Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G02376g3.499ON25125112411e-175
Kwal_47.188983.499ON25125111851e-166
SAKL0F02530g3.499ON25225110821e-150
Ecym_12303.499ON25124910631e-148
TDEL0D056703.499ON25525110591e-147
Kpol_480.103.499ON25924610511e-145
KAFR0C020203.499ON25825210491e-145
KLLA0E03917g3.499ON24924910441e-145
AFR318W3.499ON25125110361e-143
Smik_6.2313.499ON25824710361e-143
TPHA0A057003.499ON25625110351e-143
ZYRO0D09746g3.499ON25325210341e-143
YGR135W (PRE9)3.499ON25824710331e-143
Skud_7.4463.499ON25825210311e-142
Suva_7.4233.499ON25824710301e-142
NDAI0G008903.499ON25425110211e-141
KNAG0B007603.499ON25925110051e-139
NCAS0E007603.499ON25924710001e-138
CAGL0I10406g3.499ON2572529991e-138
TBLA0D029203.499ON2582539421e-129
Kwal_56.247805.64ON2622253804e-44
KLLA0B11836g7.120ON2541763762e-43
KLTH0F13574g7.120ON2541793752e-43
Suva_15.1317.120ON2541913742e-43
KAFR0G030307.120ON2541913743e-43
YOL038W (PRE6)7.120ON2541913743e-43
NDAI0C034005.64ON2632583744e-43
Skud_15.1197.120ON2541913734e-43
Kwal_YGOB_Anc_7.1207.120ON2541793726e-43
NCAS0F010307.120ON2531913701e-42
TBLA0J019807.120ON2541913701e-42
Smik_15.1297.120ON2541913691e-42
KLTH0E16324g8.871ON2501903672e-42
CAGL0F01199g7.120ON2541773682e-42
NDAI0H015207.120ON2521893682e-42
KLTH0H00528g5.64ON2612253683e-42
ZYRO0G04136g7.120ON2541793665e-42
TPHA0I020707.120ON2561793648e-42
Ecym_12727.120ON2511883649e-42
Kpol_1062.25.64ON2602253659e-42
TPHA0H011905.64ON2602253649e-42
AAR012C7.120ON2511763631e-41
SAKL0F04224g7.120ON2521913631e-41
Ecym_51005.64ON2611903622e-41
NCAS0D013405.64ON2612463622e-41
Kpol_1023.1087.120ON2542383612e-41
KNAG0J001808.871ON2501903604e-41
KLLA0A05093g5.64ON2621933587e-41
SAKL0H02068g5.64ON2611903587e-41
ADL354W8.871ON2501903587e-41
TDEL0H033007.120ON2561913588e-41
AER296W5.64ON2601903588e-41
TBLA0C066205.64ON2622253588e-41
KAFR0B044405.64ON2602253562e-40
CAGL0H07007g8.871ON2501903552e-40
Ecym_81518.871ON2501903542e-40
CAGL0I02442g5.64ON2601933543e-40
KAFR0L020808.871ON2501903524e-40
TDEL0G008805.64ON2602253535e-40
NDAI0E001608.871ON2501903501e-39
YGR253C (PUP2)5.64ON2602253482e-39
Smik_16.545.64ON2602253483e-39
Suva_7.5495.64ON2602253473e-39
KLLA0D10373g8.871ON2501903464e-39
KNAG0L010207.120ON2661813457e-39
Smik_13.438.871ON2501933447e-39
SAKL0D00440g8.871ON2501903449e-39
ZYRO0C11770g5.64ON2602253441e-38
ZYRO0A00616g8.871ON2501863431e-38
Suva_13.568.871ON2501903431e-38
Skud_7.5865.64ON2602253432e-38
NCAS0B001508.871ON2501903412e-38
Skud_13.518.871ON2501933403e-38
YML092C (PRE8)8.871ON2501933403e-38
TPHA0C049308.871ON2501903403e-38
Kpol_455.58.871ON2491903403e-38
TBLA0C063408.871ON2561963396e-38
KNAG0K004505.64ON2671933397e-38
TDEL0B004008.871ON2501893324e-37
KLTH0D00902g7.20ON2771903083e-33
ZYRO0C00792g7.20ON2901723014e-32
CAGL0H06105g7.20ON2901903015e-32
KLLA0A03487g7.20ON2751902996e-32
Skud_15.5307.20ON2881912997e-32
TBLA0E006907.20ON2781912998e-32
ADR401C7.20ON2791722989e-32
Kpol_538.407.20ON2741912971e-31
Smik_15.5467.20ON2881912971e-31
Ecym_50197.20ON2851722944e-31
SAKL0D14476g7.20ON2811902927e-31
Suva_8.4197.20ON2921912911e-30
KNAG0E002307.20ON2792022901e-30
NCAS0I002507.20ON2921722911e-30
Ecym_72334.110ON2461952872e-30
YOR362C (PRE10)7.20ON2881722902e-30
KAFR0C050007.20ON2811722892e-30
NDAI0A087707.20ON2921912851e-29
AGL089W4.110ON2461822821e-29
TDEL0H043107.20ON2741912831e-29
TPHA0N002407.20ON2771722761e-28
KNAG0E011805.1ON2331932713e-28
KLLA0A05027g4.110ON2461952706e-28
TBLA0C040804.110ON2531892663e-27
CAGL0M14003g5.1ON2331922627e-27
YGL011C (SCL1)4.110ON2521772611e-26
Kwal_47.174934.110ON2461822592e-26
Skud_7.2764.110ON2521772593e-26
KLTH0E07788g4.110ON2461822575e-26
Suva_7.2704.110ON2521772576e-26
KLTH0B09504g5.1ON2331922556e-26
Kwal_26.94835.1ON2331922556e-26
Smik_7.2794.110ON2521772566e-26
NCAS0A016404.110ON2531812566e-26
CAGL0A00407g4.110ON2541772568e-26
Kpol_1061.454.110ON2561772569e-26
TDEL0F023604.110ON2531792541e-25
ZYRO0G10164g4.110ON2531732542e-25
SAKL0H21956g4.110ON2481822523e-25
KLLA0A10153g5.1ON2331932504e-25
NDAI0I026405.1ON2331922495e-25
Ecym_56505.1ON2331922487e-25
TPHA0F006704.110ON2572002499e-25
Kwal_27.97208.871ON1731152431e-24
ZYRO0C01144g5.1ON2331932471e-24
Kpol_1060.15.1ON2331922461e-24
NCAS0D023105.1ON2331922452e-24
TPHA0A056705.1ON2331922434e-24
KNAG0D035404.110ON2521772435e-24
AGL336W5.1ON3061922457e-24
SAKL0H00946g5.1ON2331922372e-23
KAFR0F034304.110ON2521792383e-23
Skud_13.4885.1ON2341772364e-23
Smik_13.5315.1ON2341772355e-23
YMR314W (PRE5)5.1ON2341772355e-23
KAFR0I027205.1ON2351782331e-22
Suva_13.5075.1ON2341772322e-22
TBLA0C071905.1ON2331922312e-22
TDEL0G002405.1ON2381972181e-20
Kwal_26.68197.20ON1961131541e-11
NDAI0D035604.110ON172801405e-10
Smik_15.3375.507ON2611621312e-08
Suva_8.2085.507ON2611621304e-08
YOR157C (PUP1)5.507ON2611621294e-08
KNAG0B038005.507ON2611621271e-07
NDAI0C011705.507ON2631621261e-07
TDEL0A037105.507ON2611841251e-07
Ecym_54585.507ON2581681252e-07
Skud_15.3215.507ON2611621252e-07
SAKL0G04290g5.507ON2611841252e-07
Kwal_47.187485.507ON2631691252e-07
KAFR0C053005.507ON2611831224e-07
TPHA0E020505.507ON2611731224e-07
TBLA0D017505.507ON2591661215e-07
CAGL0L04312g5.507ON2611701215e-07
Kpol_218.15.507ON2611621206e-07
KLLA0A02233g5.507ON2621621172e-06
AGL324W7.480ON2431531172e-06
ZYRO0D12034g5.507ON2611601162e-06
NCAS0H024805.507ON2641851144e-06
KLTH0G03168g5.507ON2631691127e-06
KLLA0E05633g7.480ON2401461101e-05
NCAS0A148807.480ON2411991091e-05
KAFR0B006507.480ON2411741082e-05
Kpol_534.575.216ON2152091073e-05
Kpol_2002.1095.216ON2152091073e-05
CAGL0F04477g7.480ON2421541073e-05
KLLA0F12936g5.216ON2151651054e-05
TDEL0C034407.480ON2411741055e-05
SAKL0F15092g7.480ON2611781055e-05
NDAI0J006007.480ON2411741055e-05
KLTH0E01826g7.480ON2422251048e-05
Ecym_71717.480ON2421581021e-04
KNAG0F035907.480ON2481541021e-04
AAR119W5.507ON2591751002e-04
ZYRO0B10142g5.216ON215209993e-04
Kwal_55.198827.480ON242158993e-04
Kpol_1028.927.480ON242155984e-04
TBLA0F026807.480ON241160984e-04
NDAI0A048603.417ON287167984e-04
TBLA0F017603.417ON287167985e-04
ZYRO0G17842g7.480ON244147967e-04
Kwal_33.151935.216ON193205959e-04
Smik_10.2785.216ON216164940.001
TPHA0N007405.216ON216210930.002
YBL041W (PRE7)7.480ON241155930.002
TDEL0C055403.417ON287167930.002
Smik_2.737.480ON241155930.002
Skud_10.2225.216ON215164920.002
Skud_2.617.480ON241155920.002
TPHA0E004207.480ON241161920.002
KLTH0D03058g3.417ON287169920.003
Ecym_26143.417ON285167920.003
Suva_12.805.216ON215209910.003
YJL001W (PRE3)5.216ON215164910.003
Kwal_26.72733.417ON287168920.003
TPHA0E029905.216ON216210900.004
NCAS0A114403.417ON287167910.004
KLLA0F08228g3.417ON285163910.004
TDEL0E041305.216ON219206900.004
KAFR0D042103.417ON287167900.004
TPHA0M017503.417ON286167900.005
AAL172C5.216ON215161890.005
Ecym_82765.216ON215206890.005
AEL326C3.417ON285167890.006
Skud_16.3883.417ON287167890.007
Suva_16.4293.417ON287167890.007
ZYRO0C17688g3.417ON287167880.009
TBLA0C062005.216ON216208870.009
Kpol_1018.1443.417ON288167880.009
CAGL0G01804g3.417ON286169880.010
Suva_2.777.480ON241155870.010
KNAG0A075203.417ON287169870.013
YPR103W (PRE2)3.417ON287167860.015
Smik_16.3433.417ON287167860.015
SAKL0G12584g5.216ON215209850.015
SAKL0B09262g3.417ON287167850.021
CAGL0D03058g5.216ON21573830.033
KLTH0G00550g3.574ON265163810.059
NDAI0C024205.216ON216163810.062
KLTH0B03102g5.216ON215209790.10
NCAS0A014805.216ON216211770.16
KLLA0E14785g2.332ON31096770.26
KAFR0C063505.216ON216208750.34
Smik_7.1736.159ON34942740.60
TBLA0E001503.574ON265171730.65
KNAG0H024505.216ON216207711.1
KLTH0F13750g7.162ON195169701.3
KLTH0C07348g3.269ON316127701.8
TDEL0B071102.618ON88856702.1
NDAI0E036307.162ON195173673.0
KLLA0B11660g7.162ON195171663.8
ZYRO0B03146g7.383ON20582664.8
Skud_5.1167.162ON198164664.8
AAR019W7.162ON195159655.2
Kwal_55.210287.162ON195170647.2
YER012W (PRE1)7.162ON198170647.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G02376g
         (251 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   482   e-175
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   461   e-166
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   421   e-150
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   414   e-148
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   412   e-147
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   409   e-145
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   408   e-145
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   406   e-145
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   403   e-143
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   403   e-143
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   403   e-143
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   402   e-143
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   402   e-143
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   401   e-142
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   401   e-142
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   397   e-141
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   391   e-139
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     389   e-138
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   389   e-138
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   367   e-129
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   150   4e-44
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   149   2e-43
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   149   2e-43
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   148   2e-43
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   148   3e-43
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   148   3e-43
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   148   4e-43
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   148   4e-43
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   147   6e-43
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     147   1e-42
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   147   1e-42
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   146   1e-42
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   145   2e-42
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   146   2e-42
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     146   2e-42
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   146   3e-42
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   145   5e-42
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   144   8e-42
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   144   9e-42
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   145   9e-42
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   144   9e-42
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   144   1e-41
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   144   1e-41
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   144   2e-41
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      144   2e-41
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   143   2e-41
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   143   4e-41
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   142   7e-41
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   142   7e-41
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   142   7e-41
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   142   8e-41
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   142   8e-41
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   142   8e-41
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   141   2e-40
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   141   2e-40
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   140   2e-40
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   140   3e-40
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   140   4e-40
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   140   5e-40
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   139   1e-39
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   138   2e-39
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   138   3e-39
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   138   3e-39
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   137   4e-39
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   137   7e-39
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   137   7e-39
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   137   9e-39
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   137   1e-38
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   136   1e-38
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   136   1e-38
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   136   2e-38
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   135   2e-38
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   135   3e-38
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   135   3e-38
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   135   3e-38
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   135   3e-38
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   135   6e-38
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   135   7e-38
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   132   4e-37
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   123   3e-33
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   120   4e-32
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   120   5e-32
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   119   6e-32
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   119   7e-32
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   119   8e-32
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   119   9e-32
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   119   1e-31
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   119   1e-31
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   117   4e-31
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   117   7e-31
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   116   1e-30
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   116   1e-30
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   116   1e-30
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   115   2e-30
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   116   2e-30
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   115   2e-30
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   114   1e-29
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   113   1e-29
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   113   1e-29
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   110   1e-28
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   108   3e-28
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   108   6e-28
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   107   3e-27
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   105   7e-27
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   105   1e-26
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   104   2e-26
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   104   3e-26
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   103   5e-26
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   103   6e-26
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   102   6e-26
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...   102   6e-26
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   103   6e-26
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   103   6e-26
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   103   8e-26
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   103   9e-26
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   102   1e-25
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   102   2e-25
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   101   3e-25
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...   100   4e-25
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1       100   5e-25
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...   100   7e-25
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   100   9e-25
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...    98   1e-24
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...   100   1e-24
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...    99   1e-24
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...    99   2e-24
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}              98   4e-24
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...    98   5e-24
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...    99   7e-24
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...    96   2e-23
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...    96   3e-23
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...    96   4e-23
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...    95   5e-23
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...    95   5e-23
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...    94   1e-22
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...    94   2e-22
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....    94   2e-22
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    89   1e-20
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    64   1e-11
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    59   5e-10
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    55   2e-08
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    55   4e-08
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    54   4e-08
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    54   1e-07
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    53   1e-07
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    53   1e-07
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    53   2e-07
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    53   2e-07
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    53   2e-07
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    53   2e-07
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    52   4e-07
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    52   4e-07
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    51   5e-07
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    51   5e-07
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    51   6e-07
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    50   2e-06
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    50   2e-06
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    49   2e-06
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      49   4e-06
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    48   7e-06
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    47   1e-05
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    47   1e-05
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    46   2e-05
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    46   3e-05
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    46   3e-05
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    46   3e-05
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    45   4e-05
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    45   5e-05
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    45   5e-05
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    45   5e-05
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    45   8e-05
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    44   1e-04
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    44   1e-04
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    43   2e-04
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    43   3e-04
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    43   3e-04
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    42   4e-04
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    42   4e-04
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    42   4e-04
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    42   5e-04
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    42   7e-04
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    41   9e-04
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    41   0.001
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    40   0.002
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    40   0.002
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    40   0.002
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    40   0.002
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    40   0.002
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    40   0.002
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    40   0.002
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    40   0.003
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    40   0.003
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    40   0.003
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    40   0.003
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    40   0.003
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    39   0.004
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    40   0.004
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    40   0.004
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    39   0.004
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    39   0.004
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    39   0.005
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    39   0.005
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    39   0.005
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    39   0.006
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    39   0.007
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    39   0.007
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    39   0.009
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    38   0.009
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    39   0.009
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    39   0.010
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    38   0.010
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    38   0.013
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    38   0.015
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    38   0.015
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    37   0.015
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    37   0.021
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    37   0.033
KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly si...    36   0.059
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    36   0.062
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    35   0.10 
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    34   0.16 
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    34   0.26 
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    33   0.34 
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    33   0.60 
TBLA0E00150 Chr5 (19516..20313) [798 bp, 265 aa] {ON} Anc_3.574 ...    33   0.65 
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    32   1.1  
KLTH0F13750g Chr6 (1126220..1126807) [588 bp, 195 aa] {ON} highl...    32   1.3  
KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly ...    32   1.8  
TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa] ...    32   2.1  
NDAI0E03630 Chr5 complement(783559..784146) [588 bp, 195 aa] {ON...    30   3.0  
KLLA0B11660g Chr2 complement(1024265..1024852) [588 bp, 195 aa] ...    30   3.8  
ZYRO0B03146g Chr2 complement(254858..255475) [618 bp, 205 aa] {O...    30   4.8  
Skud_5.116 Chr5 (174986..175582) [597 bp, 198 aa] {ON} YER012W (...    30   4.8  
AAR019W Chr1 (375421..376008) [588 bp, 195 aa] {ON} Syntenic hom...    30   5.2  
Kwal_55.21028 s55 (654604..655191) [588 bp, 195 aa] {ON} YER012W...    29   7.2  
YER012W Chr5 (177835..178431) [597 bp, 198 aa] {ON}  PRE1Beta 4 ...    29   7.8  

