +D+K L
Sbjct: 278 HLAAKKNISMAMLSIAWTLHKGANPIVGLNSIERVDEAIKAIDVELTEDDIKYL 331

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 73/326 (22%), Positives = 129/326 (39%), Gaps = 77/326 (23%)

Query: 17  IPVLGFGT------YETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKES 70
           I  + FG+       +  KE+A  I+  A+ +G R  DTA +Y N  +    + +FL++ 
Sbjct: 21  IGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNG-QSEIILGEFLRKY 79

Query: 71  PKVSRDQVFYTTKV---AGDNHGYE-----------------KAKKSIIESLEMA-KEL- 108
             + R+ V   TK+   A +N   +                  ++KSI  S   + K L 
Sbjct: 80  -NIPRETVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSSRASVKRLG 138

Query: 109 EYVDLFLIH--NPCAETEKRLGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYS 160
            Y+D+  IH  +P    E+ +G   AL +    G  + +G S         ++ + E + 
Sbjct: 139 TYIDILQIHRGDPDTPFEETMG---ALNDVVIEGLTRYVGASLMLATEFAEMQFVAEKHG 195

Query: 161 WEGLEVKPMVNQFELNPWLTRKD---LVKYCKERDLVIEAFSPITRS------------- 204
           W        VN       + R+D   L+ + K  ++ +  FSP+ R              
Sbjct: 196 W-----FKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPLNRGLLCRPLGTETTRS 250

Query: 205 -----------KRFSD---PVVQKLLKESYPGRTPAQLL-IRWSLQMGFVPLPKSVHEDR 249
                      K ++D    ++ ++ K S     P   + + W LQ G  P+      +R
Sbjct: 251 NSDSVIKTKNLKNYTDWEASIINRVEKLSIKKNIPMSAISLAWVLQKGCFPIVGFSSIER 310

Query: 250 AESNLHALDFEISAEDMKTLTHDGEH 275
            E  + ALD  ++ E+MK L    +H
Sbjct: 311 VEEAIDALDVNLTEEEMKYLEEPYQH 336

>NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {ON}
           
          Length = 343

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 118/294 (40%), Gaps = 54/294 (18%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKF-LKESPKVSRDQVFYT--- 81
           KEK  +I+   +  G R  DTA +Y N   ER     + K+ +K    V   ++FY    
Sbjct: 39  KEKIFNILKHCYDNGLRTYDTADVYSNGVSERLIGEFLKKYNIKRETVVIFTKIFYAVDE 98

Query: 82  ------TKVAGDNHGYEKA------KKSIIESLEMAKEL--EYVDLFLIHNPCAETEKRL 127
                 + V  + +  + A      +K II  ++ + E    Y+D+  IH    +T K  
Sbjct: 99  TLDLPRSNVPNERNDLDLANQGGLSRKHIITGVKNSVERLGTYIDVLQIHRLDHDTPKE- 157

Query: 128 GTYKALQEFYKAGKIKAIGVSSYSIKHLEEL-YSWEGLEVKPMVNQFELNPWLTRKD--- 183
              +AL +    G ++ IG SS       EL ++ E       V+       L R+D   
Sbjct: 158 EIMRALNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLLNREDERE 217

Query: 184 LVKYCKERDLVIEAFSPITR-----------SKRFSDPVVQKLLKESYPGR--------- 223
           L+ +CK   + +  +SP  R           +++ SDP +  +  ++             
Sbjct: 218 LIPFCKRHGVGLIPWSPNARGILTRPLEQQSTRKLSDPTITNMGLDNLADDQKEIVKRVE 277

Query: 224 --------TPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
                   + A L I W+L  G  P+      +R +  + A+D +++ +D+K L
Sbjct: 278 HLATKKNISMAMLSISWALHKGANPIVGLNSIERVDEAIKAIDVKLTEDDIKYL 331

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 80/170 (47%), Gaps = 22/170 (12%)

Query: 41  KQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGY---EKAKKS 97
           K G + +DTA++Y +         K + E    +R  +   TK +G + G    +   KS
Sbjct: 31  KAGVKDIDTARIYPDSE-------KIIGELQLPNRFTIH--TKASGFSGGCLTKDNINKS 81

Query: 98  IIESLEMAKELEYVDLFLIHNPCAET--EKRLGTYKALQEFYKAGKIKAIGVSSYSIKHL 155
           I ESL +   +  V+ F +H+P  ET  E+ LG   A+   Y+ GK K  G+S+++ + +
Sbjct: 82  IEESLSLLG-VPSVETFFLHSPDPETPIEETLG---AINSLYEQGKFKKFGLSNFATEDV 137

Query: 156 EELYSWEGLE--VKPMVNQFELNPW--LTRKDLVKYCKERDLVIEAFSPI 201
           + +Y +   +  V P V Q   N +      DL    +E      A+SPI
Sbjct: 138 KRIYEYAKSKNFVLPTVYQGSYNAFSRAIENDLFPLLRELHFSFYAYSPI 187

>SAKL0C14058g Chr3 (1248968..1249915) [948 bp, 315 aa] {ON}
           conserved hypothetical protein
          Length = 315

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 90/199 (45%), Gaps = 20/199 (10%)

Query: 12  TNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV---AKFLK 68
            N VKI    +     PK++   ++H   K   + +DTA++Y +  +    +   AK+  
Sbjct: 3   NNRVKIIYGAYPIPFIPKDQLSEVLHVLEKYNVKDLDTARVYPDGEKSIGKLNLPAKYTI 62

Query: 69  ESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLG 128
            +  V+    F    ++ D+       +SI ESL + K  + V+ F +H P   T     
Sbjct: 63  HTKAVT----FQDGALSKDS-----IVESIGESLSLLKT-DKVETFYLHCPDPTTPIE-E 111

Query: 129 TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLE--VKPMVNQFELNPWLTR---KD 183
           T KA+ E YK GK    G+S+Y    + ++Y +   +  V P V Q   N  ++R   KD
Sbjct: 112 TLKAINELYKEGKFVHFGLSNYPANDVRKIYEYADSKGYVLPTVYQGNYNA-VSRKIEKD 170

Query: 184 LVKYCKERDLVIEAFSPIT 202
           L    +E  +   A+SPI 
Sbjct: 171 LFPVLRELKIAFYAYSPIA 189

>KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 121/303 (39%), Gaps = 65/303 (21%)

Query: 26  ETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV- 84
           E  KEK   I+   + QG R  DTA +Y N   C   + +FL+E  K+ R+ V   TK+ 
Sbjct: 36  EDDKEKVFKILKHCYDQGLRTFDTADVYSNGL-CERLLKEFLEEY-KIRRETVVIMTKLF 93

Query: 85  ------------AGDNHGYEK---------AKKSIIESLEMAKEL--EYVDLFLIHNPCA 121
                            G  K         ++K I+++ + + E    Y+D+  IH    
Sbjct: 94  FPVDETLDLSLGGAIEDGVGKLDLTNQQGLSRKHILDAAKKSVERLGTYIDVLQIHRFDP 153

Query: 122 ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL------YSW-EGLEVKPMVNQFE 174
            T  +  T +AL +  + G  + IG SS     L EL      Y+W + + V+   N   
Sbjct: 154 NTPVK-ETMRALNDVVEMGLTRYIGASSMLGTQLAELQFTADKYNWFQFVNVQSCYNLIY 212

Query: 175 LNPWLTRKDLVKYCKERDLVIEAFSP-----ITR-----SKRFSDPVV-----QKLLK-- 217
                  ++++ + K  +L++  +SP     +TR     S R S  ++      K LK  
Sbjct: 213 RE---DEREIIPFAKRHNLMLTPWSPNHGGLLTRPVGVESARSSTDIILNDWGMKHLKPW 269

Query: 218 --------ESYPGRTPAQLLI---RWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDM 266
                   E    +    + +    W +  G  P+       R + N+ ALD + + E+M
Sbjct: 270 EITIVNRIEELAKKKNVSMAVISAAWVISKGCAPIIGMSSIARVDDNIKALDVQFTNEEM 329

Query: 267 KTL 269
           K L
Sbjct: 330 KYL 332

>Kwal_47.16887 s47 complement(158953..159894) [942 bp, 313 aa] {ON}
           YDL124W - Hypothetical ORF [contig 219] FULL
          Length = 313

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 83/183 (45%), Gaps = 22/183 (12%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDN 88
           K+ A   +    + G   +DTA++YE   E    +      +P+         TK  G  
Sbjct: 19  KDDAHKYLDVLKEHGVDELDTARIYEGSEEALGEL-----RAPET----FVIDTKARGFA 69

Query: 89  HG---YEKAKKSIIESLEMAKELEYVDLFLIHNPCAET--EKRLGTYKALQEFYKAGKIK 143
            G    +   +SI ES  + K +E V++F +H+P   T  E+ L T  +L   Y  GK K
Sbjct: 70  EGSLTRDSINQSIDESFRLLK-VESVNIFYLHSPDPATLLEETLDTINSL---YVKGKFK 125

Query: 144 AIGVSSYSIKHLEELYSW--EGLEVKPMVNQFELNPWLTRKD--LVKYCKERDLVIEAFS 199
             G+S+Y  + + ++YS+  E   V P V Q   N +  + +  L    +E ++   A+S
Sbjct: 126 KFGLSNYKPEDVRKVYSYCKEKGYVLPTVYQGNYNAFARKAESTLFPVLRELEIAFYAYS 185

Query: 200 PIT 202
           PI 
Sbjct: 186 PIA 188

>CAGL0E05214g Chr5 complement(508275..509315) [1041 bp, 346 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 346

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 122/299 (40%), Gaps = 63/299 (21%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV---- 84
           KEK   I+  A+ +G R  DTA +Y N    +  + K   E  ++ R+ V   TKV    
Sbjct: 42  KEKIFGILKHAYDRGLRTYDTADVYSN--GYSERLLKEFFEKYQIKRETVVIMTKVFFGV 99

Query: 85  ---AGDNHGYEK---------------AKKSIIESLEMAKEL--EYVDLFLIHNPCAETE 124
                 +HG +                ++K I+E ++ + E    Y+D+  IH    ET 
Sbjct: 100 DEDLNLHHGLKAYNDHDDLILTNQRGLSRKHILEGVKNSTERLGTYIDVLQIHRLDKETP 159

Query: 125 KRLGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMVNQFELNPW 178
            +    KAL +  +AG  + IG SS        ++ + E ++W   +   + + + L   
Sbjct: 160 MK-EIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNW--FQFVSLQSFYNLLNR 216

Query: 179 LTRKDLVKYCKERDLVIEAFSPITR----------SKRF-SDPVVQKL------------ 215
              ++++ + K  ++ +  +SP  R          + R  SDP  + L            
Sbjct: 217 EDEREIIPFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLDLDNLTEDQKEI 276

Query: 216 ---LKESYPGRTPAQLLI--RWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
              ++E       +  +I   W L  G  P+      DR +  + ++DFE+S ED+K +
Sbjct: 277 INRVEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELSDEDIKYI 335

>KLTH0A08052g Chr1 complement(685177..686193) [1017 bp, 338 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 338

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 116/296 (39%), Gaps = 65/296 (21%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN----------------ERECATAVAKF---LKE 69
           KE+   I+   +  G R  DTA +Y N                 RE    ++K    + E
Sbjct: 39  KEEIFKILKYCYDNGLRTFDTADIYSNGLSERLIGEFLRNYNINRETVVILSKVNFPVDE 98

Query: 70  SPKVSRDQVFYTTKVAGDNHGYEK--AKKSIIESLEMAKELE----YVDLFLIHNPCAET 123
           S  +S   +F   +V       ++  ++K II+ +  AK +E    Y+D+  IH   +ET
Sbjct: 99  SLDLSVKSIFNVDEVTALTLTNQRGLSRKHIIDGV--AKSVERLGTYIDVLQIHRFDSET 156

Query: 124 EKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELY------SWEGLEVKPMVNQFELNP 177
                T +AL +  ++G  + IG SS       +L        W     K + +Q + N 
Sbjct: 157 TME-ETMRALNDVVESGHARYIGASSMLATEFSDLQFTVERNGW----FKFISSQSQYN- 210

Query: 178 WLTRKD---LVKYCKERDLVIEAFSPITRS-----------KRFSDPVVQKLLK------ 217
            L R+D   L+ Y K   + +  +SP  R            +  SDP  QKL        
Sbjct: 211 LLYREDERELIPYAKRHGIGLIPWSPNARGLLTRPVGVATERSSSDPRFQKLTNAGMEII 270

Query: 218 ---ESYPGRTPAQLLI---RWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMK 267
              E    R    +++    W L  G  P+       R +  + AL F+++ E++K
Sbjct: 271 NRVEEVANRRNVSMVVASNAWVLHKGCHPIVGMSSTARVDEAVQALTFKLTDEEVK 326

>KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 116/301 (38%), Gaps = 61/301 (20%)

Query: 26  ETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV- 84
           E  KEK   I+   + QG R  DTA +Y N    +  + K   +   + R+ V   +KV 
Sbjct: 36  EDDKEKVFKILKHCYDQGLRTFDTADVYSNG--LSEKLLKEFMQKYNIRRETVVIMSKVF 93