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  482 bits (1241), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/251 (94%), Positives = 237/251 (94%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240
           KDDITVEEATELA              PERVEFSTITKLDNGKIAQKIFKPQEIETLLNK
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240

Query: 241 TGVTKKENDDE 251
           TGVTKKENDDE
Sbjct: 241 TGVTKKENDDE 251

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  461 bits (1185), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 224/251 (89%), Positives = 235/251 (93%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLK+YNEEIPVEILVRRLSDVKQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGASFIYAGYDDR+GYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240
           KDDITV+EATELA               ERVEF+TITKL+NGKIAQKIFKP+EIETLLN+
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITKLENGKIAQKIFKPREIETLLNE 240

Query: 241 TGVTKKENDDE 251
           TG+ KKEN++E
Sbjct: 241 TGINKKENEEE 251

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  421 bits (1082), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 202/251 (80%), Positives = 225/251 (89%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +SSEKLYKLNDNITVAVAGLTADAEILINTAR++AQNYL++YNEEIPVEILVRRLSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYD+RYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240
           KD I ++ A ELA               +R+EF+TI K  NG++ QKI+KPQEI+TLL+K
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKGSNGQLYQKIYKPQEIQTLLSK 240

Query: 241 TGVTKKENDDE 251
           TG+TKK+++DE
Sbjct: 241 TGITKKDDEDE 251

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  414 bits (1063), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 217/249 (87%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MAKDGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +SSEKLY+LNDNITVAVAGLTADAEILINTARL AQNYLK YNEEIPVEILVRRLSD+KQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240
           KD+IT E A ELA               +R+EF+TI +  NGK+ QKI+KP EI+ LL K
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQDSNGKLVQKIYKPSEIKELLQK 240

Query: 241 TGVTKKEND 249
           +G+ K+E +
Sbjct: 241 SGIMKQEEN 249

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  412 bits (1059), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 196/251 (78%), Positives = 222/251 (88%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EKLY+LND ITVAVAGLTADAEILINTAR++AQNYL++YNE+IPVEILV+RLSD+KQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240
           KDD+ +E A ELA               +R+EF+TI K  +GK+ QKIFKP+EI++LL K
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240

Query: 241 TGVTKKENDDE 251
            G+TKK +DDE
Sbjct: 241 HGITKKHHDDE 251

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  409 bits (1051), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/246 (80%), Positives = 216/246 (87%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EK+Y+LND ITVAVAGLTADAEILINTAR+ AQ YLK+YNEEIPVEILVRRLSD+KQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240
           KDDI V+EA ELA               +RVEF+TI K +N KI QKIFKP+EI+ LL K
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240

Query: 241 TGVTKK 246
           TG+TKK
Sbjct: 241 TGITKK 246

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  408 bits (1049), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 221/252 (87%), Gaps = 1/252 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MAKDGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S EKLYKLND ITVAVAGLTADAEILINTAR+ AQNYLK+YNE+IPVEILVRRLSD+KQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYD+RYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITK-LDNGKIAQKIFKPQEIETLLN 239
           KD+IT+++A ELA               +R+EF+TI K   N KI QKIF P EI++LL 
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 240 KTGVTKKENDDE 251
           KTG++KKEN+DE
Sbjct: 241 KTGISKKENEDE 252

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  406 bits (1044), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/249 (79%), Positives = 217/249 (87%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+M + GIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +SSEKLYKLNDNITVAVAGLTADAEILINTAR+ AQ+YLK+YNEEIPVE+LVRRLSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240
           KDDIT++ A ELA               ER+EF+TI+K   GKI QKI+KP EI TLL K
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKDAEGKIYQKIYKPTEIATLLEK 240

Query: 241 TGVTKKEND 249
           T + KK++D
Sbjct: 241 TEIVKKDDD 249

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  403 bits (1036), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 194/251 (77%), Positives = 216/251 (86%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MAKDGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +SSEKLY+LNDNITVAVAGLTADAEIL+NTARL AQNYLK YNEEIPVE+LVRRLSD+KQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYD RYGYQLYTSNPSGNYSGWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240
           KDD+T ++A +LA               ER+EF+TI +  +GK+ QKI+K  EI+ LL K
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240

Query: 241 TGVTKKENDDE 251
           TG+ K+E  ++
Sbjct: 241 TGINKQEEKED 251

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  403 bits (1036), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/247 (78%), Positives = 219/247 (88%), Gaps = 1/247 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EKLYKLND I+VAVAGLTADAEILINTAR+ AQNYLK+YNE+IPVEILVRRLSD+KQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITK-LDNGKIAQKIFKPQEIETLLN 239
           KDD+ V++A +LA               +R+EF+TI K +++G++ QKIFKPQEI+ LL 
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KTGVTKK 246
           KTG+TKK
Sbjct: 241 KTGITKK 247

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  403 bits (1035), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 193/251 (76%), Positives = 220/251 (87%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA+DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EKLYKLNDNITVAVAGLTADAEILINTAR+FAQNYL++YNE+IPVE+LVR+LSD+KQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYD+R GYQL+TSNPSGNY+GWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240
           KDDI +E A ELA               +RVEF+TI K +N K+ QKI+KP+EI+ LL+K
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240

Query: 241 TGVTKKENDDE 251
            G+TKK  D E
Sbjct: 241 AGITKKSEDGE 251

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  402 bits (1034), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 196/252 (77%), Positives = 221/252 (87%), Gaps = 1/252 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA+DGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EKLY+LND I VAVAGLT+DAEILINTAR+ AQNYLK+YNE+IPVEILV+RLSD+KQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240
           KDDI V+ A ELA               +RVEF+TI   +NGK+ QK+FKP+EI+TLL K
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240

Query: 241 TGVTKK-ENDDE 251
            G+TK  E++DE
Sbjct: 241 NGITKAGEDEDE 252

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  402 bits (1033), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/247 (78%), Positives = 217/247 (87%), Gaps = 1/247 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EKLYKLND I VAVAGLTADAEILINTAR+ AQNYLK+YNE+IPVEILVRRLSD+KQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITK-LDNGKIAQKIFKPQEIETLLN 239
           KDD+ V++A ELA               +R+EF+TI K  ++G++ QKIFKPQEI+ +L 
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 240 KTGVTKK 246
           KTG+TKK
Sbjct: 241 KTGITKK 247

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  401 bits (1031), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/252 (77%), Positives = 219/252 (86%), Gaps = 1/252 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EKLYKLND I VAVAGLTADAEILINTAR+ AQNYLK+YNE+IPVEILVRRLSD+KQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAG+DDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDN-GKIAQKIFKPQEIETLLN 239
           K+D+ V+ A +LA               +R+EF+TI K  N G++ QKIFKPQEI+ LL 
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KTGVTKKENDDE 251
           KTG++KK+ DDE
Sbjct: 241 KTGISKKDEDDE 252

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  401 bits (1030), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 195/247 (78%), Positives = 217/247 (87%), Gaps = 1/247 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EKLYKLND I VAVAGLTADAEILINTAR+ AQNYLKSYNE+IPVEILVRRLSD+KQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAG+DDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITK-LDNGKIAQKIFKPQEIETLLN 239
           KDD+ V++A +LA               +R+EF+TI K  ++G++ QKIFKPQEI+ LL 
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 240 KTGVTKK 246
           KTG+TKK
Sbjct: 241 KTGITKK 247

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  397 bits (1021), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 195/251 (77%), Positives = 217/251 (86%), Gaps = 1/251 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGT IG+M  DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S EKLYKLND ITVAVAGLTADAEILINTAR+ AQNYLK+YNE+IPVEILVRRLSD+KQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDN-GKIAQKIFKPQEIETLLN 239
           KDD+ ++EA ELA               +++EF+TI K  N G++ QKI+KP EI+ LL 
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 240 KTGVTKKENDD 250
           KTGVTKK++D+
Sbjct: 241 KTGVTKKKDDE 251

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  391 bits (1005), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 188/251 (74%), Positives = 217/251 (86%), Gaps = 1/251 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIGV+A+DGIV+AAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EKLY+LND I VAVAGLTADAEILINTAR+  QNYLK+Y E+IPVE+LV+R+SD+KQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFG SFIYAG DDRYG+QLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITK-LDNGKIAQKIFKPQEIETLLN 239
           KD+IT+EEATELA               +RVEFSTI +  + G++ QKI+KP EI+ LL 
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 240 KTGVTKKENDD 250
           K+G+TKK+ +D
Sbjct: 241 KSGITKKDAED 251

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  389 bits (1000), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 215/247 (87%), Gaps = 1/247 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DG+VLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EKLYKLND ITVAVAGLTADAEILINTAR++AQ+YLK+YNEEIPVEILVRRLSD+KQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITK-LDNGKIAQKIFKPQEIETLLN 239
           KD++ +++A ELA               +++E +TI K     ++ QKI+KP+E++ LL 
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 240 KTGVTKK 246
           KTG+TKK
Sbjct: 241 KTGITKK 247

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  389 bits (999), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/252 (74%), Positives = 217/252 (86%), Gaps = 1/252 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+M  +GIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           +S+EKLYKLND  TVAVAGLTADAEILINTAR+ AQNYLK+YNEEIPVE+LVR+LSD+KQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GYTQ+GGLRP+G SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKL-DNGKIAQKIFKPQEIETLLN 239
           KD++T+++A ELA               +R+EF+T+ K  +  +  QKIFKP EI+ LL 
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 240 KTGVTKKENDDE 251
           KTG++KK ++DE
Sbjct: 241 KTGISKKSDEDE 252

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  367 bits (942), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 181/253 (71%), Positives = 206/253 (81%), Gaps = 2/253 (0%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGT+IG+M+KDGIVL AERK+TSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
             +EKLYKL+D IT+AVAGLTADAEILIN AR FAQNYL +YNEEIPVEILV++LSD+KQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFG SFIYAGYDD  G QLYTSNPSGNY+GWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTIT--KLDNGKIAQKIFKPQEIETLL 238
           KDD+ + +A EL                +RVE S I   K ++ KI QKI+ P EI+ LL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 239 NKTGVTKKENDDE 251
            K G+ KK ++DE
Sbjct: 241 IKFGINKKNDEDE 253

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 87/225 (38%), Positives = 132/225 (58%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIGV   +G+VL  E++VTS LLE G S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLE-GDSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + ++  ++  A++GLTADA  +I  AR+ A  +   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                +  + S++TK D  K+
Sbjct: 187 WHSSLTLKEA-ELLVLRILKQVMEEKLDEDNAQLSSVTKEDGFKV 230

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  149 bits (376), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 113/176 (64%), Gaps = 1/176 (0%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K+++++ ++ AGL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFG S + AG+D R    +LY + PSG YS W A S+G N++  +  L+ +Y
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNY 179

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  149 bits (375), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 113/179 (63%), Gaps = 1/179 (0%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+G+  KD +V+  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++ ++ ++ AGL AD+ ILI  AR+ AQ++  +  + + V+ L R ++ V+Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGASFIYAGYDDR-YGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNYARD 182

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  148 bits (374), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 119/191 (62%), Gaps = 4/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+GV  K+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDITVEEATEL 192
              TVEE  +L
Sbjct: 184 PPATVEECVKL 194

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 118/191 (61%), Gaps = 4/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+GV   + +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++++I ++ +GL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFG S + AG D R    +LY + PSG YS W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNKDE 183

Query: 184 --ITVEEATEL 192
              TVEE  +L
Sbjct: 184 PPSTVEECVKL 194

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 119/191 (62%), Gaps = 4/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+GV  K+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDITVEEATEL 192
              TVEE  +L
Sbjct: 184 PPATVEECVKL 194

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  148 bits (374), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 145/258 (56%), Gaps = 16/258 (6%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLE-ADSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + ++  ++  A++GLTADA  +I  AR+ A N+   Y+E++ VE L + + D+     +G
Sbjct: 67  IVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYDD  GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITK------LDNGKIAQKIFKPQE 233
           +   +T+ EA E+                   + S ITK       DN K A+ I + +E
Sbjct: 187 WHSSLTLREA-EVLVLKILKQVMEEKLDENNAQLSCITKDNGFQIYDNAKTAEIIKEMKE 245

Query: 234 IETLLNKTGVTKKENDDE 251
            ET  +  G  ++E+D E
Sbjct: 246 KETQEHPEG--EEEHDVE 261

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  148 bits (373), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 119/191 (62%), Gaps = 4/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+GV  K+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDITVEEATEL 192
              TVEE  +L
Sbjct: 184 PPATVEECVKL 194

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  147 bits (372), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 113/179 (63%), Gaps = 1/179 (0%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+G+  KD +V+  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++ ++ ++ AGL AD+ ILI  AR+ AQ++  +  + + V+ L R ++ V+Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGASFIYAGYDDR-YGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYVRD 182

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 116/191 (60%), Gaps = 4/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --ITVEEATEL 192
               VEE   L
Sbjct: 184 PPKNVEECVRL 194

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 117/191 (61%), Gaps = 4/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++      +G+   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++++I ++ +GL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYDRDE 183

Query: 184 --ITVEEATEL 192
              T EE  +L
Sbjct: 184 PPSTAEECIKL 194

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  146 bits (369), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 119/191 (62%), Gaps = 4/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+GV  K+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDITVEEATEL 192
              TVE+  +L
Sbjct: 184 PPATVEDCVKL 194

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  145 bits (367), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 118/190 (62%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+++A E+K TS L    S S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTESLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  +  +I  A +G+  D  +LI+ +R  A  +Y + YNE  P +ILV  ++ + Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AGYD+  GY LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  146 bits (368), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 112/177 (63%), Gaps = 2/177 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+G+  KD +VL  ER+ T KL +    + K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERRSTLKLQDTRVIASK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ ++ ++ AGL AD+ IL+N AR+ AQ++  +  + + VE + R ++ V+Q YTQ 
Sbjct: 64  VLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYTQS 123

Query: 126 GGLRPFGASFIYAGYDDR--YGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFG S + AG+D R     +LY + PSG YS W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNY 180

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  146 bits (368), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 115/189 (60%), Gaps = 1/189 (0%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+G+  K+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDI 184
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNREE 183

Query: 185 TVEEATELA 193
             E   E  
Sbjct: 184 PPENVDECV 192

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 130/225 (57%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIGV   +G+VL  E++VTS LLE G S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLE-GDSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + ++  ++  A++GLTADA  +I  AR+ +  +   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                   + S +TK D  K+
Sbjct: 187 WHSSLTLKEA-ELLVLKILKQVMEEKLDEGNAQLSCVTKEDGFKV 230

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 112/179 (62%), Gaps = 1/179 (0%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYA E++     A+G+  KD +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYD-DRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           GG+RPFG + + AG+D D    +LY + PSG YS W A ++G N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRD 182

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  144 bits (364), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     ++G+  +D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++++I ++ +GL AD+ ILI  AR+ AQ++  +  + + +E L R ++ V+Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYD-DRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           GG+RPFG S + AG+D +    +LY + PSG YS W A ++G N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYNKD 182

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  144 bits (364), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 114/188 (60%), Gaps = 3/188 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP G ++QVEYALE++      +GV   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K++ ++ ++ AGL AD+ ILI  AR+ AQ++  +  + + VE + R ++ V+Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDR-YGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY--KD 182
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKHN 183

Query: 183 DITVEEAT 190
             T EEA 
Sbjct: 184 PPTSEEAC 191

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  145 bits (365), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 131/225 (58%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+  ++G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLE-SDSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++++I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                   + S+ITK +  KI
Sbjct: 187 WHSSLTLKEA-ELLVLKILKQVMEEKLDESNTQLSSITKENGFKI 230

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  144 bits (364), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 87/225 (38%), Positives = 130/225 (57%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+  K+G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLE-SDSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQLY + PSG +  + A ++GA +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                   + S+ITK +  KI
Sbjct: 187 WHSSLTLKEA-ELLVLKVLKQVMEEKLDENNTQLSSITKDEGFKI 230

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  144 bits (363), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 111/176 (63%), Gaps = 1/176 (0%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP G ++QVEYALE++      +G+  +D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + ++++++ ++ AGL AD+ ILI  AR+ AQ++  +  + + VE + R ++ V+Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFG S + AG+D R    +LY + PSG YS W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNY 179

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  144 bits (363), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 118/191 (61%), Gaps = 4/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + +++ ++ ++ AGL AD+ ILI  AR+ AQ++  +  + + ++ L R ++ ++Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFG S + AG+D   G  +LY + PSG YS W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKEE 183

Query: 184 --ITVEEATEL 192
              T +EA +L
Sbjct: 184 PPATEQEAVKL 194

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  144 bits (362), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 120/190 (63%), Gaps = 7/190 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLE-SDSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ +I  A++GLTADA  +I  AR+ +  +   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEA 189
           +   +T++EA
Sbjct: 187 WYSSLTLKEA 196

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  144 bits (362), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 138/246 (56%), Gaps = 14/246 (5%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLE-ADSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + ++  +I  A++GLTADA  +I  AR+ A N+   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITK------LDNGKIAQKIFKPQE 233
           +   +T++EA EL                   + S +TK       D+ K A+ I + +E
Sbjct: 187 WHSSLTLKEA-ELLVLKILKQVMEEKLDESNAQLSCVTKENGFQIYDDAKTAEIIKELKE 245

Query: 234 IETLLN 239
            E   N
Sbjct: 246 KEVQEN 251

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  143 bits (361), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 135/238 (56%), Gaps = 10/238 (4%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     ++G+  ++ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + K+++++ ++ +GL AD+ ILI  AR+ AQ++  +  + I VE L R ++ V+Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYD-DRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFG S + AG+D +    +LY + PSG YS W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYDRNE 183

Query: 184 --ITVEEATELAXXXXXXXXXXXXXXPERVEF---STITKLDNGKIAQKIFKPQEIET 236
              TVEE  +L                E       S I  LDN +I + +   QEIET
Sbjct: 184 PPKTVEECVKLTVKSLLEVVQTGAKNIEITVVKPDSEILTLDNDEIDKYV---QEIET 238

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  143 bits (360), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 118/190 (62%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+V+A E+K +S L    + S 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDTLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  +Y + YNE  P ++LV  +++V Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AGYDD  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  142 bits (358), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 121/193 (62%), Gaps = 7/193 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIGV+  +GIVL  E++VTS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLES-DSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ +I  A++GLTADA  ++  AR+ A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + +  GYD   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATEL 192
           +   +T++EA  L
Sbjct: 187 WHSSLTLKEAESL 199

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  142 bits (358), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 120/190 (63%), Gaps = 7/190 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLES-DSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ +I  A++GLTADA  +I  AR+ A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEA 189
           +   +T++EA
Sbjct: 187 WHSSLTLKEA 196

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  142 bits (358), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 119/190 (62%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+V+A E+K  + L  +  + +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIK-DTLD 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFA-QNYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+ ++  +I    +G+  D  +LIN +R  A  +Y K+Y E  P +ILV +++ + Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  142 bits (358), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 116/191 (60%), Gaps = 4/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYA E++     A+G+  +D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ ++ ++ +GL AD+ ILI  AR+ AQ++  +  + + VE L R ++ V+Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFG + + AG+D +    +LY + PSG YS W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --ITVEEATEL 192
              T EE  +L
Sbjct: 184 PPATAEECVKL 194

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  142 bits (358), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 120/190 (63%), Gaps = 7/190 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLES-DSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ +I  A++GLTADA  +I  AR+ +  +   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEA 189
           +   +T++EA
Sbjct: 187 WYSSLTLKEA 196

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  142 bits (358), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 129/225 (57%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++ TS+LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLES-DSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + ++  +I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                  V+ S +TK +  KI
Sbjct: 187 WHSSLTLKEA-ELLVLKILKQVMEEKLNENNVQLSCVTKEEGFKI 230

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  141 bits (356), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 130/225 (57%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TA+G+   +G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLE-SDSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ ++  A++GLTADA  +I  AR+ A ++   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                   + S +TK D  KI
Sbjct: 187 WHSSLTLKEA-ELLVLKILKQVMEEKLDENNAQLSCVTKSDGFKI 230