Query: 85  --------AGDNHGYEK-------------AKKSIIESLEMAKEL--EYVDLFLIHNPCA 121
                    G   G E              ++K II++ + + E    Y+D+  IH    
Sbjct: 94  FPVDETLDLGLGSGLEDELAQLDLTNQQGLSRKHIIDAAKKSVERLGTYMDVLQIHRFDP 153

Query: 122 ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL------YSW-EGLEVKPMVN--- 171
            T  +  T +AL +  + G  + IG SS     L EL      Y+W + + V+   N   
Sbjct: 154 NTPVK-ETMRALNDVVEMGLTRYIGASSMLGTQLAELQFTADKYNWFQFVNVQSCYNLVY 212

Query: 172 --------------QFELNPW-------LTRKDLVKYCKER-DLVIEAFSPITRSKRFSD 209
                            L PW       LTR   V+  +   D++I A+  +   K +  
Sbjct: 213 REDERETIPFAKKHNLMLTPWSPNHQGLLTRPVGVESTRSSSDIIINAWG-LKNLKPWEV 271

Query: 210 PVVQKLLKESYPGRTP-AQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKT 268
            V+ ++ + +       A +   W +Q G  P+       R + N+ ALD   + E+MK 
Sbjct: 272 TVINRVEEMAKKKNVSMAVIATAWVIQKGCAPILGMSSIARVDDNIKALDVSFTEEEMKY 331

Query: 269 L 269
           L
Sbjct: 332 L 332

>NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 91/210 (43%), Gaps = 45/210 (21%)

Query: 26  ETPKEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKFLKESPKVSRDQVFYTT 82
           E  KEK   I    +  G+R  DTA +Y N   ER     + KF     ++ R+ V   T
Sbjct: 37  EDDKEKIFQIFKHCYDIGFRTFDTADVYSNGKSERLLGEFLRKF-----EIRRETVVILT 91

Query: 83  KV-----------AGDNHGYEK-----------AKKSIIESLE--MAKELEYVDLFLIH- 117
           K             G+    E            ++K I++S++  + +   Y+D+  IH 
Sbjct: 92  KTYFRVDETLDLPLGEFPHSENDVLDLVNQQGLSRKHILDSVKNSVGRLGTYIDVLQIHR 151

Query: 118 -NPCAETEKRLGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMV 170
            +P    ++   T KAL +  + G ++ IG SS        ++ + + Y W   +   + 
Sbjct: 152 FDPTTPIKE---TMKALNDVVENGDVRYIGASSMLPTEFVEMQAIADKYDW--FQFVNVQ 206

Query: 171 NQFELNPWLTRKDLVKYCKERDLVIEAFSP 200
           +Q+ L      +DL+KYCK+ ++ +  +SP
Sbjct: 207 SQYNLLYREDERDLMKYCKKHNIALTPWSP 236

>KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 125/302 (41%), Gaps = 64/302 (21%)

Query: 26  ETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV- 84
           E  KEK  + +   + +G R  DTA  Y N       + +FLK+  K+ R+ V   TK+ 
Sbjct: 13  EEDKEKVFNTLKYCYDKGLRTFDTADYYSNGYS-EILLGEFLKKY-KIKRETVVILTKIF 70

Query: 85  -----AGDNHGYEK---------------AKKSIIESLEMAKEL--EYVDLFLIHNPCAE 122
                  D H  E+               ++K I++ ++ + E    Y+D+  IH    +
Sbjct: 71  FPVDETLDLHLGEEPIGVDQLDVVNQRGLSRKHIVDGVKRSVERLGTYIDVLQIHRFDQD 130

Query: 123 T--EKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL-YSWEGLEVKPMVNQFELNPWL 179
           T  ++R+   KAL +  + G ++ IG SS       E+ +  E  E    VN   L   +
Sbjct: 131 TPIKERM---KALNDVVEKGHVRYIGASSMLATEFAEMQFVAEKYEWFQFVNSQSLYNLI 187

Query: 180 TRKD---LVKYCKERDLVIEAFSP-----ITR------SKRFSDPVVQKLLKESYPGRTP 225
            R+D   L+ +CK  ++ +  +SP     +TR       +  +DP V+  L +    ++ 
Sbjct: 188 YREDERELIPFCKRHNIALTPWSPNHQGLLTRPIGSTTERSENDPFVKCTLTKKLE-KSD 246

Query: 226 AQLLIR------------------WSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMK 267
            +++ R                  W +  G VP+       R +  + AL  + + E++K
Sbjct: 247 IEIINRVEELAKKKKCSMAVISTAWVISKGCVPIVGMSKTSRVDDAIKALKVKFTDEELK 306

Query: 268 TL 269
            L
Sbjct: 307 YL 308

>CAGL0E05236g Chr5 complement(509715..510749) [1035 bp, 344 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 344

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 122/296 (41%), Gaps = 58/296 (19%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKF-LKESPKVSRDQVFYTTKV 84
           KEK   I+  A+ +G R  DTA +Y N   ER       K+ +K    V   +VFY    
Sbjct: 41  KEKIFGILKRAYDRGLRTYDTADMYSNGYSERLLKEFFEKYQIKRETVVIMSKVFYAVDE 100

Query: 85  AGD-NHGYE--------------KAKKSIIESLEMAKEL--EYVDLFLIHNPCAETEKRL 127
             D +HG +               +++ I+E+++ + E    Y+D+  IH    ET  + 
Sbjct: 101 DLDLHHGLDINEVEDLHLTNQRGLSRRHILEAVKNSTERLGTYIDVLQIHRLDKETPMK- 159

Query: 128 GTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMVNQFELNPWLTR 181
              KAL +  +AG  + IG SS        ++ + E ++W   +   + + + L      
Sbjct: 160 EIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNW--FQFVSLQSFYNLLNREDE 217

Query: 182 KDLVKYCKERDLVIEAFSPITR----------SKRF-SDP----------------VVQK 214
           ++++ + K  ++ +  +SP  R          S R  SDP                ++ +
Sbjct: 218 REIIPFAKRHNIALTPWSPNARGLLTRPVSKISVRIKSDPTFKIVGLDKLTEDQKEIINR 277

Query: 215 LLKESYPGRTPAQLLIR-WSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
           + + +    T   ++   W L  G  P+       R +  + ++DFE+  ED+K L
Sbjct: 278 VEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIARVDEAIASIDFELPEEDIKYL 333

>NCAS0D03150 Chr4 complement(592701..593717) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/293 (20%), Positives = 118/293 (40%), Gaps = 55/293 (18%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKF-LKESPKVSRDQVFYTTKV 84
           KE+  +++   + QG R  DTA  Y N   ER     + ++ ++    V   ++F+    
Sbjct: 39  KEEVFALMKFCYDQGIRTFDTADQYSNGLSERLICEFLKRYSIRRETVVIMSKIFFAVDE 98

Query: 85  AGD--------NHGYEK--------AKKSIIESLEMAKEL--EYVDLFLIHNPCAETEKR 126
           A D        + G +         ++K I++ +  + E    Y+D+  IH   AET   
Sbjct: 99  AIDVPQNINLADAGVQLDVINQRGLSRKHIMDGVARSVERLGTYIDVLQIHRFDAETPME 158

Query: 127 LGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMVNQFELNPWLT 180
             T +AL +  + G+++ +G S          + + +L  W   +     +Q+ L     
Sbjct: 159 -ETMRALNDVVELGQVRYLGASRMLGTQFAEYQFVAQLNGWH--QFINWQSQYNLLYRED 215

Query: 181 RKDLVKYCKERDLVIEAFSP------------ITRSKRFSDPVVQKLLKESY-------- 220
            ++++ + K  ++ +  F P            ++   +  DP V+KL             
Sbjct: 216 EREVIPFAKRHNIALTPFYPNAGGLLARPLGQVSARTKSDDPKVKKLTARDKEIINRVEQ 275

Query: 221 ----PGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
                G + AQ+ + W L  G  P+       RA+ ++ AL  ++S +D+  L
Sbjct: 276 LSVEKGVSMAQISLAWLLHKGCYPIVGVNSIQRAQESIDALSLQLSEQDLLFL 328

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 68/312 (21%), Positives = 116/312 (37%), Gaps = 89/312 (28%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKF-LKESPKVSRDQVFYTTKV 84
           KE+   I+   +  G R  DTA +Y N   ER     + +F +K    V   ++F+    
Sbjct: 39  KEEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIFFPVDE 98

Query: 85  AGDNHGYEKAKKSIIESLEMAKELEYVDLFL----------IHNPCAETEKRLGTY---- 130
           + D H   K  +            EY+DL L          I    A + +RLGTY    
Sbjct: 99  SLDLHQGSKVDQ------------EYIDLQLSFQQGLNRKHIMAGVANSVERLGTYIDIL 146

Query: 131 ---------------KALQEFYKAGKIKAIGVSSYSIKHLEELY------SW-EGLEVKP 168
                          ++L +   +G+++ IG SS       EL        W + + V+ 
Sbjct: 147 QIHRLDKEASMEEIMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQS 206

Query: 169 MVNQFELNPWLTRKD---LVKYCKERDLVIEAFSPITR-----------SKRFSDPVVQK 214
             N       L R+D   L+ +CK+  + +  +SP  R           ++  SDP   K
Sbjct: 207 YYNV------LNREDENELIPFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIK 260

Query: 215 L----LKES-------------YPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHAL 257
           +    L ES               G + A + + W L  G   +      +R +  + A+
Sbjct: 261 MGLDKLDESDKEIIGVVEAIAKKKGISMAMVSMAWILNKGANAIAGLNSIERVDEAIRAI 320

Query: 258 DFEISAEDMKTL 269
           D + + E+++ L
Sbjct: 321 DVKFTVEELELL 332

>CAGL0E05192g Chr5 complement(506831..507868) [1038 bp, 345 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 345

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 115/296 (38%), Gaps = 58/296 (19%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKF-LKESPKVSRDQVFYTTK- 83
           KEK   I+  A+ +G R  DTA +Y N   ER       K+ +K    V   +VF+    
Sbjct: 42  KEKIFGILKHAYDRGLRTYDTADVYSNGYSERLLKEFFEKYQIKRETVVIMTKVFFGVDE 101

Query: 84  ----------------VAGDNHGYEKAKKSIIESLEMAKEL--EYVDLFLIHNPCAETEK 125
                           V  +  G   ++K I+E ++ + E    Y+D+  IH    ET  
Sbjct: 102 DLNLQPGVKIDEQEDLVLTNQRGL--SRKHILEGVKNSTERLGTYIDVLQIHRLDKETPM 159

Query: 126 RLGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL-YSWEGLEVKPMVNQFELNPWLTRKD- 183
           +    KAL +  +AG  + IG SS       EL +  E       V+   L   L R+D 
Sbjct: 160 K-EIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNWFQFVSLQSLYNLLIREDE 218

Query: 184 --LVKYCKERDLVIEAFSPITRS-----------KRFSDPVVQKL--------------- 215
             ++ + K  ++ +  +SP  R            +  SDP  + L               
Sbjct: 219 REIIPFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLELDKLTEDQKEIINR 278

Query: 216 LKESYPGRTPAQLLI--RWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
           ++E       +  +I   W L  G  P+      DR +  + ++DFE+  ED+K L
Sbjct: 279 VEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELPEEDIKYL 334

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/302 (20%), Positives = 118/302 (39%), Gaps = 70/302 (23%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV---A 85
           KE+   I+  A+ +G R  DTA +Y N     T + +FL+ +  + R+ V   TKV    
Sbjct: 39  KEEIFGILKHAYDRGLRTYDTADVYSNGMS-ETILGEFLR-TYNIPRETVVIMTKVFFPV 96

Query: 86  GDNHGYEKAK-KSIIESLEMAKELEYVDLFLIHNPCAETEKRLGTY-------------- 130
            D       + K+  E+L++  + +++    I N    + KRLGTY              
Sbjct: 97  DDKMDISSNRTKTEEENLQLINQ-QHLSRKHILNAVKNSVKRLGTYIDVYQIHRCDHETP 155

Query: 131 -----KALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMVNQFELNPWL 179
                +AL +  + G ++ +G SS        ++ + E + W        VN       +
Sbjct: 156 FEETMRALNDVVEQGDVRYLGASSMLAVEFAEMQFIAEKHGWHKF-----VNMQSCYNLV 210

Query: 180 TRKD---LVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLL------- 229
            R+D   ++ +CK   + +  +SPI +    + P+     +ES  G   A+ L       
Sbjct: 211 YREDEREMIPFCKRHGIALTPWSPIQKG-LLARPLGSHTHRESTDGVLIARKLNQFTESE 269

Query: 230 ----------------------IRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMK 267
                                 + W +Q G +P+      +R +  +  L  +++ +DM 
Sbjct: 270 KEIINRVEKLAIKKNLKMVDISLGWVIQKGTLPILGMSSIERVDEAIKTLTTKLTEDDMY 329

Query: 268 TL 269
            L
Sbjct: 330 YL 331

>KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 120/302 (39%), Gaps = 64/302 (21%)