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  141 bits (355), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 117/190 (61%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+V+A E+K +S L    + S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  L  +I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ + Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AGYD+  GY LY  +PSG+Y  WKA S+G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  140 bits (354), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 118/190 (62%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+V+A E+K  S L     + +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLT-DTLD 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFA-QNYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+ K+  +I    +G+  D  +LIN +R  A  +Y+K+Y E  P +ILV +++ + Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AGYD+   + LY  +PSG+Y  WKA ++G   +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  140 bits (354), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 122/193 (63%), Gaps = 7/193 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIGV+  +G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLE-SDSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ ++  A++GLTADA  ++  AR+ A  +   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATEL 192
           +   +T++EA +L
Sbjct: 187 WHSSLTLKEAEQL 199

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  140 bits (352), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 68/190 (35%), Positives = 119/190 (62%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+V+A E+K +S L    + S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  +Y + YNE  P ++LV  ++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  140 bits (353), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 126/225 (56%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLE-ADSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+E++ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
                    RPFG + + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                   + S+ TK D  KI
Sbjct: 187 WHSSLTLKEA-ELLVLKILKQVMEEKLDENNAQLSSTTKEDGFKI 230

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  139 bits (350), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 117/190 (61%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL +++   T+IG+ A +GIV+A E+K +S L    + S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ + Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  138 bits (348), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 127/225 (56%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+  K+G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLES-DSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                   + S ITK D  KI
Sbjct: 187 WHSSLTLKEA-ELLVLKILKQVMEEKLDENNAQLSCITKQDGFKI 230

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  138 bits (348), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 127/225 (56%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+  K+G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLES-DSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                   + S ITK D  KI
Sbjct: 187 WHSSLTLKEA-ELLILKILKQVMEEKLDENNAQLSCITKQDGFKI 230

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  138 bits (347), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 127/225 (56%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+  K+G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLES-DSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                   + S ITK D  KI
Sbjct: 187 WHSSLTLKEA-ELLVLKILKQVMEEKLDENNAQLSCITKEDGFKI 230

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  137 bits (346), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 116/190 (61%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ + +GIV+A E+K +S L    + S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDTVS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  +  +I    +G+  D  +L++ AR  A  NY + Y E  P +ILV  ++ + Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AG+D+  G+ LY  +PSG Y  WKA ++G  +SAA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  137 bits (345), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 110/181 (60%), Gaps = 1/181 (0%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +IFSP+G ++QVEYALE++     A+GV     +VL  ER+ T KL +  ++  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ ++ ++ AGL+ADA +LI  AR  AQ++  +  + + VE + R ++ ++Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDI 184
           GG+RPFG S + AG+D      +LY + PSG YS W A ++G N    +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNYAGES 183

Query: 185 T 185
           T
Sbjct: 184 T 184

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  137 bits (344), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 117/193 (60%), Gaps = 8/193 (4%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+V+A E+K +S L    + SE
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPL----AISE 59

Query: 65  KLYK---LNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQ 120
            L K   L  +I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ + Q
Sbjct: 60  TLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQ 119

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ GG+RPFG S + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  +
Sbjct: 120 EATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRW 179

Query: 181 KDDITVEEATELA 193
            D++ +E+A  +A
Sbjct: 180 NDELELEDAIHIA 192

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  137 bits (344), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 116/190 (61%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+++A E+K +S L    S S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTESLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  +Y + Y E  P +ILV  ++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AGYD+  GY LY  +PSG+Y  WKA ++G + +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  137 bits (344), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 127/225 (56%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+   +G++L  E++  S LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLE-ADSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+E I VE L + + D+     +G
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   +T++EA EL                   + S+ITK +  KI
Sbjct: 187 WHSSLTLKEA-ELLVLKILKQVMEEKLDENNAQLSSITKEEGFKI 230

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  136 bits (343), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 115/186 (61%), Gaps = 2/186 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YA  ++    T+IGV A +G+V+A E+K +S L     +  
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALT-ETLN 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+ ++  NI    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ + Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RP+GAS + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 ITVEEA 189
           + +E+A
Sbjct: 183 LELEDA 188

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  136 bits (343), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 68/190 (35%), Positives = 115/190 (60%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+V+A E+K TS  L    +  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKK-TSSPLAMSETLS 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  L  +I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ + Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  136 bits (343), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 83/225 (36%), Positives = 127/225 (56%), Gaps = 8/225 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+  K+G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLES-DSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFG + + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDITVEEATELAXXXXXXXXXXXXXXPERVEFSTITKLDNGKI 224
           +   ++++EA EL                   + S ITK D  KI
Sbjct: 187 WHSSLSLKEA-ELLILKILKQVMEEKLDENNAQLSCITKEDGFKI 230

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  135 bits (341), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 117/190 (61%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL +++   T++G+ A +G+V+A E+K +S L    + S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  NY + Y    P ++LV  ++ + Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  135 bits (340), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 117/193 (60%), Gaps = 8/193 (4%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+V+A E+K +S L    + SE
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPL----AMSE 59

Query: 65  KLYK---LNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQ 120
            L K   L  +I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ + Q
Sbjct: 60  TLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQ 119

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ GG+RPFG S + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  +
Sbjct: 120 EATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRW 179

Query: 181 KDDITVEEATELA 193
            D++ +E+A  +A
Sbjct: 180 NDELELEDAIHIA 192

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  135 bits (340), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 117/193 (60%), Gaps = 8/193 (4%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+V+A E+K +S L    + SE
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPL----AMSE 59

Query: 65  KLYK---LNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQ 120
            L K   L  +I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ + Q
Sbjct: 60  TLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQ 119

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ GG+RPFG S + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  +
Sbjct: 120 EATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRW 179

Query: 181 KDDITVEEATELA 193
            D++ +E+A  +A
Sbjct: 180 NDELELEDAIHIA 192

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  135 bits (340), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 68/190 (35%), Positives = 115/190 (60%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+++A E+K +S L      S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDIS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  L  +I    +G+  D  +L++ +R  A  NY + Y E    ++LV  ++ V Q  T
Sbjct: 63  KISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AG+D+  G+ LY  +PSG+Y  WKA S+G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  135 bits (340), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 115/190 (60%), Gaps = 2/190 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    T++G+ A +G+++A E+K +S L      S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDVS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  L  +I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ + Q  T
Sbjct: 63  KISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNNE 182

Query: 184 ITVEEATELA 193
           + +E+A  +A
Sbjct: 183 LELEDAIHIA 192

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  135 bits (339), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 8/196 (4%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YAL ++    TA+G+ A +G+VLA E+K  S  L    S +
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSS-LALAESLD 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  L  NI    AG+  D  +L++ AR  A  NY + Y E  P   LV  ++ + Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDD------RYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
           Q GG+RPFG S + AG+D+        G+ LY  +PSG Y  WKA +VG    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 MDYKDDITVEEATELA 193
             + D++ +E+A  +A
Sbjct: 183 KRWHDELELEDAVHIA 198

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  135 bits (339), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 114/193 (59%), Gaps = 7/193 (3%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++ TS LLE   S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLES-DSIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+E I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
                    RPFG + + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDITVEEATEL 192
           +   + + +A  L
Sbjct: 187 WHSSLNMRDAEVL 199

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  132 bits (332), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 115/189 (60%), Gaps = 2/189 (1%)

Query: 5   RFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           R+    T FSP G+L Q++YA  ++    T+IG+ A +G+V+A+E+K +S L    + S 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ + Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFG S + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  +  +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 ITVEEATEL 192
           + +E+A  +
Sbjct: 183 LELEDAIHI 191

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  123 bits (308), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 109/190 (57%), Gaps = 4/190 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA+++  +  T++G+  KDGIVLA E+ VTSKLL  G  ++K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLLVPG-KNKK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ ++  A +GL  D   L+N  R  A ++ K+Y   IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFG + I  G DD  G  LY   PSG Y G+K  + G    +A+  L+  +  K +
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELEKVISNKPE 185

Query: 184 ITVEEATELA 193
           +   EA + A
Sbjct: 186 LDAREAVKEA 195

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  120 bits (301), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 101/172 (58%), Gaps = 2/172 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ V+SKLL     + K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVP-KRNVK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ ++    +GL  D   L+N  R  AQ++ K++ E IP++ L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             +RPFG + I+ G DD+ G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELE 177

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  120 bits (301), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 107/190 (56%), Gaps = 4/190 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA +++ +  T+IG+   DG+V A E+ +TSKLL   + + K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVP-NKNLK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I V  +GL  D   L+N AR  +QN+ K Y   IPV+    R+    Q +T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFG + I+ G  D+ G  LY   PSG Y G+   + G     A+  L+  +D   +
Sbjct: 127 NSVRPFGVTAIFGGC-DKNGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELEKLLDKTPE 185

Query: 184 ITVEEATELA 193
           ++ +EA + A
Sbjct: 186 MSAKEAAKHA 195

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  119 bits (299), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 109/190 (57%), Gaps = 4/190 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T++G+  +DG+VLA E+ +TSKLL  G  ++K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLLVPG-KNKK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQM--DYKDD 183
             +RPFG + I+ G D   G  LY   PSG Y G+K+ + G    +A+  L+   +   +
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELEKLSNKNPN 185

Query: 184 ITVEEATELA 193
           +T  EA + A
Sbjct: 186 LTAREAVKEA 195

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  119 bits (299), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 106/191 (55%), Gaps = 5/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ +TSKLL     + K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVP-QKNVK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ K Y   IPV     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFG S I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+     + D
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDQHTD 185

Query: 183 DITVEEATELA 193
            +T +EA + A
Sbjct: 186 GLTAKEAVKQA 196

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  119 bits (299), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 107/191 (56%), Gaps = 5/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T++G+   DG+V A E+ ++SKLL     + K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVP-KRNVK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A N+ K Y + IPV  L  R+S   Q YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYK---D 182
             +RPFG S I  G D+  G  LY   PSG   G+K  + G    AA+  L+  +    D
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELEKLFDRSTD 185

Query: 183 DITVEEATELA 193
            ++V++A + A
Sbjct: 186 GLSVKDAIKEA 196

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  119 bits (298), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T+IG+  KDG+V A E+ +TSKLL     ++K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLLVP-HKNKK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ K Y + IP+     R+    Q +T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             +RPFG   I+ G D++ G  LY   PSG Y G++  + G    AA+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELE 177

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  119 bits (297), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 109/191 (57%), Gaps = 5/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T++G+   DG+V A E+ ++SKLL     + K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVP-KKNVK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  ++++ + Y++ IP+     R+    Q +T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY---KD 182
             +RPFG S I+ G DD  G  LY   PSG+Y G+K  + G+    A+T L+  +    D
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELEKLFDKNPD 185

Query: 183 DITVEEATELA 193
            ++  EA + A
Sbjct: 186 GLSAREAIKQA 196

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  119 bits (297), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 105/191 (54%), Gaps = 5/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ +TSKLL     + K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVP-QKNVK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ K YN  IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFG S I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+     +  
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDQHPQ 185

Query: 183 DITVEEATELA 193
            +T  EA + A
Sbjct: 186 GLTAREAVKQA 196

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  117 bits (294), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T+IG+  KDG+V A E+ + SKLL   S +EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLLVP-SKNEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ K Y + I +     R+    Q +T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             +RPFG   I+ G DD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELE 177

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  117 bits (292), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 108/190 (56%), Gaps = 4/190 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   +++SP+GR +QVEYA++++ +  T++G+  +DG+V A E+ VTSKLL  G  ++K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPG-KNKK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ K Y++ IPV     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFG + I+ G  D+ G  LY   PSG Y G+   + G    +A+  L+     K D
Sbjct: 127 NSVRPFGVTAIFGGV-DKDGAHLYMLEPSGTYWGYTGAATGKGRQSAKAELEKLATSKPD 185

Query: 184 ITVEEATELA 193
           ++  EA + A
Sbjct: 186 LSPREAVKEA 195

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  116 bits (291), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 106/191 (55%), Gaps = 5/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ +TSKLL    ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNT-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFG S I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+     + +
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDQHTE 185

Query: 183 DITVEEATELA 193
            +T  EA + A
Sbjct: 186 ALTAREAVKQA 196

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  116 bits (290), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 110/202 (54%), Gaps = 14/202 (6%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGS---- 61
           +D   ++FSP+GR +QVEYA +++ +  T++G++ +DG+VLA E+ V SKLL + S    
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 62  ---SSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDV 118
              ++ K+  +  +I  A +GL  D   L+N AR  +Q + + Y  +IP   L  R+   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQGYTQHGGLRPFGASFIYAGYDDRYGY-QLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
            Q +T +  +RPFG + I+ G D       LY   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

Query: 178 --MDYKDD----ITVEEATELA 193
             +  +DD     T+E   ELA
Sbjct: 188 KLISSRDDNSPITTLEAVKELA 209

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  116 bits (291), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ VTSKLL     + K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVP-KRNVK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D    +N  R  A N+ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             +RPFG + I+ G D+  G  LY   PSG Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  115 bits (287), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 103/195 (52%), Gaps = 5/195 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQ 59
           M +  +D   TIFSPEGRLYQVEYA ++ +     ++ +  K+ +VL  ++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  GSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK 119
            + S  ++ ++ +I +   G   DA  +    +  A  +   Y  +IPV +L +RL+++ 
Sbjct: 61  ATVS-YMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G    +   D+  G  ++  +P+G Y+G+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YKD---DITVEEATE 191
           +K    D   EE +E
Sbjct: 180 FKKLNVDCLQEETSE 194

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  116 bits (290), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ +TSKLL     + K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVP-QKNVK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             +RPFG S I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  115 bits (289), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ +TSKL+   + + K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVP-NKNIK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  + ++ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             +RPFG + I+ G D+  G  LY   PSG+Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  114 bits (285), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 103/191 (53%), Gaps = 5/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QVEYA +++ +  T+IG+  KDG+V A E+ +TSKLL     + K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVP-KKNVK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ K Y+  IP+     RL    Q +T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFG + I+ G D++ G  LY   PSG   G+   + G     A+  L+     + D
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELEKLADQHPD 185

Query: 183 DITVEEATELA 193
            +T  +A + A
Sbjct: 186 GLTTRDAVKYA 196

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  113 bits (282), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 95/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQ 59
           M +  +D   TIFSPEGRLYQVEYA ++ +     ++ +  K   VL  ++KV  KLLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  GSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK 119
            S+   L+ +  +I +   G  ADA  +    R  A  +   Y  ++PV +L +R +++ 
Sbjct: 61  -STVTYLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G    +   D+  G  ++  +P+G Y+G+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  113 bits (283), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 106/191 (55%), Gaps = 5/191 (2%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR +QV+YA++++ +  T+IG+  KDG+V A E+ VTSKLL     + K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVP-KKNVK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  + ++ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFG + I+ G D+  G  LY   PSG + G+K  + G     A+  L+     + +
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELEKLVDKHPE 185

Query: 183 DITVEEATELA 193
            +T  EA + A
Sbjct: 186 GLTGREAVKQA 196

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  110 bits (276), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEK 65
           +D   ++FSP+GR++QVEYA +++ +  T+IG+   DG+V A E+ ++SKLL     + K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVP-KKNVK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  + N+ K Y + I +     R+    Q YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             +RPFG S I+ G D   G  LY   P+G + G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELE 177

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  108 bits (271), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 102/193 (52%), Gaps = 6/193 (3%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +     L A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLK-SYNEEIPVEILVRRLSDVK 119
           S  +K+ K +D++ +++AGL  DA +L N  R    NY K  YN E+ +E +   LSD  
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHC-NYSKLVYNRELSMEKIGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+G   +  GY D+ G  L    PSGN       ++GA +  ++T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLVGY-DKSGPHLIEFQPSGNILELYGAAIGARSQGSRTYLERV 175

Query: 180 YKDDITVEEATEL 192
             D + VE+ATEL
Sbjct: 176 MDDFLPVEDATEL 188

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  108 bits (270), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 102/195 (52%), Gaps = 5/195 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQ 59
           M +  +D   TIFSPEGRLYQVEYA ++ +     +I + +K   V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  GSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK 119
            + S  ++ +  +I     G   DA  +    +  A  +   Y  +IP  +L +R++++ 
Sbjct: 61  KTVS-YIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G    +  YD+  G  ++  +P+G Y+G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 Y---KDDITVEEATE 191
           +   KDD   EE+ E
Sbjct: 180 FKKLKDDKIDEESWE 194

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  107 bits (266), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 98/189 (51%), Gaps = 2/189 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRLYQVEYA ++ +     +I +      V+  ++KV  KLL+  + S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++ ++  I +   G   DA+     A+     Y   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDI 184
              +RP G    +  YD+  G  +Y ++P+G Y G+KA + G       T L+  +K + 
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKND 190

Query: 185 TVEEATELA 193
             E+  E A
Sbjct: 191 VKEKINEDA 199

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  105 bits (262), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 99/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +KD  VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K ++++ +++AGL  DA +L N  R         YN ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDITVEEATEL 192
            D + + +ATEL
Sbjct: 177 DDYLAITDATEL 188

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  105 bits (261), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRLYQVEYA ++ +     ++ V  KD  V+ +++KV  KLL+  + S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYK 181
              +RP G    +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  104 bits (259), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 97/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQ 59
           M +  +D   TIFSPEGRLYQVEYA ++ +     +I +   D  V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  GSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK 119
            + S  L++++ ++ +   G   DA      A+  A  Y   Y  ++P ++L +R++++ 
Sbjct: 61  STMS-YLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G    +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  104 bits (259), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRLYQVEYA ++ +     ++ V  K+  V+ +++KV  KLL+  + S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPATVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYK 181
              +RP G    +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  103 bits (257), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 94/182 (51%), Gaps = 2/182 (1%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQ 59
           M +  +D   TIFSPEGRLYQVEYA ++ +     ++ +   D  V+  ++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  GSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK 119
            + S  L+ ++ +I +   G   DA      A+     Y   Y  ++P ++L +R++++ 
Sbjct: 61  STMS-YLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G    +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  103 bits (257), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRLYQVEYA ++ +     ++ +  K+  V+ +++KV  KLL+  + S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNTVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYK 181
              +RP G    +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  102 bits (255), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 100/192 (52%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +GV +K   VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K ++++ +++AGL  D  +L N  R         YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDDITVEEATEL 192
           +D + +++A +L
Sbjct: 177 QDYLELDDADDL 188

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score =  102 bits (255), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +GV +K   VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K ++++ +++AGL  D  +L N  R         YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDDITVEEATEL 192
            + + +E+  EL
Sbjct: 177 NEYLEIEDEDEL 188

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  103 bits (256), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRLYQVEYA ++ +     ++ V  K+  V+ +++KV  KLL+  + S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPTTVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYK 181
              +RP G    +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  103 bits (256), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 96/181 (53%), Gaps = 2/181 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGT-AIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRLYQVEYA ++ +     ++ V   +  V+  ++KV  KLL+  + S 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPSTVS- 71

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++ ++ ++ +   G   DA      A++ A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDI 184
              +RP G    +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K   
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFKKKT 191

Query: 185 T 185
           T
Sbjct: 192 T 192

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  103 bits (256), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 94/177 (53%), Gaps = 2/177 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRLYQVEYA ++ +     ++ V  K+  V+  ++KV  KLL+  + S 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPSTVS- 71

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++K++  I +   G   DA      A+  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYK 181
              +RP G    +   D+  G  +Y  +P+G Y G+KA + G       T L+  YK
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYK 188

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  103 bits (256), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 94/177 (53%), Gaps = 2/177 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRLYQVEYA ++ +     +I +   +  V+  ++KV  KLL+  + S 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAETVS- 71

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            +++++  I +   G   DA       +  A  +   Y  ++PV++L +R++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYK 181
              +RP G    +   D+  G  +Y S+PSG Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  102 bits (254), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 96/179 (53%), Gaps = 2/179 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRL+QVEYA ++ +     ++ V  ++  V+  ++KV  KLLE  S+  
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLE-ASTVS 71

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
              +RP G    +   D+  G  +Y ++P+G + G+KA + G       T L+  +K++
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNN 190

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  102 bits (254), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 94/173 (54%), Gaps = 2/173 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRLYQVEYA ++ +     ++ +  K+  V+ +++KV  KLL+  + S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++K++  I + + G   DA      A+     +   +  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
              +RP G    Y   D+  G  +Y S+P+G + G+KA + G       T L+
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLE 183

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  101 bits (252), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 98/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQ 59
           M +  +D   TIFSPEGRLYQVEYA ++ +     ++ +   + +V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  GSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK 119
            + S  ++K++ ++ +   G   DA      A+  A  +   Y  ++P ++L +R++++ 
Sbjct: 61  NTVS-YIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G    +   D+  G  +Y  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  100 bits (250), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 98/193 (50%), Gaps = 6/193 (3%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMA-KDGIVLAAERKVTSKLLEQ 59
           M    +D  T  FSP GRL+QVEYALE+I      +G+ + K  +V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNAD----EL 56

Query: 60  GSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK 119
            S  +K+ K +D++ V++AGL  DA +L N  R         YN ++ +E     LSD  
Sbjct: 57  SSYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+G   +  GYD+  G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERV 175

Query: 180 YKDDITVEEATEL 192
             D   +E+A EL
Sbjct: 176 LDDFREIEDADEL 188

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score =  100 bits (249), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 96/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +K   VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K ++++ +A+AGL  DA +L N  R         YN ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDITVEEATEL 192
              I +E+  EL
Sbjct: 177 DQFIEIEDPEEL 188

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score =  100 bits (248), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 99/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ ++  +VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K ++++ +++AGL  DA +L N  R         YN  + +      LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDITVEEATEL 192
           ++ + +E A EL
Sbjct: 177 EEYLKIETADEL 188

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  100 bits (249), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 98/200 (49%), Gaps = 13/200 (6%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRL+QVEYA ++ +     ++ V   D  V+  ++KV  KLL+  + S 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADTVS- 71

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++ ++  I +   G   DA       +  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ------- 177
              +RP G    +   D+  G  +Y S+PSG Y G+K  + G       T L+       
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFKKQK 191

Query: 178 ----MDYKDDITVEEATELA 193
                D+ D+ T E+  E A
Sbjct: 192 NPSKKDHYDEDTWEKVVEFA 211

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score = 98.2 bits (243), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 72/115 (62%), Gaps = 1/115 (0%)

Query: 80  LTADAEILINTARLFAQ-NYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYA 138
           +  D  +LI+ +R  A   Y + YNE  P +ILV  ++ + Q  TQ GG+RPFG S + A
Sbjct: 1   MGPDFRVLIDKSRKVAHTQYKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLVA 60

Query: 139 GYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           GYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D++ +E+A  +A
Sbjct: 61  GYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAIHIA 115

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score = 99.8 bits (247), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 98/193 (50%), Gaps = 6/193 (3%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMA-KDGIVLAAERKVTSKLLEQ 59
           M    +D  T  FSP GRL+QVEYALE+I      +G+ + K  +V+A +R       + 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNAD----DL 56

Query: 60  GSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVK 119
            S  +K+ K ++++ +++AGL  DA +L N  R         YN ++ VE +   L D  
Sbjct: 57  SSYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCDKA 116

Query: 120 QGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+G   +  GYD+  G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLEKT 175

Query: 180 YKDDITVEEATEL 192
            +  + VE+  EL
Sbjct: 176 LEQFLEVEDPNEL 188

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score = 99.4 bits (246), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +    VLAA ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K ++++ +++AGL  DA +L N  R         +N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 181 KDDITVEEATEL 192
            + + +E+  EL
Sbjct: 177 DNFVDLEDPEEL 188

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score = 99.0 bits (245), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 96/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K ++++ +A+AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGY-DKSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDITVEEATEL 192
              + +E+A EL
Sbjct: 177 DKFVEIEDAEEL 188

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score = 98.2 bits (243), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +K+  V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ + ++++ +++AGL  DA +L N  R         +N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVM 176

Query: 181 KDDITVEEATEL 192
              I +E+  EL
Sbjct: 177 DKYIEIEDPEEL 188

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score = 98.2 bits (243), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAGT-AIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRL+QVEYA ++ +     ++ +  +   V+  ++KV  KLL+  + S 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYK 181
              +RP G    +   D+  G  +Y S+P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFK 187

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score = 99.0 bits (245), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 99/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +   +VL A ++   +L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K +D++ +++AGL  DA +L N  R         Y  ++ V    + LSD  Q
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQ 190

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 191 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 249

Query: 181 KDDITVEEATEL 192
           ++ + +E+A  L
Sbjct: 250 EEYLEIEDADAL 261

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score = 95.9 bits (237), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +K   V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S   K+ K ++++ +++AGL  DA +L N  R         +N ++ +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDITVEEATEL 192
           ++ + +E+A EL
Sbjct: 177 EEYLEIEDADEL 188

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score = 96.3 bits (238), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 96/179 (53%), Gaps = 2/179 (1%)