Query: 26  ETPKEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKF-LKESPKVSRDQVFY- 80
           E  K     I+   + +G R  DTA  Y N   E+     + K+ +K    V   ++F+ 
Sbjct: 37  EDDKNTIFGILKYCYDKGLRTFDTADYYSNGLSEKLLGEFLVKYNIKRETVVIMTKIFFP 96

Query: 81  ---TTKVAGDNHGYEK-----------AKKSIIESLE--MAKELEYVDLFLIHNPCAETE 124
              T  +  +    E            ++K I++ +E  +A+   Y+D+  IH    ET 
Sbjct: 97  FDETLNLKSNTPLSELQELDVVNQRGLSRKHILDGVEKAIARLGTYIDVLQIHRFDPETP 156

Query: 125 KRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL------YSWEGLEVKPMVNQFELNPW 178
            +  T KAL +  ++G ++ IG SS       E+      Y+W        VN   +   
Sbjct: 157 IK-ETMKALNDVIESGHVRYIGASSMLATQFAEMQFIADKYNW-----FQFVNAQSMYNL 210

Query: 179 LTRKD---LVKYCKERDLVIEAFSP-----ITR----------SKRF-----------SD 209
           + R+D   L+ +CK  ++ +  +SP     +TR          S RF           SD
Sbjct: 211 VYREDERELIPFCKRHNIALTPWSPNHRGFLTRPIGTKSLRSESDRFTINKLRDNVLESD 270

Query: 210 PVVQKLLKE--SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMK 267
             + K ++E     G + A +   W +  G  P+      +R +  + AL    + E++K
Sbjct: 271 IKIVKRVEELAEKKGVSMAAISTAWVVSKGCQPIIGLSKTERVDDAISALSVTFTDEELK 330

Query: 268 TL 269
            L
Sbjct: 331 YL 332

>NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/339 (21%), Positives = 135/339 (39%), Gaps = 76/339 (22%)

Query: 1   MSITASTTKTLTNGVKIP--VLGFGTY---------ETPKEKAESIVHAAFKQGYRHVDT 49
           MS      K    G+KI   ++G  +Y         +  KEK   I+   + +G R  DT
Sbjct: 1   MSKLVQQVKFDNTGIKISPIIVGCMSYGSKQWAEWVQDDKEKVFEILKHCYDRGLRTFDT 60

Query: 50  AQLYEN---ERECATAVAKF-LKESPKVSRDQVFY----TTKVAGDNHGYEK-------- 93
           A +Y N   ER     + KF +K    V   + F+    +  +A     + +        
Sbjct: 61  ADVYSNGISERLLGEFLKKFNIKRETVVILTKTFFPVDESLSLALGEMSFSESDTLDLTN 120

Query: 94  ----AKKSIIESLEMAKEL--EYVDLFLIH--NPCAETEKRLGTYKALQEFYKAGKIKAI 145
               ++K I++S++ + E    Y+D+  IH  +P    ++   T KAL +  ++G ++ I
Sbjct: 121 QRGLSRKHILQSVKNSVERLGTYIDVLQIHRFDPTTPIKE---TMKALNDVVESGDVRYI 177

Query: 146 GVSSYSIKHLEELYS-------WEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAF 198
           G SS       E+ S       ++ + V+   N          +DL++YC++ ++ +  +
Sbjct: 178 GASSMLPTQFVEMQSVADKHDWFQFVNVQSCYNLLYRED---ERDLMQYCEKHNIALTPW 234

Query: 199 SP-----ITR------SKRFSDPVVQKL-LKESYPGR----------------TPAQLLI 230
           SP     +TR       +  +D ++    +K+  P                  + A +  
Sbjct: 235 SPNHQGLLTRPIGVESERSTTDKIINGWNMKDLKPSEIEIINRVEELSKKKNVSMAVIST 294

Query: 231 RWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
            W L  G  P+       R +  + ALD + + E+ K L
Sbjct: 295 AWVLSKGCAPIVGMSSISRVDEVITALDVKFTEEETKQL 333

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 59/134 (44%), Gaps = 11/134 (8%)

Query: 35  IVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE-SPKVSRDQVFYTTKVAG---DNHG 90
           I+  AF+ G   +DT+  Y N       + K L     K  RD     TKV     D+  
Sbjct: 29  ILRVAFENGINCIDTSPYYGNSE---ILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFD 85

Query: 91  Y--EKAKKSIIESLEMAKELEYVDLFLIHN-PCAETEKRLGTYKALQEFYKAGKIKAIGV 147
           Y  +  ++S++ S +     +Y+DL  +H+      +  L   + L++    G IK  G+
Sbjct: 86  YSADNVRRSVVRSCKRLNS-DYLDLVYLHDVEFVNMKDSLVALRELKKLKNEGIIKRFGI 144

Query: 148 SSYSIKHLEELYSW 161
           S Y + +L  L S+
Sbjct: 145 SGYPVDYLFHLSSY 158

>KNAG0A07840 Chr1 complement(1245869..1246930) [1062 bp, 353 aa]
           {ON} 
          Length = 353

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 97/219 (44%), Gaps = 19/219 (8%)

Query: 2   SITASTTKTLTNGVKIPVLGFGTYETPKEKA-----ESIVHAAFKQGYRHVDTAQLYENE 56
           SI A  +K  T G  +  L +     P+EKA     + + +A   +     +  + Y  +
Sbjct: 13  SIKAELSKVST-GYGLMSLTWRPTPAPQEKAFAAMKKVVEYATASKCKAFFNVGEFYGPD 71

Query: 57  RECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGY-EKAK-KSIIESLEMAKEL--EYVD 112
           R   T V  F K++P + R+ V  + K A D H +  K K + +++S+  + E    Y+D
Sbjct: 72  RMNLTYVRDFFKQNPTL-REHVIISCKGALDVHTFLSKGKYQDVLDSVSNSVEAIGGYID 130

Query: 113 LFLIHN------PCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEV 166
           +F +        P  E   +  +++AL +    GKI  I +S  +  H+  +    G  +
Sbjct: 131 IFEVARLDNGIVPAGEVYPK-ESFEALAKMVDEGKIGGISLSEVNEGHIRAIAKDFGPYL 189

Query: 167 KPMVNQFELNPWLTRKDLV-KYCKERDLVIEAFSPITRS 204
             +  +  L      KD V K C + +L+I  +SP+ R 
Sbjct: 190 TCVEVELSLFSTHILKDGVAKACSDLELIIICYSPLGRG 228

>ZYRO0D02816g Chr4 (221712..222743) [1032 bp, 343 aa] {ON} similar
           to uniprot|Q02895 Saccharomyces cerevisiae YPL088W
           Putative aryl alcohol dehydrogenase transcription is
           activated by paralogous transcription factors Yrm1p and
           Yrr1p along with genes involved in multidrug resistance
          Length = 343

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 120/304 (39%), Gaps = 74/304 (24%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV---- 84
           K++  SI+   + +G R  DTA +Y N       V +FL+    ++R+ V   TKV    
Sbjct: 40  KQRIFSILKHCYDRGLRTFDTADVYSNGMS-ERLVGEFLRHY-NINRETVVILTKVYFPV 97

Query: 85  -----------AGDNHGYEKA------KKSIIESLEMAKEL--EYVDLFLIHNPCAETEK 125
                      A  ++G   A      +K II  ++ + E    Y+D+  +H    +T  
Sbjct: 98  DESIQLTHSNIASTDNGLTLANQRGLSRKHIIAGVKGSVERLGTYIDVLQLHRLDHDTPM 157

Query: 126 RLGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMVNQFELNPWL 179
                +AL +    G  + IG SS        ++ + E + W    VK + +Q   N  L
Sbjct: 158 E-EIMRALNDVVTQGDARYIGASSMLATEFAELQFIAEKHDW----VKFVSSQSCYN-LL 211

Query: 180 TRKD---LVKYCKERDLVIEAFSPITRSKRFSDPV------------------------- 211
            R+D   L  +    ++ +  +SP+ R    S P+                         
Sbjct: 212 YREDERELYPFAHRHNIALIPWSPLARGA-LSRPLGANTQRGSTDKGFQRFGFAELEAHE 270

Query: 212 ------VQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAED 265
                 V+K+ K+   G + A L   W L  G  P+     E+R +  L ALD +++ E+
Sbjct: 271 QEIVKRVEKVAKDK--GISMATLGTAWVLSKGCYPIGGFSSEERVDEALKALDVKLTDEE 328

Query: 266 MKTL 269
           +K L
Sbjct: 329 IKYL 332

>Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 117/299 (39%), Gaps = 64/299 (21%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKFLKESPKVSRDQVFYTTKV- 84
           KEK   I+   +  G R  DTA +Y N   ER     + +FLK   K+ R+ V   TKV 
Sbjct: 41  KEKIFEILKHCYDSGMRTFDTADVYSNGLSER----ILGEFLKHY-KIKRETVVILTKVY 95

Query: 85  ----------------AGDNHGYEK----AKKSIIESLEMAKEL--EYVDLFLIHNPCAE 122
                             D  G       ++K I+E+ + + E    Y+D+  IH    +
Sbjct: 96  YPVDESLKLTHSAKISESDMLGLVNQTGLSRKHILEAAKNSVERLGTYIDVLQIHRLDHD 155

Query: 123 TEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL-YSWEGLEVKPMVNQFELNPWLTR 181
           T       KAL +    G  + IG SS       EL +  E  +    +        L R
Sbjct: 156 TPME-EIMKALNDVVGLGYTRYIGASSMLATEFAELQFIAEKHDWTKFICSQSCYSLLYR 214

Query: 182 KD---LVKYCKERDLVIEAFSPITRS-----------KRFSDPVVQKL---LKESYPGR- 223
           +D   L+ + K+  + +  +SP  R            ++ SDP +++L     ES+  R 
Sbjct: 215 EDERELIPFAKKHGIGLIPWSPNARGVLTRPLNQETDRKISDPTLKRLKFDCLESHEKRI 274

Query: 224 -------------TPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
                        + A + I W L  G  P+      +R +  + A+D +++ E+++ L
Sbjct: 275 VNRVEEVAKKKGISMAMVSIAWVLSKGACPIVGLNSIERVDEAIRAVDVQLTEEEIQYL 333

>TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON} 
          Length = 345

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 68/318 (21%), Positives = 128/318 (40%), Gaps = 66/318 (20%)

Query: 15  VKIPVLGFGTYE------TPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLK 68
           + I  + FG  E      + KE+   ++   + +G R  DTA  Y N       + +FLK
Sbjct: 19  IIIGCMTFGKKEWSDWIVSDKEEVFRLLKYCYDKGLRTYDTANTYSNG-VSEQLLGEFLK 77

Query: 69  ESPKVSRDQVFYTTKV---AGDN-------HGYEK-------------AKKSIIESLEMA 105
               + R+ V   +K+   A D+       +G++               ++++IES + +
Sbjct: 78  RY-NIRRETVVIMSKLFFPADDSLPDFQLTNGFKDEEEKLHLINQFGLNRRNVIESAKQS 136

Query: 106 KEL--EYVDLFLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL-YSWE 162
            E    Y+D+  IH  C        T +AL +   AG  K IG S        E+ +  E
Sbjct: 137 VERLGTYMDVLQIHR-CDRETPFEETMRALNDVVNAGYTKYIGASLMRATEFAEMQFIAE 195

Query: 163 GLEVKPMVNQFELNPWLTRKD---LVKYCKERDLVIEAFSPITR---------------- 203
             +    VN   L+  + R+D   L+ + K+  + +  +SP+ +                
Sbjct: 196 KHDWHKFVNVQSLHNLIYREDERELIPFTKKHGIALTPYSPLQKGYLAKPYGTKTVRNTT 255

Query: 204 ----------SKRFSDP-VVQKLLKESYPGRTP-AQLLIRWSLQMGFVPLPKSVHEDRAE 251
                     + R SD  ++ ++ K S   +   A++ + W +Q G  P+      +R +
Sbjct: 256 DKHMLRIKIDNMRDSDKEIISRVEKVSKDKKVSMAEVSLAWLIQQGCNPIVGVSSTERVD 315

Query: 252 SNLHALDFEISAEDMKTL 269
             + ALD +++ E+ K L
Sbjct: 316 EAIRALDVKLTEEETKFL 333

>NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 123/302 (40%), Gaps = 69/302 (22%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKFLKESPKVSRDQVFYTTKV- 84
           KEK  +I+   + +G R  DTA +Y N   ER     + +FLK+   + R+ V   TK+ 
Sbjct: 40  KEKVFTILKHCYDRGLRTFDTADVYSNGYSER----LLGEFLKKY-NIRRETVVILTKLF 94

Query: 85  ----------AGDNHGYEK-----------AKKSIIESLEMAKEL--EYVDLFLIHNPCA 121
                       D    E            ++K I+++++ + E    Y+D+  IH    
Sbjct: 95  APVDESLKFKFADPSTSENILLDLTNQQGLSRKHIMQAVKNSVERLGTYIDVLQIHRFDP 154

Query: 122 ETEKRLGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMVNQFEL 175
            T  +  T K L +  + G ++ IG SS        ++ + + + W   +   + + + L
Sbjct: 155 NTPIK-ETMKGLNDVIEGGDVRYIGASSMLPTQFVEMQGIADKHDW--FQFVNVQSCYNL 211

Query: 176 NPWLTRKDLVKYCKERDLVIEAFSP-----ITR-----SKRFS-------------DP-- 210
                 +DL +YCK+ ++ +  +SP     +TR     S R S             DP  
Sbjct: 212 VYREDERDLFQYCKKHNIALTPWSPNHQGLLTRPVGVESTRSSKDTFINATKMKEMDPAE 271

Query: 211 --VVQKLLKESYPGRTPAQLL-IRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMK 267
             ++ ++ + S     P  +L   W L     P+      +R +  + ALD   + E++K
Sbjct: 272 VEIINRIEELSKKKNVPMAVLSTAWVLSKQCSPIVGMSSINRVDEAITALDVTFTEEEIK 331

Query: 268 TL 269
            L
Sbjct: 332 YL 333

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 10/110 (9%)

Query: 108 LEYVDLFLIHNPCAETEKRLGTYKA---LQEFYKAGKIKAIGVSSYSIKHLEELYSWEGL 164
           +EYVD+  +H+P    +  +   K         ++ K    G SS +++ L  +   E  
Sbjct: 65  VEYVDMHFLHSPFVFKQANVLNLKDAMHTDHLRRSNKANNRGASSVNVEELRRVLKTEDE 124

Query: 165 EVKPMVNQFELNPWLTRKD--LVKYCKERDLVIEAFS---PITRSKRFSD 209
           E  P VNQ +L   L  +   + K C+E D+++  +S   P+ R    +D
Sbjct: 125 E--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTLDPLQRKNARND 172

>NDAI0D00600 Chr4 (131820..132803) [984 bp, 327 aa] {ON} 
          Length = 327

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 93/213 (43%), Gaps = 42/213 (19%)

Query: 20  LGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVF 79
           LG    +  ++K   I+   +  G+R  DTA +Y N  E    + +FLKE      +  +
Sbjct: 24  LGLNGLKMTRKKFFQILKHCYDIGFRTFDTADVYSNG-ESERLLGEFLKEFNIKKGNSGY 82

Query: 80  YTTKV-------------------AG-----DNHGYEKAKKSIIESLEMAKEL--EYVDL 113
             TK                    +G     +  G   ++K I+++++ + E    Y+D+
Sbjct: 83  LLTKTYFPMDETLVLAMVEAPQSESGVLDLVNQQGL--SRKHILQAVKNSVERLGTYIDV 140

Query: 114 FLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVK 167
             IH   + T  + GT KAL +  + G ++ IG SS        ++ + + Y W   +  
Sbjct: 141 LQIHRFDSTTPIK-GTMKALNDVVENGDVRYIGASSMLPTQFVEMQAVADKYDW--FQFV 197

Query: 168 PMVNQFELNPWLTRKDLVKYCKERDLVIEAFSP 200
            + +Q+ L   L RKD  + CK+ ++ +  +SP
Sbjct: 198 NVQSQYNL---LYRKD-ERDCKKHNIALTPWSP 226

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 85/198 (42%), Gaps = 25/198 (12%)

Query: 17  IPVLGFGTYET---PKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKV 73
           +P + +G Y     PK++   +     + G    DTA++Y    +    +          
Sbjct: 4   LPKIVYGAYPITALPKDEFSKLYSLLRENGVTEWDTARIYPGSEKSIGDLG--------- 54

Query: 74  SRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKE---LEYVDLFLIH--NPCAETEKRLG 128
             D +   TK      G    +  I ES++ + +   ++ V+++ +H  +P    E+   
Sbjct: 55  IADDLVIDTKARSFEEG-ALTRDGIFESIKQSFDELKVDSVEIYYLHAPDPITPIEE--- 110

Query: 129 TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLE--VKPMVNQFELNPW--LTRKDL 184
           T  A+ E YK GK K  G+S+Y+   ++++Y +   +  V P V Q   N +     KDL
Sbjct: 111 TIDAINELYKQGKFKKFGLSNYTPDDVKKIYEYAKSKNYVLPTVFQGNYNAFSRSIEKDL 170

Query: 185 VKYCKERDLVIEAFSPIT 202
               ++  +   A+SPI 
Sbjct: 171 FPVLRKYGISFYAYSPIA 188

>NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565
          Length = 343

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 118/313 (37%), Gaps = 91/313 (29%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKFLKESPKVSRDQVFYTTKV- 84
           K++   I+   + +G R  DTA +Y N   ER     V +FLK+   + R+ V   TK+ 
Sbjct: 39  KDEIFKILKHCYDRGLRTFDTADVYSNGISER----LVGEFLKKY-NIKRETVVIMTKIF 93

Query: 85  ----------AGDNHGYEK-----------AKKSIIESLEMAKEL--EYVDLFLIHNPCA 121
                      G N   E            ++K II+ +  + E    Y+D+  IH    
Sbjct: 94  FPVDESLDLHHGSNVNQEAMELQLTLQRGLSRKHIIDGVANSVERLGTYIDVLQIHRLDE 153

Query: 122 ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQF--ELNPW- 178
           ET       ++L +   +G+++ IG SS       EL             QF  E N W 
Sbjct: 154 ETSME-EIMRSLNDVVMSGQVRYIGASSMLATEFAEL-------------QFIAEKNGWF 199

Query: 179 -----------LTRKD---LVKYCKERDLVIEAFSPITRS-----------KRFSDPVVQ 213
                      + R+D   L+ +CK+  + +  +SP  R            +  +DP   
Sbjct: 200 KFISAQSYYNLINREDERELIPFCKKHGVGLIPWSPNARGVLTRPVEKNTERMLTDPTFN 259

Query: 214 KL-----------------LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHA 256
           ++                 +       T A + + W+L  G  P+      +R +  + A
Sbjct: 260 RMRLNELGDDEKEIVRRIQMVAERRSVTMAIISMAWTLHKGCNPIVGLNSVERVDEAVKA 319

Query: 257 LDFEISAEDMKTL 269
           ++F ++ +++K L
Sbjct: 320 IEFTLTEDEIKLL 332

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 11/127 (8%)

Query: 41  KQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGD-----NHGYEKAK 95
           ++ +  VDT+  Y +       V + L+E  ++ R +++  TKV        ++  E  +
Sbjct: 38  RRCFNAVDTSPYYGDSE---LLVGQALREL-QIPRGEIYVCTKVGRVGVSEFDYSRENVR 93

Query: 96  KSIIESLE-MAKELEYVDLFLIHN-PCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIK 153
            S++ S+E +  E  Y+D+  +H+      E  L     LQ+  +AG ++ +GVS Y + 
Sbjct: 94  MSVMRSVERLVGEGGYLDVVYLHDVEFQPQEACLAALDELQKLKRAGIVRNVGVSGYPLS 153

Query: 154 HLEELYS 160
            L  L S
Sbjct: 154 KLYSLVS 160

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 80/191 (41%), Gaps = 48/191 (25%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDN 88
           KE+A  ++ A ++ G   VDTA  Y+NE +  T + +++K   +  RDQ+   TK  GD 
Sbjct: 52  KEQAFELLDAFYEAGGNCVDTANSYQNE-QSETWIGEWMK--LRKVRDQIVICTKYTGDY 108

Query: 89  HGYEKAKK---------------SIIESLEMAKELEYVDLFLIH--NPCAETEKRLGTYK 131
             YE                   S+ +SL    + +++D+  IH  +  +  E+ +    
Sbjct: 109 KKYEAGDGKSANYCGNHRRSLHVSVRDSLRKL-QTDWIDILYIHWWDYMSSIEEVM---D 164

Query: 132 ALQEFYKAGKIKAIGVSS-----------YSIKHLEELYS-----WEGL------EVKPM 169
           +L    + GK+  +GVS            Y+  H +  +S     W  L      E+ PM
Sbjct: 165 SLHILVQQGKVLYLGVSDTPAWIVSAANYYATSHGKTPFSVYQGKWNVLNRDFEREIIPM 224

Query: 170 VNQF--ELNPW 178
              F   L PW
Sbjct: 225 ARHFGMALAPW 235

>Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C -
           Hypothetical ORF [contig 59] FULL
          Length = 338

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 57/123 (46%), Gaps = 9/123 (7%)

Query: 39  AFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAG---DNHGY--EK 93
           A + G R +DT+  Y +  +      + LK+  ++ R+  F  TKV     D   Y  E 
Sbjct: 52  AVQHGIRAIDTSPYYGDSEKLFGKALESLKD--EIPRENYFICTKVGRIRLDEFDYSREH 109

Query: 94  AKKSIIESLEMAKELEYVDLFLIHN-PCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSI 152
            + S++ S E  +  +Y+D+  +H+    ET + L   K L++    G +   G+S Y +
Sbjct: 110 VRSSVLRSCERLRT-DYLDVVFLHDVEFVETAQVLEALKELRKLKDEGVLHNFGISGYPV 168

Query: 153 KHL 155
             L
Sbjct: 169 DFL 171

>AAR033W Chr1 (401423..402448) [1026 bp, 341 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR127W
          Length = 341

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 100/275 (36%), Gaps = 53/275 (19%)

Query: 38  AAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKS 97
           +  KQG    +  + Y  +      V  F +  P  +R++V    K A DN   +     
Sbjct: 45  SCCKQGKILFNCGEFYGGDFLNLHYVRDFFRLHP--ARERVILCVKGAVDNATLQPVGDP 102

Query: 98  IIESLEMAKELE----YVDLFLI--HNPCAETEKRL---GTYKALQEFYKAGKIKAIGVS 148
           +     M   L     Y+D+F     +P A     L    + +A+ E+ KAGKI AIG+S
Sbjct: 103 VSVRKSMDNCLREIGGYIDIFECARFDPKAVAPGELYPRASIEAVVEYVKAGKIGAIGLS 162

Query: 149 SYSIKHLEELYSWEGLEVKPMVNQFE-LNPWLTRKDLVKYCKERDLVIEAFSPITRSKRF 207
             + + +  +    G  +  +  +F  L+  +    L + C E  + I  +SP+ R    
Sbjct: 163 EVTAEQVRAISRDYGEYLACVEVEFSMLSRDILHNGLAQTCAELGIPILCYSPLARG--- 219

Query: 208 SDPVVQKLLKE--SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAED 265
                  LL    S P   PA  L R   + G          D   +NL A  F +    
Sbjct: 220 -------LLTNAISTPDDVPAGDLRRLLARFG---------HDALANNLQAATF-LQEHI 262

Query: 266 MKTL-------------------THDGEHFLAQPG 281
           +K                     TH G HFL  PG
Sbjct: 263 IKPRAPPPPLPAVALAWIRSWSGTHKGTHFLPIPG 297

>KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 66/324 (20%), Positives = 131/324 (40%), Gaps = 71/324 (21%)

Query: 12  TNGVKI-PV----LGFGT------YETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60
             G+KI P+    + FG+       E  +E+A  I+   +  G R  DTA +Y N  E  
Sbjct: 11  NTGIKISPIVVGCMSFGSKRWQAWIEDDREEAFKILKYCYDHGLRTFDTADVYSNG-ESE 69

Query: 61  TAVAKFLKESPKVSRDQVFYTTKV-------AGDNHGYEKAKKSIIESLEMAKELEYVDL 113
             + +FLK    + R+ V   TKV         +  G++    S    L++  +      
Sbjct: 70  KFLGEFLKRY-NIRRETVVILTKVYFPVDDELPEFGGFKDLAASEQMQLDVTNQRGLSRK 128

Query: 114 FLIHNPCAETEKRLGTY-------------------KALQEFYKAGKIKAIGVSSY---- 150
            ++    A++ +RLGTY                   ++L +   +G ++ IG S+     
Sbjct: 129 HILAG-VAKSVERLGTYIDVLQLHRLDHGLPMKEIMRSLNDVVMSGNVRYIGASTMLATE 187

Query: 151 --SIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR----- 203
              ++++ E Y+W   +     +Q+ L      ++++ + K+ ++ +  +SP  R     
Sbjct: 188 FVEMQYIAEKYNW--FQFVSWQSQYNLLYREDEREVIPFAKKHNIALIPWSPNARGILTR 245

Query: 204 -----SKRFS-DPVVQKLLKESYP------------GRTPAQLLIRWSLQMGFVPLPKSV 245
                S R S DP +Q L ++               G + A +   W L  G  P+    
Sbjct: 246 PNGVDSDRSSIDPRLQNLPEQDKQIIDRVEKVARDRGVSMAMVSTAWVLSKGCSPIVGLN 305

Query: 246 HEDRAESNLHALDFEISAEDMKTL 269
             +R +  + A++ +++  ++K L
Sbjct: 306 SIERVQEAIEAVNLKLNEAEIKFL 329

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 70/330 (21%), Positives = 122/330 (36%), Gaps = 82/330 (24%)

Query: 14  GVKIPVLGFGTYETPKEK-----------AESIVHAAFKQGYRHVDTAQLYENERECATA 62
           G+KI    FGT     +K           A  I+  A+ +G R  DTA  Y N     T 
Sbjct: 13  GLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGL-SETI 71

Query: 63  VAKFLKESPKVSRDQVFYTTKVA----------------GDNHGYEK--------AKKSI 98
           +  FLK    + R+ V   TKV                 G+N             ++K I
Sbjct: 72  LGSFLKHY-NIPRETVVIMTKVFYRVDDTIELNPTDLLFGNNEELNLRLVNQKGLSRKHI 130