Query: 6   FDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVMAKDGIVLAAERKVTSKLLEQGSSSE 64
           +D   TIFSPEGRL+QVEYA ++ +     ++ V  K+  V+  ++KV  KLL+  + S 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPATLS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQ 124
            ++ ++ ++ +   G   DA      A+  A  +   Y  ++P + L +R++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDD 183
              +RP G    +  +D+  G  +Y ++P+G + G+KA + G       T L+  +K +
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKN 189

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 95.5 bits (236), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 89/177 (50%), Gaps = 4/177 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K ++++ +++AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+G   +  GY D+ G  L    PSGN       S+GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTSIGARSQGAKTYLE 173

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 95.1 bits (235), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 89/177 (50%), Gaps = 4/177 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K +D++ +++AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+G   +  GY D+ G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLE 173

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score = 95.1 bits (235), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 90/177 (50%), Gaps = 4/177 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K ++++ +++AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+G   +  GY D+ G  L    PSGN +     ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLE 173

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score = 94.4 bits (233), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 94/178 (52%), Gaps = 6/178 (3%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+Q+EYA+E+I      +G+ +K+   + A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLK-SYNEEIPVEILVRRLSDVK 119
           S  +K+ K +D++ +++AGL  DA +L N  R    NY K  +N ++ VE     LSD  
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQC-NYSKLVFNRDLSVEKAGFLLSDKA 116

Query: 120 QGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
           Q  TQ  G RP+G   +  GY D+ G  L    PSGN       ++GA +  ++T L+
Sbjct: 117 QKNTQSYGGRPYGVGLLVVGY-DKTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLE 173

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 94.0 bits (232), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 89/177 (50%), Gaps = 4/177 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K ++++ +++AGL  DA +L N  R         +N ++ +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+G   +  GY D+ G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLE 173

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score = 93.6 bits (231), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 95/192 (49%), Gaps = 4/192 (2%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60
           M    +D  +  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120
           S  +K+ K + ++ +++AGL  DA +L N  R         ++ ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+G   +  GYD+  G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 181 KDDITVEEATEL 192
            D + ++   EL
Sbjct: 177 DDFLEIDNVEEL 188

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 88.6 bits (218), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 95/197 (48%), Gaps = 9/197 (4%)

Query: 1   MGSRRFDSRTTIFSPEGRLYQVEY-----ALESISHAGTAIGVMAKDGIVLAAERKVTSK 55
           M    +D  T  FSP GRL+QV+Y     ALE+I      +G+ +K   VL A ++   +
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRL 115
           L    S   K+ K ++++ +++AGL  DA +L N  R         +N ++ VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTL 175
            D  Q  TQ  G RP+G   +  G+ D+ G  L    PSGN       ++GA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGH-DKSGAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQMDYKDDITVEEATEL 192
           L+      + +E+  EL
Sbjct: 177 LERTLDTFLEIEDPNEL 193

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 59/113 (52%), Gaps = 3/113 (2%)

Query: 83  DAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDD 142
           D   L+N AR  A ++ K+Y   I +  L  RL    Q +T +  +RPFG + I  G D+
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ--MDYKDDITVEEATELA 193
             G  LY   PSG+Y G+K  + G    +A+  L+  +  K DI+ +EA + A
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKILSSKPDISAKEAVKEA 114

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 58.5 bits (140), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%)

Query: 102 YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWK 161
           Y  ++P ++L +R++++ Q YTQ   +RP G    +   D+  G  +Y S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISVGANTSAAQTLLQMDYK 181
           A + G       T L+  +K
Sbjct: 88  ATATGPKQQEITTNLENYFK 107

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 81/162 (50%), Gaps = 10/162 (6%)

Query: 34  TAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARL 93
           T +GV   DG+V+AA+ + T   +    +  KL++++  I  A AG  AD E +    +L
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV---TQL 87

Query: 94  FAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
              N  L S Y    P   +V  L  +KQ   ++ G    GA  I AG D   G  L++ 
Sbjct: 88  IGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSI 142

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           +  G+      +S+G+ + AA  +L+  +K D+T +EA +LA
Sbjct: 143 HAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAVKLA 184

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 82/162 (50%), Gaps = 10/162 (6%)

Query: 34  TAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARL 93
           T +GV  K+G+V+AA+ + T   +    +  KL++++  I  A AG  AD E +    +L
Sbjct: 31  TIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV---TQL 87

Query: 94  FAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
              N  L S Y    P   +V  L  +KQ   ++ G    GA  I AG D   G  L++ 
Sbjct: 88  IGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSI 142

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           +  G+      +S+G+ + AA  +L+  +K D+T +EA +LA
Sbjct: 143 HAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 81/162 (50%), Gaps = 10/162 (6%)

Query: 34  TAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARL 93
           T +GV   +G+V+AA+ + T   +    +  KL++++  I  A AG  AD E +    +L
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV---TQL 87

Query: 94  FAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
              N  L S Y    P   +V  L  +KQ   ++ G    GA  I AG D   G  L++ 
Sbjct: 88  IGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSI 142

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           +  G+      +S+G+ + AA  +L+  +K D+T EEA +LA
Sbjct: 143 HAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLA 184

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 83/162 (51%), Gaps = 10/162 (6%)

Query: 34  TAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARL 93
           T +GV   +G+V+AA+ + T   +    +  KL++++  I  A AG  AD E +    +L
Sbjct: 32  TIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV---TQL 88

Query: 94  FAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
              N  L S Y +  P   +V  L  +KQ   ++ G    GA  I AG D   G  L++ 
Sbjct: 89  IGSNVELHSLYAKRQPR--VVTALQMLKQHLFKYQG--HIGAYLIVAGTDPT-GAHLFSV 143

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
              G+      +S+G+ + AA  +L+ ++K+D++ EEA +LA
Sbjct: 144 QAHGSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAIKLA 185

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 82/162 (50%), Gaps = 10/162 (6%)

Query: 34  TAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARL 93
           T +G+  +DG+V+AA+ + T   +    +  KL++++  I  A AG  AD E +    +L
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV---TQL 88

Query: 94  FAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
              N  L S Y    P   +V  L  +KQ   ++ G    GA  I AG D   G  L++ 
Sbjct: 89  IGSNIELHSLYTSRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSI 143

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           +  G+      +S+G+ + AA  +L+  ++ +++ EEA ELA
Sbjct: 144 HAHGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAIELA 185

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 87/184 (47%), Gaps = 18/184 (9%)

Query: 20  YQVEYALESISHA--------GTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLND 71
           YQ    L S SHA         T +GV   +G+V+AA+ + T   +    +  KL++++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  NITVAVAGLTADAEILINTARLFAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLR 129
            I  A AG  AD E +    +L + N  L S Y    P   +V  L  +KQ   ++ G  
Sbjct: 69  RIWCAGAGTAADTEAV---TQLISSNLELHSLYASREPR--VVSALQMLKQHLFKYQG-- 121

Query: 130 PFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEA 189
             GA  I AG D   G  L++ +  G+       S+G+ + AA  +L+  +K D+T EEA
Sbjct: 122 HIGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDLTKEEA 180

Query: 190 TELA 193
             LA
Sbjct: 181 INLA 184

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 86/168 (51%), Gaps = 8/168 (4%)

Query: 27  ESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEI 86
           ++ S   T +GV  ++G+V+AA+ + T   +    + EKL+K++  I  A AG  AD + 
Sbjct: 24  QATSTGTTIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDA 83

Query: 87  LINTARLFAQNYLKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYG 145
           +  T  + +   L S +    P   +V  L  +KQ   ++ G    GA  I AG D   G
Sbjct: 84  V--TGLIGSNLELHSLFTGREPR--VVSALQKLKQHLFKYQG--HIGAYLIVAGVDPT-G 136

Query: 146 YQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
             L++ +  G+       S+G+ + AA  +L+ ++K+ +T EEA +LA
Sbjct: 137 AHLFSVHAHGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAIKLA 184

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 81/162 (50%), Gaps = 10/162 (6%)

Query: 34  TAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARL 93
           T +GV   +G+V+AA+ + T   +    +  KL++++  I  A AG  AD E +    +L
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV---TQL 87

Query: 94  FAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
              N  L S Y    P   +V  L  +KQ   ++ G    GA  I AG D   G  L++ 
Sbjct: 88  IGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSI 142

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           +  G+      +S+G+ + AA  +L+  +K D+T +EA +LA
Sbjct: 143 HAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 88/184 (47%), Gaps = 18/184 (9%)

Query: 20  YQVEYALESISHA--------GTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLND 71
           YQ    L + SHA         T +GV    G+V+AA+ + T   +    + EKL++++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  NITVAVAGLTADAEILINTARLFAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLR 129
            I  A AG  AD E +    +L   N  L S Y    P   +V  L  +KQ   ++ G  
Sbjct: 69  RIWCAGAGTAADTEAV---TQLIGSNIELHSLYTNREPR--VVSALQMLKQHLFKYQG-- 121

Query: 130 PFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEA 189
             GA  I AG D   G  L++ +  G+       S+G+ + AA  +L+ ++K +++ EEA
Sbjct: 122 HVGAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSREEA 180

Query: 190 TELA 193
            ELA
Sbjct: 181 IELA 184

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 81/169 (47%), Gaps = 10/169 (5%)

Query: 27  ESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEI 86
           ++ S   T +GV    G+V+AA+ + T   +    +  KL++++  I  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTE- 82

Query: 87  LINTARLFAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRY 144
                +L   N  L S Y    P   +V  L  +KQ   ++ G    GA  I AG D   
Sbjct: 83  --EVTKLIGSNLELHSLYASRAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT- 135

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           G  L++ +  G+       S+G+ + AA  +L+  +K+DI  EEA +LA
Sbjct: 136 GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAMQLA 184

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 86/183 (46%), Gaps = 16/183 (8%)

Query: 20  YQVEYALESISH--------AGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLND 71
           YQ    L S SH          T +GV    G+V+AA+ + T   +    +  KL++++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  NITVAVAGLTADAEILINTARLFAQNY-LKSYNEEIPVEILVRRLSDVKQGYTQHGGLRP 130
            I  A AG  AD E +    +L + N  L S +      + V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV---TQLISSNIELHSLSTRREPRV-VTTLQMLKQHLFRYQG--H 122

Query: 131 FGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEAT 190
            GA  I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ DI+ +EA 
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKDEAI 181

Query: 191 ELA 193
           ELA
Sbjct: 182 ELA 184

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 84/173 (48%), Gaps = 11/173 (6%)

Query: 24  YALESISHAGTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTA 82
           YA    +  GT I GV  K G+V+AA+ + T   +    +  KL+++   I  A AG  A
Sbjct: 20  YAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAA 79

Query: 83  DAEILINTARLFAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGY 140
           D E +    +L   N  L S Y E  P   +V  L  +KQ   ++ G    GA  I AG 
Sbjct: 80  DTEAV---TQLIGSNIELHSLYTERAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGV 132

Query: 141 DDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           D   G  L++ +  G+       ++G+ + AA  +L+  +K D++ E+A +LA
Sbjct: 133 DPT-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAIKLA 184

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 79/166 (47%), Gaps = 18/166 (10%)

Query: 34  TAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARL 93
           T +GV   +G+++AA+ + T   +    +  KL+++   I  A AG  AD E +    +L
Sbjct: 31  TIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAV---TQL 87

Query: 94  FAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDR----YGYQ 147
              N  L S Y    P   +V  L  +KQ   ++ G    GA  I AG D      +  Q
Sbjct: 88  VGSNLELHSLYTHREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPTGPHLFAVQ 143

Query: 148 LYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            + S   G Y      S+G+ + AA  +L+ ++K D+T EEA +LA
Sbjct: 144 AHGSTDVGFYH-----SLGSGSLAAMAVLETNWKQDLTKEEAMKLA 184

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 83/170 (48%), Gaps = 10/170 (5%)

Query: 26  LESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAE 85
           +++ S   T +GV    G+V+AA+ + T   +    +  KL++++  I  A AG  AD E
Sbjct: 23  VKATSTGTTIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTE 82

Query: 86  ILINTARLFAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDR 143
            +    +L   N  L S Y    P   +V  L  +KQ   ++ G    GA  I AG D  
Sbjct: 83  AV---TQLIGSNIELHSLYTNRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT 135

Query: 144 YGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            G  L++ +  G+       S+G+ + AA  +L+  +K D+T EEA +LA
Sbjct: 136 -GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAIQLA 184

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 80/162 (49%), Gaps = 10/162 (6%)

Query: 34  TAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARL 93
           T +GV    G+V+AA+ + T   +    +  KL+++   I  A AG  AD E +    +L
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAV---TQL 87