Query: 99  IESLE--MAKELEYVDLFLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSY------ 150
           +E+ +  + +   Y+D++ IH  C        T +AL +  + G  + IG SS       
Sbjct: 131 LEAAKNSVRRLGTYIDVYQIHR-CDHETPFEETMRALNDVVEQGYARYIGASSMLGTEFA 189

Query: 151 SIKHLEELYSWEGLEVKPMVNQFELNPWLTRKD---LVKYCKERDLVIEAFSPITRS--- 204
             + + E + W        VN       L R+D   ++ +CK+ ++ I  +SP+      
Sbjct: 190 EYQFIAEKHGWHKF-----VNMQTCYNLLYREDEREMLPFCKKNNVAITPWSPLQMGFLA 244

Query: 205 --------KRFSDPVVQKLLKESYP-----------------GRTPAQLLIRWSLQMGFV 239
                   ++ +D V++ +  + +                      A + + W  +    
Sbjct: 245 RPITEKSVRQTTDLVIKAMSLDKFSEADKEIIDRVNKLANKKNLKMATVTLAWLFKKNAF 304

Query: 240 PLPKSVHEDRAESNLHALDFEISAEDMKTL 269
           P+     E R +  L AL  E++ E++K L
Sbjct: 305 PIVGLNKESRIDDALEALKVELTEEEVKYL 334

>SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 342

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 112/296 (37%), Gaps = 70/296 (23%)

Query: 35  IVHAAFKQGYRHVDTAQLYEN---ERECATAVAKFLKESPKVSRDQVFYTTKV------- 84
           ++   +  G R  DTA  Y N   ER     V KFLK    ++R+ V   TKV       
Sbjct: 45  VLKHCYDNGLRTFDTADFYSNGLSER----LVGKFLKRY-NINRETVVILTKVFFPVDET 99

Query: 85  --AGDNHGYEKA------------KKSIIESLEMAKELE----YVDLFLIHNPCAETEKR 126
                + G ++A            +K I++   +AK +E    Y+D+  IH    ET   
Sbjct: 100 LDLSHSKGMDEATQLTVANQRGLSRKHILDG--VAKSVERLGTYIDVLQIHRFDTETPVN 157

Query: 127 LGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL-YSWEGLEVKPMVNQFELNPWLTRKD-- 183
             T KAL +    G  + IG SS       EL +  E  +    ++       L R+D  
Sbjct: 158 -ETMKALNDVVSKGYARYIGASSMLATQFAELQFVAEKHDWFKFISSQSCYNLLYREDER 216

Query: 184 -LVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYP--------------------- 221
            L+ + K  ++ +  +SP  R    + P+  + L+ S                       
Sbjct: 217 ELIPFAKRHNIGLIPWSPNARGV-LTRPLGTQTLRHSTDFGLKRISAFDLQPHEEEIVRR 275

Query: 222 --------GRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
                   G T A + I W L  G  P+      +R +  + A++F+++ E+   L
Sbjct: 276 VGEIAEKRGVTMAVVSIAWVLSKGCYPIVGLSSTERVDETIKAVEFKLTEEEATYL 331

>ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR041C
          Length = 359

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 63/143 (44%), Gaps = 18/143 (12%)

Query: 25  YETPKEKAESIVHAAFKQGYRHVDTAQLYENEREC-ATAVAKFLKESPKVSRDQVFYTTK 83
           YE P      +V  A + G   +DT+  Y    E    A+A    E P   R+  F  TK
Sbjct: 52  YEVP---TLGLVRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEHP---RETYFICTK 105

Query: 84  VAGD-----NHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAETEKRLGTYKALQEFYK 138
           V  +     ++     + S+  S       EY+DL  +H+   E  +  G ++ALQE  +
Sbjct: 106 VGREGPSDFDYSAAHVRASVHRSCARLHT-EYLDLVYLHD--IEFVEAAGIWEALQELRR 162

Query: 139 A---GKIKAIGVSSYSIKHLEEL 158
               G I+  G+S Y ++ L+E+
Sbjct: 163 LKDEGVIRFFGISGYPVELLQEV 185

>Suva_16.224 Chr16 (392092..393120) [1029 bp, 342 aa] {ON} YPL088W
           (REAL)
          Length = 342

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 75/332 (22%), Positives = 126/332 (37%), Gaps = 87/332 (26%)

Query: 13  NGVKIP--VLGFGTYETPK-------EKAE--SIVHAAFKQGYRHVDTAQLYENERECAT 61
           +G+KI   V+G  +Y + K       +KA+   I+   +  G R  DTA  Y N    + 
Sbjct: 12  SGLKISPIVIGCMSYGSKKWADWVIEDKAQIFKILKHCYDNGLRTFDTADFYSNG--LSE 69

Query: 62  AVAKFLKESPKVSRDQVFYTTKV-----------------------AGDNHGYEKAKKSI 98
            + K   +   + R+ V   TK+                         +  G   ++K I
Sbjct: 70  RIIKEFLDHYSIKRETVVIMTKIFLPIDETLDLRHKFTLGEAEELDLTNQRGL--SRKHI 127

Query: 99  IESLEMAKEL--EYVDLFLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLE 156
           I  ++ + E    Y+DL  IH    +T  +    +AL +  +AG ++ IG SS       
Sbjct: 128 IAGVKNSVERLGTYIDLLQIHRLDHDTPMK-EIMRALNDVVEAGDVRYIGASSMLATEFA 186

Query: 157 EL------YSWEGLEVKPMVNQFELNPWLTRKD---LVKYCKERDLVIEAFSPITRS--- 204
           EL      Y W     + + +Q   N  L R+D   L+ + K  ++ +  +SP  R    
Sbjct: 187 ELQFIADKYGW----FQFISSQSYYN-LLNREDERELIPFAKRHNIGLLPWSPNARGVLT 241

Query: 205 --------KRFSDPV-------------------VQKLLKESYPGRTPAQLLIRWSLQMG 237
                   ++ SDP                    V+K+ KE     + A + I W L  G
Sbjct: 242 RPLDKTTDRQKSDPTFKSLKLDALEDDQMEIVNRVEKISKEK--NVSMAMISIAWVLHKG 299

Query: 238 FVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
             P+       R +  + AL   ++ ED+K L
Sbjct: 300 CHPIVGLNSTSRVDEAIAALQLTLTEEDVKYL 331

>KNAG0L01560 Chr12 (276747..277769) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 62/300 (20%), Positives = 120/300 (40%), Gaps = 70/300 (23%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKFLKESPKVSRDQVFYTTKV- 84
           +EK   I+   +  G R  DTA +Y N   ER     + KFLK+   ++R+ V   TKV 
Sbjct: 39  EEKVFEILKYCYDHGVRTFDTANVYSNGVSER----LLGKFLKKY-NINRETVVILTKVY 93

Query: 85  ------------AGDNHGYEK---------AKKSIIESLEMAKEL--EYVDLFLIH---N 118
                        G+N              ++K+I+ S++ + E    Y+D+  IH   +
Sbjct: 94  FPVDESLEPFKIGGENDPLTDVTLSNQRGLSRKNILASVDKSVERLGTYIDVLQIHRLDH 153

Query: 119 PCAETEKRLGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMVNQ 172
            C   E      KAL +  ++ K++ +G S+        ++ + E Y W   +      +
Sbjct: 154 ECTGKE----IMKALNDVVESNKVRYVGASTMLATEFVELQMIAEKYDW--FQFVSSQTE 207

Query: 173 FELNPWLTRKDLVKYCKERDLVIEAFSP-------------ITRSKRFS--------DPV 211
           + L      ++L+ Y K  ++ +  +SP               RS   +        D +
Sbjct: 208 YSLLFREDERELLSYTKRNNIAVLPWSPNAGGYLCRPLDAATERSNSNTYKTEITEGDKI 267

Query: 212 VQKLLKESYPGRTPAQLLIR--WSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
             K ++E    ++ +  +I   W +  G+ P+      +R +  + A   E++ E++  L
Sbjct: 268 TIKRVEEIAKKKSVSMAMISEAWVMSKGYNPIIGFSSVERVKEAIEATKIELTEEEINYL 327

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 114/302 (37%), Gaps = 69/302 (22%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAG-- 86
           K +   I+  A+  G R  DTA  Y N  +    + +FLKE  ++ R+ V   TKV    
Sbjct: 39  KNEVFKILKTAYDSGLRTFDTADGYSNG-QSEILLGEFLKEY-EIPRETVIIMTKVWAPV 96

Query: 87  --DNHGYEK------------------AKKSIIESLE--MAKELEYVDLFLIHNPCAETE 124
                G+++                  ++K IIE+ +  + +   Y+D++ IH    +T 
Sbjct: 97  DSSLEGFQRTGPMNEDQKVHFANQQGLSRKHIIEACKNSVRRLGTYIDVYQIHRADQDTP 156

Query: 125 KRLGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMVNQFELNPW 178
               T +AL +  + G  + IG SS         + + E   W        VN  +    
Sbjct: 157 ME-ETMRALNDVVQQGLTRYIGASSMLGTEFAEYQFIAEKNGW-----SKFVNMQDCYNL 210

Query: 179 LTR---KDLVKYCKERDLVIEAFSPITRS-----------KRFSDPVVQKLLKESY---- 220
           L R   ++++ Y K+  +    +SP+ R            +  +D V++      Y    
Sbjct: 211 LYREEEREMIPYIKKHGIAQTPWSPLQRGLLSRPVEVSSYREDNDRVLKGRRLNQYEDFE 270

Query: 221 -------------PGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMK 267
                         G T A++   W L  G  P+       R +  + ALD  ++ E+ K
Sbjct: 271 IEIINRVEQVAVKKGITMAEVATAWLLSKGTFPILGLNSVQRVKEAIKALDVTLTEEECK 330

Query: 268 TL 269
            L
Sbjct: 331 YL 332

>KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} similar
           to uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 340

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 60/127 (47%), Gaps = 9/127 (7%)

Query: 35  IVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAG---DNHGY 91
           ++  A + G R +DT+  Y +      A  + LKE  ++ R+  F  TKV     +   Y
Sbjct: 48  MIRFAMQFGVRAIDTSPYYGDSEVLYGAALESLKE--ELPRENYFICTKVGRIRLEEFDY 105

Query: 92  EKAKK--SIIESLEMAKELEYVDLFLIHN-PCAETEKRLGTYKALQEFYKAGKIKAIGVS 148
            ++    S++ S E  K  +Y+D+  +H+    ETE+ L   + L++    G I   G+S
Sbjct: 106 SRSHIHFSVLRSCERLKT-KYLDVVFLHDVEFVETEQVLEALQELRKLRDEGVILNFGIS 164

Query: 149 SYSIKHL 155
            Y +  L
Sbjct: 165 GYPVDFL 171

>Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]
           {ON} complement(243219..244247) [1029 nt, 343 aa]
          Length = 342

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 114/301 (37%), Gaps = 62/301 (20%)

Query: 26  ETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV- 84
           E  K K   I+   + +G R  DTA +Y N     T + +FLK    + R+ V   +K+ 
Sbjct: 36  EDDKTKIFGILKHCYDRGMRTFDTANVYSNGL-SETLLGEFLKHY-NIPRETVVIMSKLN 93

Query: 85  --AGDNHGYEK------------------AKKSIIESL-EMAKEL-EYVDLFLIHNPCAE 122
               D   +E                   ++K+I+ S  E  + L  Y+D+  IH    +
Sbjct: 94  FATDDKVSFETLKERSEELNLHFVNMSGLSRKNIMASAKESVRRLGTYIDVLQIHRADRD 153

Query: 123 TEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL------YSW--------------- 161
           T     T +AL +  ++G  + IG SS       E+      Y W               
Sbjct: 154 TPYE-ETMRALNDLVESGITRYIGASSMLATEFAEMQFTAEKYGWFKFINSQSCYNLLYR 212

Query: 162 -EGLEVKPMV--NQFELNPW-------LTRKDLVK---YCKERDLVIEAFSPITRSKRFS 208
            +  E+ P    +   L PW       LTR   +K   Y  +R L I     +  S+   
Sbjct: 213 EDERELMPFAKRHNIALTPWSPLQRGLLTRPVGIKTTRYDSDRQLEIRKMKNLKDSEIEI 272

Query: 209 DPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKT 268
              V+KL  +     T A + + W +  G  P+       R +  + ALD + + E+++ 
Sbjct: 273 INRVEKLAND--KNVTMAVIGLAWVIAKGCTPIAGLSSIARVDEAIKALDIKFTEEELQY 330

Query: 269 L 269
           L
Sbjct: 331 L 331

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 36.6 bits (83), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 83/191 (43%), Gaps = 48/191 (25%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDN 88
           KE+A  ++ A ++ G   +DTA  Y+NE+  A  + +++ ES K+ RDQ+   TK + D 
Sbjct: 52  KERAFKLLDAFYEAGGNFIDTANTYQNEQSEAW-IGEWM-ESRKL-RDQIVIATKFSTDY 108

Query: 89  HGYEKAKK---------------SIIESLEMAKELEYVDLFLIH--NPCAETEKRLGTYK 131
             Y+  K                S+ +SL    + +++D+  IH  +     E+ +    
Sbjct: 109 KWYDVGKNRSANFCGNSKHSLHVSVRDSLRKL-QTDWIDILYIHWWDHMTSIEEVM---D 164

Query: 132 ALQEFYKAGKIKAIGVSS-----------YSIKHLEELYS-----WEGL------EVKPM 169
           +L    + GK+  +GVS            Y+  H +  +S     W  L      ++ PM
Sbjct: 165 SLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSIYQGKWNVLNRDFERDIIPM 224

Query: 170 VNQF--ELNPW 178
            + F   L PW
Sbjct: 225 ASHFGMALAPW 235

>NCAS0J01740 Chr10 complement(321825..322862) [1038 bp, 345 aa] {ON}
           
          Length = 345

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 62/300 (20%), Positives = 117/300 (39%), Gaps = 64/300 (21%)

Query: 26  ETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVA 85
           E  KEK  +++   +  G R  DTA +Y N  +    + +FLK+   + R+ V   TK+ 
Sbjct: 37  EDNKEKVFALLKHCYDVGLRTFDTADVYNNG-QSEVLLGEFLKKY-NIRRETVVILTKIY 94

Query: 86  GDNHGYEKAKK---SIIES--LEMAKELEYVDLFLIHNPCAETEKRLGTY---------- 130
            D+    +      SI ES  L++  +       +I      + +RLGTY          
Sbjct: 95  FDSDDSMEVGSNFASINESTKLDLVNQRGLSRKHIIQG-VKNSVRRLGTYIDVLQIHRLD 153

Query: 131 ---------KALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPW--- 178
                    K+L +   +G ++ IG SS       +L +     +    + F+   W   
Sbjct: 154 DNVPMKSIMKSLNDVVLSGDVRYIGASSMLATEFADLQA-----IADKHDWFQFVNWQSQ 208

Query: 179 ---LTRKD---LVKYCKERDLVIEAFSP-----------ITRSKRFSDPVVQKLLKES-- 219
              L R+D   ++ Y K  ++ +  +SP           +T  ++  DP +  +  +   
Sbjct: 209 YNLLYREDEREVIPYAKRHNIAVTPWSPNARGLLAKPANVTSERKNFDPRLASISDDDKE 268

Query: 220 YPGR----------TPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
             GR          + A +   W L   F+P+      +R +  + A+   ++ E++K L
Sbjct: 269 IIGRVEKIAKDKDISMAMVSTAWVLSKRFLPIVGMSKMERIDEAVKAIKVTLTQEEIKYL 328

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
          AAD4Putative aryl-alcohol dehydrogenase; involved in
          oxidative stress response; similar to P. chrysosporium
          aryl-alcohol dehydrogenase; expression induced in cells
          treated with the mycotoxin patulin
          Length = 329

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 29 KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDN 88
          KE+A  ++ A ++ G   +DTA  Y+NE E    + +++K S K+ RDQ+   TK  GD 
Sbjct: 6  KEQAFELLDAFYEAGGNCIDTANSYQNE-ESEIWIGEWMK-SRKL-RDQIVIATKFTGDY 62

Query: 89 HGYE 92
            YE
Sbjct: 63 KKYE 66

>KAFR0A02340 Chr1 complement(485299..486288) [990 bp, 329 aa] {ON}
           Anc_2.604 YMR041C
          Length = 329

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 78/173 (45%), Gaps = 28/173 (16%)

Query: 19  VLGFGTYETP-KEKAES-----IVHAAFKQGYRHVDTAQLY-ENERECATAVAKFLKESP 71
           +LG  T+ T   +  ES     I+  AF  G   +DT+  Y  +E     A+AK     P
Sbjct: 7   ILGCATFNTQYNDVPESLPVVEIMKKAFGDGINVIDTSPYYGPSEILVGEALAKI---KP 63

Query: 72  KVSRDQVFYTTKVAGD------NHGYEKAKKSIIESLE-----MAKELE-YVDLFLIHNP 119
           + S  Q+   TK AG       N+  E  + S+  S+E        E E Y+DL  +H+ 
Sbjct: 64  RRSTFQI--CTK-AGRITENEFNYSPEHIRFSVKRSIERLLGWCPDETEKYLDLVYLHDV 120

Query: 120 CAETEKRL-GTYKALQEFYKAGKIKAIGVSSYSIKHLEEL--YSWEGLEVKPM 169
             +T   + G  K L    K G IK +G+S Y +K L E+  Y  E  ++ P+
Sbjct: 121 EFQTLNDITGAIKELMILKKEGFIKRVGISGYPVKFLYEVSKYCKESRDIGPL 173

>CAGL0F06061g Chr6 complement(604063..605073) [1011 bp, 336 aa] {ON}
           similar to uniprot|Q04212 Saccharomyces cerevisiae
           YMR041c
          Length = 336

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 13/128 (10%)

Query: 39  AFKQGYRHVDTAQLYENERECATAVAKFLKESP-----KVSRDQVFYTTKVAGD-----N 88
           AF  G   +DT+  Y    E     A    +SP       +RDQ +  TKV        +
Sbjct: 41  AFTNGINAIDTSPYY-GPSEIIFGQALHKLKSPDEDGLSFTRDQYYICTKVGRIKLEEFD 99

Query: 89  HGYEKAKKSIIESLEMAKELEYVDLFLIHN-PCAETEKRLGTYKALQEFYKAGKIKAIGV 147
           +  +  + S++ S E   + +Y+DL  +H+    E  K +   K L++  + G I+  G+
Sbjct: 100 YSPKAVRASVLRSCERL-DTDYLDLVYLHDVEFVEFTKSMEALKELRKLKEEGVIRHFGL 158

Query: 148 SSYSIKHL 155
           S Y +K+L
Sbjct: 159 SGYPVKYL 166

>Kwal_33.14948 s33 (883559..886216) [2658 bp, 885 aa] {ON} YKL073W
           (LHS1) - novel member of the Hsp70 family of molecular
           chaperones that localizes to the lumen of the
           endoplasmic reticulum: [contig 396] FULL
          Length = 885

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 65/151 (43%), Gaps = 27/151 (17%)

Query: 114 FLIHNPCAETEKRLGTYKALQEFYKAG-KIKAI-GVSSYSIKHLEELYSWEGLEVKPMVN 171
           FL HNP   TEK     ++L   Y+A  K K I   +S +  H+E L+           +
Sbjct: 277 FLEHNPTVRTEKLDQNARSLVRLYQAAEKAKLILSANSDASVHVESLF-----------D 325

Query: 172 QFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR---FSDPV----VQKLLKESYPGRT 224
             +    +TR++   + +  DL +    PI  + +    SDPV    V  L+      RT
Sbjct: 326 DIDFKTTITRQEFEDFSE--DLTVRIVQPILDALKHQFLSDPVNLSQVNSLILTGGSTRT 383

Query: 225 PAQLLIRWSL--QMGFVPLPKSVHEDRAESN 253
           P   +++ SL    G   + K+V+ D +  N
Sbjct: 384 P---MVQKSLAQHFGEALIAKNVNADESSVN 411

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDN 88
           KE+A  ++ A ++ G   +DTA  Y+NE E    + +++  + +  RDQ+   TK  GD 
Sbjct: 52  KEQAFELLDAFYEAGGNCIDTANSYQNE-ESEIWIGEWM--ASRKLRDQIVIATKFTGDY 108

Query: 89  HGYE 92
             YE
Sbjct: 109 KKYE 112

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 79/191 (41%), Gaps = 48/191 (25%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDN 88
           KE+A  ++ A F+ G   +DTA  Y+NE+  A  + +++    +  RDQ+   TK   D 
Sbjct: 52  KERAFELLDAFFEAGGNFIDTANNYQNEQSEAW-IGEWMVS--RKLRDQIVIATKFTTDY 108

Query: 89  HGYEKAKK---------------SIIESLEMAKELEYVDLFLIH--NPCAETEKRLGTYK 131
             YE  K                S+ +SL    + +++D+  +H  +  +  E+ +    
Sbjct: 109 KKYEVGKGRSANFCGNHKHSLHVSVRDSLRKL-QTDWIDILYVHWWDYMSSIEEVM---D 164

Query: 132 ALQEFYKAGKIKAIGVSS-----------YSIKHLEELYS-----WEGL------EVKPM 169
           +L    + GK+  +GVS            Y+  H +  +S     W  L      E+ PM
Sbjct: 165 SLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSIYQGKWNLLNRDFEREIIPM 224

Query: 170 VNQF--ELNPW 178
              F   L PW
Sbjct: 225 ARHFGMALAPW 235

>YPL088W Chr16 (381965..382993) [1029 bp, 342 aa] {ON} Putative aryl
           alcohol dehydrogenase; transcription is activated by
           paralogous transcription factors Yrm1p and Yrr1p along
           with genes involved in multidrug resistance
          Length = 342

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 112/292 (38%), Gaps = 62/292 (21%)

Query: 35  IVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV------AGDN 88
           I+   + +G R  DTA  Y N    +  + K   E   + R+ V   TK+        D 
Sbjct: 45  IMKHCYDKGLRTFDTADFYSNG--LSERIIKEFLEYYSIKRETVVIMTKIYFPVDETLDL 102

Query: 89  HG------YEK---------AKKSIIESLEMA-KEL-EYVDLFLIHNPCAETEKRLGTYK 131
           H       +E+         ++K II  +E + K L  Y+DL  IH    ET  +    K
Sbjct: 103 HHNFTLNEFEELDLSNQRGLSRKHIIAGVENSVKRLGTYIDLLQIHRLDHETPMK-EIMK 161

Query: 132 ALQEFYKAGKIKAIGVSSYSIKHLEEL------YSWEGLEVKPMVNQFELNPWLTRKDLV 185
           AL +  +AG ++ IG SS       EL      Y W   +     + + L      ++L+
Sbjct: 162 ALNDVVEAGHVRYIGASSMLATEFAELQFTADKYGW--FQFISSQSYYNLLYREDERELI 219

Query: 186 KYCKERDLVIEAFSPITR----------SKRF-SDP----------------VVQKLLKE 218
            + K  ++ +  +SP  R          + R  SDP                ++ ++ K 
Sbjct: 220 PFAKRHNIGLLPWSPNARGMLTRPLNQSTDRIKSDPTFKSLHLDNLEEEQKEIINRVEKV 279

Query: 219 SYPGRTP-AQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
           S   +   A L I W L  G  P+       R +  + AL   ++ E++K L
Sbjct: 280 SKDKKVSMAMLSIAWVLHKGCHPIVGLNTTARVDEAIAALQVTLTEEEIKYL 331

>Kwal_47.16685 s47 (62770..63033) [264 bp, 87 aa] {ON} YJR135W-A
          (TIM8) - Subunit of mitochondrial protein import
          machinery [contig 376] FULL
          Length = 87

 Score = 32.7 bits (73), Expect = 0.22,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 2  SITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHA----AFKQGYRHVDTAQLYENER 57
          SIT +   +L +G K  ++ F   E  K+K +  +H      FKQ   +V    L   E 
Sbjct: 3  SITQNDLASLDDGSKKEIMTFLESENSKQKVQMSIHQFTNICFKQCATNVSNGNLSSQEE 62

Query: 58 ECAT-AVAKFLKESPKVSR 75
           C T  V +FL  + ++ +
Sbjct: 63 ACLTNCVNRFLDTNIRIVK 81

>SAKL0G18502g Chr7 (1595090..1595353) [264 bp, 87 aa] {ON} similar
          to uniprot|P57744 Saccharomyces cerevisiae YJR135W-A
          TIM8 Mitochondrial intermembrane space protein
          mediating import and insertion of polytopic inner
          membrane proteins; homolog of human DDP1 (deafness
          dystonia peptide 1) which is mutated in the X-linked
          Mohr-Tranebjaerg syndrome
          Length = 87

 Score = 32.3 bits (72), Expect = 0.30,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 2  SITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHA----AFKQGYRHVDTAQLYENER 57
          SIT +    L +G K  ++ F   E  K+K +  +H      FKQ    V+ A L   E 
Sbjct: 3  SITQADLANLDDGSKKDIMTFLESENSKQKVQMSIHQFTNICFKQCIPSVNNADLSTQEE 62

Query: 58 ECA-TAVAKFLKESPKVSR 75
          +C    V +FL  + ++ +
Sbjct: 63 QCLNNCVNRFLDTNIRIVK 81

>NCAS0I02160 Chr9 (407406..408440) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 115/314 (36%), Gaps = 92/314 (29%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKFLKESPKVSRDQVFYTTKVA 85
           KE+   I+   + +G R  DTA +Y N   ER     + +FLK   K+ R+ V   TKV 
Sbjct: 39  KEEIFKILKYCYDRGLRTYDTADVYSNGLSER----LLGEFLKRY-KIKRETVVIFTKVF 93

Query: 86  GD-------NHGYEK----------------AKKSIIESLEMAKEL--EYVDLFLIHNPC 120
                     HG +                 ++K I+  +  + E    YVD+  IH   
Sbjct: 94  CPVDETLPLTHGRQAIYDESVNLDLTNQKGLSRKHIVAGVANSVERLGTYVDVLQIHRLD 153