Query: 94  FAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
              N  L S Y+   P   +V  L  +KQ   ++ G    GA  I AG D   G  L++ 
Sbjct: 88  IGSNIELHSLYSNREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSI 142

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           +  G+       S+G+ + AA  +L+ ++K D+T EEA +LA
Sbjct: 143 HAHGSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAIKLA 184

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 80/162 (49%), Gaps = 10/162 (6%)

Query: 34  TAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARL 93
           T +GV    G+++AA+ + T   +    + EKL+++   I  A AG  AD E +    +L
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAV---TQL 88

Query: 94  FAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
            + N  L S Y    P   +V  L  +KQ   ++ G    GA  I AG D   G  L++ 
Sbjct: 89  ISSNIELHSLYTGREPR--VVSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSI 143

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           +  G+       S+G+ + AA  +L+ ++  D++ EEA +LA
Sbjct: 144 HAHGSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAIKLA 185

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 71/153 (46%), Gaps = 6/153 (3%)

Query: 32  AGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           AGT +G+  +D  VLA + + T+          K++   DNI ++  G  AD + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
           +   + Y   +N+++ ++   R +  +  G      + P+    I AG D+     +Y+ 
Sbjct: 91  KNSMKWYRFDHNKKMTIKSAARSIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
           +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 179

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 76/160 (47%), Gaps = 6/160 (3%)

Query: 34  TAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARL 93
           T +GV    G+V+AA+ + T   +    +  KL+++   I  A AG  AD E +      
Sbjct: 31  TIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  FAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNP 153
             + + +  N E  V   V  L  +KQ   ++ G    GA  I AG D   G  L++   
Sbjct: 91  NLELHSQYANREPRV---VSALQMLKQHLFRYQG--HIGAYLIVAGVDPT-GAHLFSVQA 144

Query: 154 SGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            G+      +S+G+ + AA   L+ ++K ++T +EA +LA
Sbjct: 145 HGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAVKLA 184

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 88/185 (47%), Gaps = 19/185 (10%)

Query: 20  YQVEYALESISHA---------GTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLN 70
           YQ   AL + SH+          T +GV   +G+++AA+ + T   +    +  KL++++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DNITVAVAGLTADAEILINTARLFAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGL 128
             I  A AG  AD E +    +L   N  L S Y    P   +V  L  +KQ   ++ G 
Sbjct: 69  PRIWCAGAGTAADTEAV---TQLIGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG- 122

Query: 129 RPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEE 188
              GA  I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ +++ E 
Sbjct: 123 -HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSKEA 180

Query: 189 ATELA 193
           A ELA
Sbjct: 181 AVELA 185

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 81/169 (47%), Gaps = 10/169 (5%)

Query: 27  ESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEI 86
           ++ S   T +GV    G+++AA+ + T   +    +  KL++++  I  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTE- 82

Query: 87  LINTARLFAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRY 144
                +L   N  L S Y    P   +V  L  +KQ   ++ G    GA  I AG D   
Sbjct: 83  --EVTKLIGSNLELHSMYASREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGADPT- 135

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           G  L++ +  G+       S+G+ + AA  +L+ +++ D+  EEA +LA
Sbjct: 136 GTHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAMQLA 184

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 31  HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +G+  +D  VLA + + T+          K+++  DNI ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYT 150
            +     Y  ++N+++ ++   R +  +  G      + P+    I AG D+     +Y+
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYSGWKAISVGANTSAAQTLL 176
            +P G+Y   +  + G+  S     L
Sbjct: 143 FDPVGSYEREQCRAGGSAASLIMPFL 168

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 85/199 (42%), Gaps = 23/199 (11%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLND 71
           +S E R   +E+     S + GT +G+  +D  VLA + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  NITVAVAGLTADAEILINTARLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRP 130
           NI ++  G  AD E L+   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSLKWYHFDHNDKKLAMSSAARNIQHLLYGKR----FFP 123

Query: 131 FGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKDD----- 183
           +    I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+      
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGT 183

Query: 184 ----------ITVEEATEL 192
                     +T+EEA +L
Sbjct: 184 DGKVKRPLKYLTIEEAIKL 202

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 75/174 (43%), Gaps = 15/174 (8%)

Query: 20  YQVEYALESISH--------AGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLND 71
           Y  E A + I H         GT +G+  +D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  NITVAVAGLTADAEILINTARLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRP 130
           NI ++  G  AD E L+   +   + Y   +N+ ++ ++   R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSIKWYHFDHNDKKLSIKSAARNIQHLLYGKR----FFP 123

Query: 131 FGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
           +    I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 82/209 (39%), Gaps = 16/209 (7%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNE---EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQL 148
           +   + Y   Y E   E+   I      + K   T         A  I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXP 208
           Y+    G+         G+ ++        ++K+D+T EE  E                 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETIEFMKHSLSQAIKWDGSSG 189

Query: 209 ERVEFSTITKLDNGKIAQKIFKPQEIETL 237
             +    +TK    ++   IF P E E L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPDEYEKL 215

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 82/209 (39%), Gaps = 16/209 (7%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNE---EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQL 148
           +   + Y   Y E   E+   I      + K   T         A  I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXP 208
           Y+    G+         G+ ++        ++K+D+T EE  E                 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETIEFMKHSLSQAIKWDGSSG 189

Query: 209 ERVEFSTITKLDNGKIAQKIFKPQEIETL 237
             +    +TK    ++   IF P E E L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPDEYEKL 215

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 68/154 (44%), Gaps = 7/154 (4%)

Query: 32  AGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
            GT +G+  +D  VLA + + T+          K++   DNI ++  G  AD E L+   
Sbjct: 29  GGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKRF 88

Query: 92  RLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYT 150
           +   + Y   +N+ ++ +    R +  +  G        P+    I AG DD     +Y+
Sbjct: 89  KNSIKWYHFDHNDKKLSISSAARNIQHLLYGKR----FFPYYVHTIIAGLDDEGKGAVYS 144

Query: 151 SNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
            +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 145 FDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 74/165 (44%), Gaps = 15/165 (9%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL K++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNE---EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQL 148
           +   + Y   Y E   ++   I      + K   T         A  I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGEPTTKVAASIFKTLCYENKDHLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTSA-AQTLLQMDYKDDITVEEATEL 192
           Y S P G     ++ S+  + SA        +YK+D+T EE  E 
Sbjct: 130 Y-SIPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETIEF 173

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 73/174 (41%), Gaps = 15/174 (8%)

Query: 20  YQVEYALESISH--------AGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLND 71
           Y  E A   I H         GT +G+  +D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  NITVAVAGLTADAEILINTARLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRP 130
           NI ++  G  AD E L+   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 68  NIVMSANGFAADGEALVKRFKNSVKWYHFDHNDKKLSLSSAARNIQHLLYGKR----FFP 123

Query: 131 FGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
           +    I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 77/178 (43%), Gaps = 16/178 (8%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLND 71
           +S E +   +E+     S + GT +G+  +D  VLA + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  NITVAVAGLTADAEILINTARLFAQNYLKSY-----NEEIPVEILVRRLSDVKQGYTQHG 126
           NI ++  G  AD E L+       QN LK Y     + ++ +    R +  +  G     
Sbjct: 88  NILISANGFAADGEALVKR----FQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKR--- 140

Query: 127 GLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
              P+    I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 141 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 197

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 78/174 (44%), Gaps = 8/174 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLND 71
           +S E     +E+A    + + GT +G+  +D  +LA + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  NITVAVAGLTADAEILINTARLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRP 130
           NI ++  G  AD E L+   +   + Y   +N+ ++ ++   R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR----FFP 123

Query: 131 FGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
           +    I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 124 YYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 90/225 (40%), Gaps = 23/225 (10%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLND 71
           +S E +   +E+     S + GT +G+  +D  VLA + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  NITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGG-LRP 130
           NI ++  G  AD   L+       QN LK Y+ +   + L  R +     +  +G    P
Sbjct: 69  NILISANGFAADGNALVKR----FQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKRFFP 124

Query: 131 FGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKDD----- 183
           +    I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+      
Sbjct: 125 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDS 184

Query: 184 ----------ITVEEATELAXXXXXXXXXXXXXXPERVEFSTITK 218
                     +TVEE  +L                + VE   +TK
Sbjct: 185 HGTKRKHVKFLTVEEVVQLVRDAFSSATERHIHVGDGVEILIVTK 229

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 72/158 (45%), Gaps = 15/158 (9%)

Query: 32  AGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
            GT +G+  +D  V+A + + T+       +  K++   DNI ++  G  AD + L+   
Sbjct: 29  GGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALVKKF 88

Query: 92  RLFAQNYLKSY-----NEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
           +    N LK Y     N+++ ++   R +  +  G      + P+    I AG D+    
Sbjct: 89  K----NNLKWYHFDHNNKKMTLKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEDGKG 140

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
            +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 141 AVYSFDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKN 178

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 69/154 (44%), Gaps = 7/154 (4%)

Query: 32  AGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
            GT +G+  +D  VLA + + T+       S  K++ + D I ++  G  AD+  L+   
Sbjct: 37  GGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGIVISANGFAADSTALVKRF 96

Query: 92  RLFAQNYLKSYNEE-IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYT 150
           R   + Y  + NE+ + +    R +  +  G        P+    I AG D+     +Y+
Sbjct: 97  RNSLKWYHFNENEKRLSLSAAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGKGAVYS 152

Query: 151 SNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
            +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 153 FDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 186

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 79/175 (45%), Gaps = 18/175 (10%)

Query: 20  YQVEYALESISH--------AGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLND 71
           YQ    L S SH          T +GV  + G+V+AA+ + T   +    + EKL+++  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  NITVAVAGLTADAEILINTARLFAQNY-LKS-YNEEIPVEILVRRLSDVKQGYTQHGGLR 129
            I  A AG  AD E +     L   N  L S Y    P   +V  L  +KQ   ++ G  
Sbjct: 69  RIWCAGAGTAADTEAV---TWLIGSNLELHSLYTGREPR--VVSALQKLKQHLFKYQG-- 121

Query: 130 PFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDI 184
             GA  I AG D   G  L++ +  G+    +  S+G+ + AA  +L+  +++ +
Sbjct: 122 HIGAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWREGM 175

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 83/209 (39%), Gaps = 16/209 (7%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T         ++KL +++D +    +G  AD + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNE---EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQL 148
           + +   Y   Y E        I  +   + K   T         A  I AGYD++   ++
Sbjct: 79  QYYLDLYTAQYGEPSTRTAAAIFQQLCYENKDALT---------AGIIVAGYDEKNQGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXP 208
           Y+    G+    K    G+ ++        +YKD +T +E  +                 
Sbjct: 130 YSIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETVDFIKHSLSQAIKWDGSSG 189

Query: 209 ERVEFSTITKLDNGKIAQKIFKPQEIETL 237
             +    +TK  NG + + I  P+E E L
Sbjct: 190 GVIRMVVLTK--NG-VERLIVYPEEFENL 215

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 69/158 (43%), Gaps = 15/158 (9%)

Query: 32  AGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
            GT +G+  +D  VLA + + T+          K++   DNI ++  G  AD   L+   
Sbjct: 29  GGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGFAADGTALVKR- 87

Query: 92  RLFAQNYLKSY-----NEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               QN LK Y     ++++ ++   R +  +  G        P+    I AG D+    
Sbjct: 88  ---FQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGKG 140

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
            +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 141 AVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +G+  +D  VLA + + T+          K++   DNI ++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGFAADGEALVKR 87

Query: 91  ARLFAQNYLKSYNEE-IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLY 149
            +   + Y    N++ + +    R +  +  G        P+    I AG D+     +Y
Sbjct: 88  FKNSIKWYHFDNNDKTLSLSSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGKGAVY 143

Query: 150 TSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 70/160 (43%), Gaps = 7/160 (4%)

Query: 31  HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +G+  +D  VLA + +  +          K++   DNI ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ ++   R +  +  G        P+    I AG D+     +Y
Sbjct: 87  FKNSIKWYHFDHNDKKLTMKSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKDDITVE 187
           + +P G+Y   +  + GA  S     L  Q+++K+    E
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPE 182

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    K GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELKEKNRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D+TVEEA  L 
Sbjct: 186 TIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLG 232

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    K GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D+TVEEA  L 
Sbjct: 186 TIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLG 232

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 62/147 (42%), Gaps = 5/147 (3%)

Query: 31  HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +G+  +D  VLA + + T+          K++   DNI +   G  AD E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+    I AG D+     +Y
Sbjct: 90  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYSGWKAISVGANTSAAQTLL 176
           + +P G+Y   +  + GA  S     L
Sbjct: 146 SFDPVGSYEREQCRAGGAAASLIMPFL 172