Query: 121 AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQF--ELNPW 178
            ET       ++L +   +G+++ IG SS       EL             QF  E N W
Sbjct: 154 HETSME-EIMRSLNDVILSGQVRYIGASSMRATEFAEL-------------QFIAEKNGW 199

Query: 179 ------------LTRKD---LVKYCKERDLVIEAFSPITRS-----------KRFSDPVV 212
                       L R+D   L+ + K+  + +  +SP  R               SD +V
Sbjct: 200 FKFVSSQSYYNLLNREDERELIPFAKKHGIGLVPWSPNARGILTRPLDESTPTGRSDNIV 259

Query: 213 QKLLKESY-----------------PGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLH 255
           +KL   +                     + A + I WS++ G  P+       RA   + 
Sbjct: 260 KKLHLNALMEDEKEIVKRVQKIAQKKSVSMAMVSIAWSIKKGCNPIVGLSSISRAAEAIG 319

Query: 256 ALDFEISAEDMKTL 269
           ALD  ++ E++  L
Sbjct: 320 ALDVHLTEEEVTYL 333

>Smik_16.149 Chr16 (265088..266116) [1029 bp, 342 aa] {ON} YPL088W
           (REAL)
          Length = 342

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 97/245 (39%), Gaps = 51/245 (20%)

Query: 3   ITASTTKTLTNGVKIP--VLGFGTYETPK-------EKAE--SIVHAAFKQGYRHVDTAQ 51
           + A   +   +G+KI   V+G  +Y + K       +KA    I+   +  G R  DTA 
Sbjct: 2   VLAKQVRLGNSGLKISPIVIGCMSYGSKKWADWVIEDKARIFKILKHCYDNGLRTFDTAD 61

Query: 52  LYENERECATAVAKFLKESPKVSRDQVFYTTKV-------AGDNHGYEK----------- 93
            Y N    +  + K   E   + R+ V   TK+          +H +             
Sbjct: 62  FYSNG--LSERIIKEFLELYNIKRETVVIMTKIFLPVDETLELHHNFTMNEVQELDLTNQ 119

Query: 94  ---AKKSIIESLEMAKEL--EYVDLFLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVS 148
              ++K II  ++ + E    Y+DL  IH    +T  +    KAL +  +AG ++ IG S
Sbjct: 120 RGLSRKHIIAGVKNSVERLGTYIDLLQIHRLDQDTPMK-EIMKALNDVVEAGHVRYIGAS 178

Query: 149 SYSIKHLEEL------YSWEGLEVKPMVNQFELNPWLTRKD---LVKYCKERDLVIEAFS 199
           S       EL      Y W     + + +Q   N  L R+D   L+ + K  ++ +  +S
Sbjct: 179 SMLATEFAELQFIADKYGW----FQFISSQSYYN-LLNREDERELIPFAKRHNIGLLPWS 233

Query: 200 PITRS 204
           P  R 
Sbjct: 234 PNARG 238

>TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa]
           {ON} 
          Length = 344

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 111/301 (36%), Gaps = 68/301 (22%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV---- 84
           KEK  SI+   +  G R  DTA +Y N       V +FLK+   + R+ V   TK+    
Sbjct: 42  KEKIFSILKHCYDHGLRTFDTADVYSNG-ASGRLVGEFLKKY-NIDRETVVILTKLFYPV 99

Query: 85  --------AGD---------NHGYEKAKKSIIESLEMAKEL--EYVDLFLIHNPCAETEK 125
                    G           H    ++K II   + + E    Y+D+  IH    ET  
Sbjct: 100 DESLDLKHGGTFDEEEKLQLTHHRGLSRKHIIAGAKASMERLGTYIDVLQIHRFDDETPM 159

Query: 126 RLGTYKALQEFYKAGKIKAIGVSSYS------IKHLEELYSWEGLEVKPMVNQFELNPWL 179
              T +AL      G  + IG S+        ++ + E + W     K + +Q   N  L
Sbjct: 160 E-ETMRALNYVVDQGFTRYIGASTMRATEFAEMQFIAEKHGW----YKFISSQSSYN-LL 213

Query: 180 TRKD---LVKYCKERDLVIEAFSPITR----------SKRF-SDPVVQKLLKESY----- 220
            R+D   L+ + +   + +  +SP  R          S+R  SDP   +L   +      
Sbjct: 214 YREDERELIPFAQRHGVGLIPWSPNARGVLTRPSNQTSERIKSDPTYSRLGWNALRANQK 273

Query: 221 ------------PGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKT 268
                        G + A + I W L  G  P+      +R    L ALD  ++ E+   
Sbjct: 274 EIVDRVEEIAKTKGVSMAVISIAWVLSKGAYPIVGLNSIERVNEALQALDVRLTDEETTY 333

Query: 269 L 269
           L
Sbjct: 334 L 334

>Smik_13.211 Chr13 complement(344952..346007) [1056 bp, 351 aa] {ON}
           YMR041C (REAL)
          Length = 351

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 53/127 (41%), Gaps = 11/127 (8%)

Query: 33  ESIVHAAFKQGYRHVDTAQLY-ENERECATAVAKFLKESPKVSRDQVFYTTKV---AGDN 88
           E ++  AF  G   +DT+  Y  +E     A+     E P   R   F  TKV   + D 
Sbjct: 51  EDMIRYAFSHGINAIDTSPYYGPSEVLYGKALTSLKNEFP---RSTYFICTKVGRISADE 107

Query: 89  HGYEK--AKKSIIESLEMAKELEYVDLFLIHN-PCAETEKRLGTYKALQEFYKAGKIKAI 145
             Y K   + S++ S +   +  Y+DL  +H+         L   K L+     G IK I
Sbjct: 108 FNYSKEFVRFSVLRSCKRL-DTAYLDLVYLHDVEFVSLPHILEALKELRILKNEGIIKNI 166

Query: 146 GVSSYSI 152
           GVS Y I
Sbjct: 167 GVSGYPI 173

>Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 115/299 (38%), Gaps = 64/299 (21%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYEN---ERECATAVAKFLKESPKVSRDQVFYTTKV- 84
           K K   I+   +  G R  DTA +Y N   ER     + +FLK   K+ R+ V   TKV 
Sbjct: 41  KGKIFEILKHCYDGGMRTFDTADVYSNGLSER----ILGEFLKHY-KIKRETVVILTKVY 95

Query: 85  --------------------AGDNHGYEKAKKSIIESLEMAKEL--EYVDLFLIHNPCAE 122
                                G  +    ++K I+E+ + + E    Y+D+  IH    +
Sbjct: 96  YPVDESLELTHFGKVSEFDMLGLVNQSGLSRKHILEAAKNSVERLGTYIDVLQIHKLDHD 155

Query: 123 TEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEEL-YSWEGLEVKPMVNQFELNPWLTR 181
           T       KAL    + G  + IG SS       EL +  E  +    +        L R
Sbjct: 156 TPME-EIMKALNGVVELGYTRYIGASSMLATEFAELQFIAEKRDWTKFICSQSCYSLLYR 214

Query: 182 KD---LVKYCKERDLVIEAFSPITRS-----------KRFSDPVVQKL---LKESY---- 220
           +D   L+ + K+  + +  +SP  R            ++ SDP  ++L     ES+    
Sbjct: 215 EDERELIPFAKKHGIGLIPWSPNARGILTRPLNQATDRKNSDPTFKRLKFDCLESHEKGI 274

Query: 221 ----------PGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
                      G + A + I W L  G  P+      +R +  + A++ +++ E+++ L
Sbjct: 275 VNRVEELAKKKGISMAMVSIAWVLSKGACPIVGLNSIERVDEAIRAVNVQLTEEEIQYL 333

>Skud_13.197 Chr13 complement(337502..338557) [1056 bp, 351 aa] {ON}
           YMR041C (REAL)
          Length = 351

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 58/136 (42%), Gaps = 17/136 (12%)

Query: 33  ESIVHAAFKQGYRHVDTAQLY-ENERECATAVAKFLKESPKVSRDQVFYTTKVA---GDN 88
           E I+  AF  G   +DT+  Y  +E     A+     E P   R+  F  TKV     D 
Sbjct: 51  EDIIKYAFWHGINAIDTSPYYGPSEILYGKALRNLKNEFP---RNTYFICTKVGRIGADE 107

Query: 89  HGYEK--AKKSIIESLEMAKELEYVDLFLIHN----PCAETEKRLGTYKALQEFYKAGKI 142
             Y K   + S+  S E      Y+DL  +H+    P  +  + L   + L++    G I
Sbjct: 108 FNYSKEFVRFSVHRSCERLNT-TYLDLVYLHDVEFVPLPQILEALKELRILKD---EGVI 163

Query: 143 KAIGVSSYSIKHLEEL 158
           K +G+S Y I+ +  L
Sbjct: 164 KNLGISGYPIEFITWL 179

>NDAI0A04610 Chr1 complement(1035715..1036761) [1047 bp, 348 aa]
           {ON} Anc_3.462
          Length = 348

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 82/195 (42%), Gaps = 20/195 (10%)

Query: 27  TPKEKAESIVHAAFK--QGYRH---VDTAQLYENERECATAVAKFLKESPKVSRDQVFYT 81
            P ++A   +H   K  Q   H    +  + Y  +    T   +F  + P + +D V  +
Sbjct: 30  VPMDQAFKTMHQVIKLAQARNHKAFFNVGEFYGPDYRNLTYCKEFFAKYPDLRKD-VIIS 88

Query: 82  TKVA--GDNHGYEKAKKSIIESLEMAKEL--EYVDLF----LIHNPCAETEKR-LGTYKA 132
            K A  G N   +     +I+S++   +    Y+D+F    L    C++ E     T++A
Sbjct: 89  CKGAYDGINFVCQGKHDQVIDSVKACVQNIGGYIDIFEPARLDMEICSKDEVYPRETFEA 148

Query: 133 LQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT---RKDLVKYCK 189
           L E  + G I A+ +S    K +  ++  +         + EL+ + T     D+ K C 
Sbjct: 149 LAELIEEGVIGAMSLSEVVAKEITAVH--KDFAKYLACVEVELSMFTTDILHNDVAKVCS 206

Query: 190 ERDLVIEAFSPITRS 204
           E  L+I  +SP+ R 
Sbjct: 207 EYGLIIICYSPLGRG 221

>Suva_6.19 Chr6 complement(28872..29492) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%)

Query: 114 FLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQF 173
            L+ N C   +KR+  Y   +EF  A K+  +  S+    ++E+ +     ++K  ++Q 
Sbjct: 117 LLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQ 176

Query: 174 ELNPWLTRKD 183
            LN    +KD
Sbjct: 177 NLNETTQKKD 186

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDN 88
           KE+A  ++ A ++ G   +DTA  Y+NE+  A  + +++  S K+ RDQ+   TK   D 
Sbjct: 52  KERAFELLDAFYEAGGNFIDTANNYQNEQSEAW-IGEWMV-SRKL-RDQIVIATKFTTDY 108

Query: 89  HGYE 92
             Y+
Sbjct: 109 KKYD 112

>Skud_16.417 Chr16 (749628..750665) [1038 bp, 345 aa] {ON} YPR127W
           (REAL)
          Length = 345

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 76/210 (36%), Gaps = 49/210 (23%)

Query: 110 YVDLF----LIHNPCAETEKR-LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELY-SWEG 163
           Y+D++    L  + CA+ E     +++AL E    G I  I +S  + + +  ++  W  
Sbjct: 120 YIDIYEVARLDTSLCAKGEVYPFESFEALAEMISEGVIGGISLSEVNEEQIRAIHKDWSK 179

Query: 164 LEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRS------------------- 204
                 V     +  +    + K C E  L +  +SP+ R                    
Sbjct: 180 FLTCVEVELSLFSTDILENGIAKTCAELGLTVICYSPLGRGLLTGQLKSNADIPEGDFRK 239

Query: 205 --KRFSDPVVQK------LLKESYPGRTP-------AQLLIRWSLQMG---------FVP 240
             KRFSD  ++K       L+E    + P       AQL + W              F+P
Sbjct: 240 TLKRFSDESLKKNLALVKFLQEEVIDKRPSNNSITLAQLALGWIKHWSKVPEYKGTKFIP 299

Query: 241 LPKSVHEDRAESNLHALDFEISAEDMKTLT 270
           +P      + + N      E++ ++ KT+ 
Sbjct: 300 IPSGSSISKVDENFDEKKTELTDQEFKTIN 329

>ZYRO0C06468g Chr3 (493466..494491) [1026 bp, 341 aa] {ON} similar
           to uniprot|Q06494 Saccharomyces cerevisiae YPR127W
           Hypothetical ORF
          Length = 341

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 81/210 (38%), Gaps = 17/210 (8%)

Query: 9   KTLTNGVKIPVLGFGTYETPKEKA----ESIVHAAFKQGYR-HVDTAQLYENERECATAV 63
           K L  G  +  L +     PKE+A    + ++  A   G +   +  + Y  +      V
Sbjct: 12  KQLHTGYGLMSLTWRPTPVPKEQAWDAMQCVIGLAQASGVKAFFNVGEFYGPDYSNLKLV 71

Query: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKS--IIESLEMAKELEYVDLFLIHNPCA 121
             F    P++ R  V  + K A D   +    KS  +I S+E  K +E++   L     A
Sbjct: 72  KSFFDAKPEL-RSHVIISCKGAIDATTFTPKGKSEDVIASVE--KCVEHLGTHLEIYEVA 128

Query: 122 ETEKRLG------TYKALQEFYKAGKIKAIGVSSYSIKHLEELY-SWEGLEVKPMVNQFE 174
             +K LG      +++A+      G I  I +S      +  ++  W    V   V    
Sbjct: 129 RLDKSLGGAYPRESFEAMASLVDKGVIDGISLSEVDKDEIIAIHKDWAKYLVCVEVELSL 188

Query: 175 LNPWLTRKDLVKYCKERDLVIEAFSPITRS 204
            +  +    +   C +  L+I A+SP+ R 
Sbjct: 189 FSTDILHNGIASICNDLGLIIVAYSPLGRG 218

>Kpol_1018.86 s1018 complement(232551..233642) [1092 bp, 363 aa]
           {ON} complement(232551..233642) [1092 nt, 364 aa]
          Length = 363

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/69 (21%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 101 SLEMAKELEYVDLFLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKH------ 154
           S +M  E +Y+ L ++   C   ++ +  +K + EF K+  + A G+  +   H      
Sbjct: 257 SRQMETEADYIGLMIMARACFNPDESIRLWKRMSEFEKSHHLGANGILEFLSTHPASDTR 316

Query: 155 LEELYSWEG 163
           ++ ++ W G
Sbjct: 317 IQNMHKWLG 325

>CAGL0K12672g Chr11 (1256370..1256990) [621 bp, 206 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038c YPT1
          Length = 206

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 34/70 (48%)

Query: 114 FLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQF 173
            L+ N C   +KR+  Y   +EF +A K+  +  S+    ++EE +     ++K  + Q 
Sbjct: 117 LLVGNKCDLADKRVVEYDVAKEFAEANKMPFLETSALDSTNVEEAFLTMARQIKESMTQQ 176

Query: 174 ELNPWLTRKD 183
            +N    +K+
Sbjct: 177 NMNESQQKKN 186

>YPL127C Chr16 complement(308828..309604) [777 bp, 258 aa] {ON}
           HHO1Histone H1, a linker histone required for nucleosome
           packaging at restricted sites; suppresses DNA repair
           involving homologous recombination; not required for
           telomeric silencing, basal transcriptional repression,
           or efficient sporulation
          Length = 258

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 191 RDLVIEAFSPITRSKRFSDPVVQKLLKESYP 221
           R+L+IE  + +   K  S P ++K +KE+YP
Sbjct: 48  RELIIEGLTALKERKGSSRPALKKFIKENYP 78

>KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 344

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 41/221 (18%)

Query: 26  ETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKV- 84
           E  KEK  S +   +  G R  DTA  Y N       V +FLK+   + R+ V   TKV 
Sbjct: 36  EDDKEKIFSTLKYCYDHGLRTFDTADFYSNGLS-EKLVGEFLKKY-NIRRETVVILTKVY 93

Query: 85  --------AGDNHGYEK------------AKKSIIESLEMA-KELE-YVDLFLIHNPCAE 122
                      ++G+ +            ++K I+  +  + K L+  +D+  IH    E
Sbjct: 94  FPVDEDLELSHSNGFTENDLLDLTNQQGLSRKHILAGVTASCKRLDTCIDVLQIHRLDRE 153

Query: 123 TEKRLGTYKALQEFYKAGKIKAIGVSSY------SIKHLEELYSWEGLEVKPMVNQFELN 176
           T       ++L    ++G+++ IG S+        ++ + E Y W     K + +Q   N
Sbjct: 154 TPME-EIMRSLNHVVESGQVRYIGASTMLATEFVELQSIAERYGWH----KFISSQSCYN 208

Query: 177 PWLTRKD---LVKYCKERDLVIEAFSPITRSKRFSDPVVQK 214
             L R+D   L+ Y K   + +  +SP  R      PV Q+
Sbjct: 209 -LLYREDERELIPYLKRHGVGMIPWSPNARGI-LCRPVSQQ 247

>NCAS0C03710 Chr3 complement(747168..747803) [636 bp, 211 aa] {ON}
           Anc_8.25
          Length = 211

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%)

Query: 114 FLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQ 172
            L+ N C  T+KR+  Y   +EF  A K+  +  S+ +  ++EE +     ++K  ++Q
Sbjct: 117 LLVGNKCDLTDKRVVEYDVAKEFADANKMPFLETSALNSTNVEEAFLTMARQIKESMSQ 175

>ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 379

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 73/333 (21%), Positives = 127/333 (38%), Gaps = 66/333 (19%)

Query: 1   MSITASTTKTLTNGVKI-PV----LGFGTYE------TPKEKAESIVHAAFKQGYRHVDT 49
           MSI A   +    G+KI P+    + FG+ E        KE+   I+  A+ +G R  DT
Sbjct: 38  MSI-AQQVRFGNTGLKISPIVVGCMSFGSKEWADWLIEDKEEVFKILKRAYDRGLRTYDT 96

Query: 50  AQLYEN----------------ERECATAVAKFL---KESPKVSRDQVFYTTKVAGDNHG 90
           A +Y N                 RE    + K      ES  V+    F   ++    + 
Sbjct: 97  ADVYSNGLSERILGEFLRHYNINRETVVILTKVFFPTDESIHVTSKFDFSEQELLTLTNQ 156

Query: 91  YEKAKKSIIESLEMAKEL--EYVDLFLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVS 148
              ++K I+  ++ + E    Y+D+  IH    ET       +AL +    G ++ IG S
Sbjct: 157 RGLSRKHILAGVKASIERLGTYIDVLQIHRLDHETPME-EIMRALNDVVTQGDVRYIGAS 215

Query: 149 SYSIKHLEEL-YSWEGLEVKPMVNQFELNPWLTRKD---LVKYCKERDLVIEAFSPI--- 201
           S       EL +  E  +    V+       L R+D   L+ + K   + +  +SP+   
Sbjct: 216 SMLATEFAELNFIAERHDWFKFVSSQSYYSLLYREDERELIPFAKRHGIALIPWSPLSGG 275

Query: 202 --------TRSKRFSD----------------PVVQKLLK-ESYPGRTPAQLLIRWSLQM 236
                   T ++  +D                 +V +L K  +  G++ A +   W L  
Sbjct: 276 ALTRPLGGTSNRSQTDNFKGILGVDNLKDNEKEIVNRLEKVANEKGQSMAAVATAWVLHK 335

Query: 237 GFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269
           G  P+       R +  L AL+ ++S +++  L
Sbjct: 336 GCNPIIGFNSIKRVDQALDALEVKLSEQEISYL 368

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 61/137 (44%), Gaps = 24/137 (17%)

Query: 29  KEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDN 88
           K+++  ++ A ++ G   +DTA  Y+N  +    + +++  S +  RDQ+   TK   D 
Sbjct: 52  KQRSFELLDAFYEAGGNFIDTANNYQNG-QSEEWIGEWM--SSRKIRDQIVIATKYTSDY 108

Query: 89  HGYEKAKK---------------SIIESLEMAKELEYVDLFLIH--NPCAETEKRLGTYK 131
             Y+  K                S+ +SL    + +++D+  +H  +     E+ +    
Sbjct: 109 KAYQIGKNKSANFSGNHRRSLQLSVRDSLRKL-QTDWIDILYVHWWDQMTSIEEVM---D 164

Query: 132 ALQEFYKAGKIKAIGVS 148
           +L    + GK+  +GVS
Sbjct: 165 SLHVLVQQGKVLYLGVS 181

>KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W
          Length = 342

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 64/144 (44%), Gaps = 16/144 (11%)

Query: 75  RDQVFYTTKVAGDNHGYEKA--KKSIIESLEMAKEL--EYVDLFLIHNPCAETEKRLG-- 128
           R++V  + K A D      A   KS+  S+E   ++   YVD++       E  K+ G  
Sbjct: 81  REKVIISAKGAVDLQTLSPAGDAKSVSASIENTLKVFNGYVDIYEPARLDLELIKKTGES 140

Query: 129 -----TYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPW---LT 180
                T+  + E+ K GKI  I +S  + + +  ++   G  +  +  + EL+ +   + 
Sbjct: 141 VFPRETFDTIVEYVKKGKIGGISLSEVTAEQIRAIHKEYGEYL--VCVEVELSMFSAEIL 198

Query: 181 RKDLVKYCKERDLVIEAFSPITRS 204
              +V  C E  L I A+SP+ R 
Sbjct: 199 SNGIVDTCNELGLPIVAYSPLGRG 222

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
           YFL008W
          Length = 1219

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 5/100 (5%)

Query: 189 KERDLVIEAFSPITRSKRFSDPVVQKLLK--ESYPGRTPAQ--LLIRWSLQMGFVPLPKS 244
           KE+D ++   +PI  S+R ++  +  + K  ES       Q   + R+  Q+  V   K 
Sbjct: 297 KEKDNLLSELTPIQLSQRSAEKRLANIEKRIESIARDMERQKTYVSRYEKQLKVVKKTKD 356

Query: 245 VHEDR-AESNLHALDFEISAEDMKTLTHDGEHFLAQPGFD 283
             E+   +SN +   + ++ EDMK      E +L + GF+
Sbjct: 357 TFEEELKQSNSNPDKYRLNDEDMKLYERLNEQYLTEGGFE 396

>KLLA0F26851g Chr6 complement(2478465..2479451) [987 bp, 328 aa]
           {ON} similar to uniprot|Q04212 Saccharomyces cerevisiae
           YMR041C Hypothetical ORF
          Length = 328

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 54/124 (43%), Gaps = 5/124 (4%)

Query: 39  AFKQGYRHVDTAQLYE-NERECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEK--AK 95
           AF  G   +DT+  Y  +E     A+    ++ P+ S        ++  D+  Y K   +
Sbjct: 42  AFANGINAIDTSPYYGPSEIIYGEALESIQEQWPRNSYQICTKVGRIQLDDFDYSKEHVR 101

Query: 96  KSIIESLEMAKELEYVDLFLIHN-PCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKH 154
            S++ S E  K   Y+D+  +H+    E +  L     +++    G +  IG+S Y +  
Sbjct: 102 SSVLRSCERLKT-NYLDVLYLHDIEFVEEDMILEALTEMRKLKDEGIVLRIGISGYPVDF 160

Query: 155 LEEL 158
           L ++
Sbjct: 161 LYQI 164

>Smik_6.326 Chr6 (514568..515356) [789 bp, 262 aa] {ON} YPL127C
           (REAL)
          Length = 262

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 191 RDLVIEAFSPITRSKRFSDPVVQKLLKESYP 221
           R+L++E  + +   K  S P ++K +KE+YP
Sbjct: 48  RELIVEGLTALKERKGSSRPALKKFIKENYP 78

>Skud_6.32 Chr6 complement(58531..59151) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 34/70 (48%)

Query: 114 FLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQF 173
            L+ N C   +KR+  Y   +EF  A K+  +  S+    ++E+ +     ++K  ++Q 
Sbjct: 117 LLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQ 176

Query: 174 ELNPWLTRKD 183
            LN    +K+
Sbjct: 177 NLNETTQKKE 186

>Smik_6.40 Chr6 complement(70749..71369) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 34/70 (48%)

Query: 114 FLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQF 173
            L+ N C   +KR+  Y   +EF  A K+  +  S+    ++E+ +     ++K  ++Q 
Sbjct: 117 LLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQ 176

Query: 174 ELNPWLTRKD 183
            LN    +K+
Sbjct: 177 NLNETTQKKE 186

>YFL038C Chr6 complement(55366..55986) [621 bp, 206 aa] {ON}
           YPT1Rab family GTPase, involved in the ER-to-Golgi step
           of the secretory pathway; complex formation with the Rab
           escort protein Mrs6p is required for prenylation of
           Ypt1p by protein geranylgeranyltransferase type II
           (Bet2p-Bet4p)
          Length = 206

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 34/70 (48%)

Query: 114 FLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQF 173
            L+ N C   +KR+  Y   +EF  A K+  +  S+    ++E+ +     ++K  ++Q 
Sbjct: 117 LLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQ 176

Query: 174 ELNPWLTRKD 183
            LN    +K+
Sbjct: 177 NLNETTQKKE 186

>Kpol_1023.21 s1023 complement(39597..40220) [624 bp, 207 aa] {ON}
           complement(39597..40220) [624 nt, 208 aa]
          Length = 207

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 30/59 (50%)

Query: 114 FLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQ 172
            L+ N C   +KR+  Y   +EF +A K+  +  S+    ++EE +     ++K  ++Q
Sbjct: 117 LLVGNKCDLNDKRVVEYDVAKEFAEANKMPFLETSALDSTNVEEAFLTMARQIKESISQ 175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,582,906
Number of extensions: 1283044
Number of successful extensions: 4254
Number of sequences better than 10.0: 215
Number of HSP's gapped: 4002
Number of HSP's successfully gapped: 234
Length of query: 289
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 181
Effective length of database: 41,097,471
Effective search space: 7438642251
Effective search space used: 7438642251
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)