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/205 (19%), Positives = 81/205 (39%), Gaps = 15/205 (7%)

Query: 36  IGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARLFA 95
           + V  KDG++L A+ + T+        ++KL +++D +    +G  AD + + +  + + 
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADIVQHYL 60

Query: 96  QNYLKSYNE---EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSN 152
           + Y   + E   +    I      + K   T         A  I AG+DD+   ++Y+  
Sbjct: 61  ELYTAQFGEPSTKTAASIFKTLCYENKDNLT---------AGIIVAGFDDKNKGEVYSIP 111

Query: 153 PSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXPERVE 212
             G+    K    G+ ++        ++K+D+T +E                      + 
Sbjct: 112 LGGSVHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETISFMKNSLSQAIKWDGSSGGVIR 171

Query: 213 FSTITKLDNGKIAQKIFKPQEIETL 237
              +TK    ++   IF P+E E L
Sbjct: 172 MVVLTKEGAERL---IFYPEEYENL 193

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 69/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RLFAQNYLKSY---NEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQL 148
           +   + Y   Y   + E    +      + K   T         A  I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
           YT    G+         G+ ++        +++D+++ EE    
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETVNF 173

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 82/210 (39%), Gaps = 17/210 (8%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL ++ D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNE---EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY-Q 147
           +   + Y   + E   ++   I      D K   +         A  I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXX 207
           +Y+    G+    K    G+ ++        ++KDD+T +E                   
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETVNFMKHSLSQAIKWDGSS 189

Query: 208 PERVEFSTITKLDNGKIAQKIFKPQEIETL 237
              +    +TK     + + IF P E E L
Sbjct: 190 GGVIRMVVLTK---DGVERLIFYPDEYENL 216

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +G+  +D  VLA + +  +          K++   DNI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+    I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L AQ  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGAQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK ++ VEEA EL 
Sbjct: 186 TVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEALELG 232

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +G+  +D  VLA + +  +          K++   DNI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+    I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RLFAQNYLKSY---NEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQL 148
           +   + Y   Y   + E    +      + K   T         A  I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
           YT    G+         G+ ++        +++++++ EE  + 
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDF 173

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +G+  +D  VLA + +  +          K++   DN+ ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+    I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 69/161 (42%), Gaps = 15/161 (9%)

Query: 32  AGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
            GT +G+  +D  VLA + + T+          K++   D+I ++  G  AD E L+   
Sbjct: 28  GGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGFAADGEALVKRF 87

Query: 92  RLFAQNYLKSY-----NEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
           +    N +K Y     ++++ +    R +  +  G        P+    I AG D+    
Sbjct: 88  K----NSIKWYHFDNNDKKLALSSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGKG 139

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKDDIT 185
            +Y+ +P G+Y      + GA  S     L  Q+++K+  T
Sbjct: 140 AVYSFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKNQYT 180

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 72/169 (42%), Gaps = 12/169 (7%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRY 144
             L    RL   + LK   E I V    + LS++   Y   G         +  GY  + 
Sbjct: 132 TWLGTQCRL---HELKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D++VEEA  L 
Sbjct: 184 GPTIYYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEALYLG 232

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 70/167 (41%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYW- 128

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L AQ  L    E+  I V    + L ++   Y   G         +  GY  + G 
Sbjct: 129 -ETWLGAQCRLHELKEKERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGP 183

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D+TVEEA  L 
Sbjct: 184 TIYYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEALYLG 230

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 82/209 (39%), Gaps = 16/209 (7%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSY---NEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQL 148
           +   + Y   Y   + E    I      + K   T         A  I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAAAIFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXP 208
           YT    G+         G+ ++        +++++++ EE  +                 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSG 189

Query: 209 ERVEFSTITKLDNGKIAQKIFKPQEIETL 237
             +    +T+     + + IF P E E L
Sbjct: 190 GVIRMVVLTE---AGVERLIFYPDEYERL 215

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RLFAQNYLKSY---NEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQL 148
           +   + Y   Y   + E    +      + K   T         A  I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
           YT    G+         G+ ++        +++++++ EE  + 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDF 173

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 72/168 (42%), Gaps = 12/168 (7%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEI-- 86
           ++H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRY 144
             L    RL   + LK   E I V    + LS++   Y   G         +  GY  + 
Sbjct: 132 TWLGTQCRL---HELKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
           G  +Y  +  G         VG+  + A  +L  +YK D+TVEEA  L
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEALYL 231

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 83/210 (39%), Gaps = 17/210 (8%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL ++ D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNE---EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY-Q 147
           +   + Y   + E   ++   I      D K   +         A  I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXX 207
           +Y+    G+    K    G+ ++        +YK+++T +E  +                
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSTFIYGYCDKNYKENMTKDETVDFMKHSLSQAIKWDGSS 189

Query: 208 PERVEFSTITKLDNGKIAQKIFKPQEIETL 237
              +    +TK     + + IF P E E L
Sbjct: 190 GGVIRMVVVTK---DGVERLIFYPDEYENL 216

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D+TVE+A  L 
Sbjct: 186 TIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDALYLG 232

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 70/163 (42%), Gaps = 8/163 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    K GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFW- 127

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 128 -ETWLGSQCRLHELREKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGP 182

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEA 189
            +Y  +  G         VG+  + A  +L  +Y+ D++VEEA
Sbjct: 183 TIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEA 225

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/206 (19%), Positives = 80/206 (38%), Gaps = 15/206 (7%)

Query: 35  AIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARLF 94
           ++ V  KDG++L A+ + T+        ++KL ++++ I    +G  AD + + +  +  
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  AQNYLKSYNE---EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
              Y   Y E   +    +      + K   T         A  I AGYD++   ++Y+ 
Sbjct: 86  LDLYTAQYGEPSTKTAAAVFKELCYENKDNLT---------AGIIVAGYDEKNKGEVYSI 136

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXPERV 211
              G+    K    G+ ++        ++KDD+T +E                      +
Sbjct: 137 PLGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVNFMKNSLSQAIKWDGSSGGVI 196

Query: 212 EFSTITKLDNGKIAQKIFKPQEIETL 237
               +TK    ++   IF P++ E L
Sbjct: 197 RMVVLTKEGAERL---IFYPEDYEKL 219

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELKEKDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D+TVEEA  L 
Sbjct: 186 TVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLG 232

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 70/167 (41%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       +  K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYW- 129

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 130 -ETWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 184

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D+TV+EA  L 
Sbjct: 185 TVYYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEALYLG 231

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 68/161 (42%), Gaps = 7/161 (4%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  +DG++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
           + + + Y   Y E           S +      H       A  I AGYDD+   ++Y+ 
Sbjct: 79  QHYLELYTMQYGEP-SASTAASLFSTICYENKDH-----LTAGIIVAGYDDKNKGEVYSI 132

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
              G+         G+ ++         +++D++ EE  + 
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKHFREDMSKEETIDF 173

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 82/206 (39%), Gaps = 10/206 (4%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTS 151
           +     Y   Y E   V       S +   Y     L    A  I AGYDD+   ++YT 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTI--CYENKDFLT---AGIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXPERV 211
              G+         G+ ++        ++K++++ EE                      +
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETIRFMKHSLSQAIKWDGSSGGVI 192

Query: 212 EFSTITKLDNGKIAQKIFKPQEIETL 237
               +TK     + + IF P++ E+L
Sbjct: 193 RMVVLTK---EGVERLIFYPEDYESL 215

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYW- 128

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L AQ  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 129 -ETWLGAQCRLHELKEKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGP 183

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +Y+ D++VE+A  L 
Sbjct: 184 TIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDALYLG 230

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D++VE+A  L 
Sbjct: 186 TIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLG 232

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D++VE+A  L 
Sbjct: 186 TIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLG 232

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + ++       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L AQ  L    E+  I V    + L ++   Y  +G         +  GY  + G 
Sbjct: 131 -ETWLGAQCRLHELKEKERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D++VEEA  L 
Sbjct: 186 TVYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEALYLG 232

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 82/208 (39%), Gaps = 13/208 (6%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T         ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPF-GASFIYAGYDDRYGYQLYT 150
           +   + Y   Y   IP     R  + V Q        + F  A  I AG+DD+       
Sbjct: 79  QYHLEVYTSQYG--IPS---TRTAASVFQSLCYEN--KDFLSAGIIVAGFDDKSEKGEVY 131

Query: 151 SNPSGNYSGWKAISVGANTSA-AQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXPE 209
           S P G     +  ++  + SA        +YK D+T +E  E                  
Sbjct: 132 SIPLGGSIHKQPYAIAGSGSAFIYGYCDKNYKPDMTKDETVEFMKHSLSQAIKWDGSSGG 191

Query: 210 RVEFSTITKLDNGKIAQKIFKPQEIETL 237
            +    +TK     + + IF P++ E L
Sbjct: 192 VIRLVVLTK---SGVERLIFYPEDYENL 216

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELKEKSRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D+TV+EA  L 
Sbjct: 186 TIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEALYLG 232

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 12/169 (7%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 87  --LINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRY 144
             L +  RL   + LK   E I V    + L ++   Y   G         +  GY  + 
Sbjct: 131 TWLGSQCRL---HELKE-KERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D++VEEA  L 
Sbjct: 183 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEALYLG 231

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 67/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +G+  +D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARLFAQNYLKSYNE-EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+    I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYSGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 73/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRY 144
             L +  RL+    LK   + I V    + L+++   Y   G         +  GY  + 
Sbjct: 132 TWLGSQCRLYE---LKE-KQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D++VE+A  L 
Sbjct: 184 GPTVYYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDALYLG 232

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D++VE+A  L 
Sbjct: 186 TIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLG 232

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L +Q  L    E+  I V    + LS++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D+++E+A  L 
Sbjct: 186 TIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDALYLG 232

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 81/209 (38%), Gaps = 16/209 (7%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNE---EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQL 148
           +   + Y   Y E   +    +      + K   T         A  I AGYD++   ++
Sbjct: 79  QYHLELYDSQYGEPSTKTAASVFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXP 208
           Y+    G+         G+ ++        ++K+ +T EE  +                 
Sbjct: 130 YSIPLGGSIHKQNYAIAGSGSTFIYGYCDKNFKEGMTKEETIDFIKHSLSQAIKWDGSSG 189

Query: 209 ERVEFSTITKLDNGKIAQKIFKPQEIETL 237
             +    +TK     + + +F P E E L
Sbjct: 190 GVIRMVVLTK---DGVERLVFYPDEYENL 215

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 69/167 (41%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARLFAQNYLKSYNEE--IPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY 146
               L  Q  L    E+  I V    + L ++   Y   G         +  GY  + G 
Sbjct: 131 -ETWLGTQCRLHELKEKQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELA 193
            +Y  +  G         VG+  + A  +L  +YK D+T+E+A  L 
Sbjct: 186 TIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDALYLG 232

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++DNI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNE 104
           + +   Y   + E
Sbjct: 79  QYYLDMYEGQFGE 91

>KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 35.8 bits (81), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 70/163 (42%), Gaps = 8/163 (4%)

Query: 20  YQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAG 79
           Y   +  + I    + I +  KDG+++AA+R  +   L + S  E+L+ +  N  V ++G
Sbjct: 29  YPSMHTQQPIVTGTSVISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISG 88

Query: 80  LTADAEILINTARLFA--QNYLKSYNEE---IPVEILVRRLSDVKQGYTQHGGLRPFGAS 134
             +D + L N         NY   Y E+   +    +   L++V   Y +   + P   +
Sbjct: 89  DISDMQHLENLLDEMQTENNYDNEYAEDEEALKPSYVFEYLANVM--YNRRSKMNPLWNA 146

Query: 135 FIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ 177
            I AG +D   +  Y +     YS   +++ G     A  LL+
Sbjct: 147 LIVAGLEDGKPFLKYVNLLGVTYSA-PSLATGFGAHLALPLLR 188

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 35.8 bits (81), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 69/163 (42%), Gaps = 10/163 (6%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL K++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVAD-- 76

Query: 92  RLFAQNYLKSYNEEIPVEILVRRLSDVKQ-GYTQHGGLRPFGASFIYAGYDDRYGY-QLY 149
               Q +L  Y+ +          S  K   Y     L    A  I AG+DD     ++Y
Sbjct: 77  --IVQYHLDIYSTQFGTPSTKTAASVFKTLCYENKDNLT---AGIIVAGFDDATNKGEVY 131

Query: 150 TSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
           +    G+    K    G+ ++        ++KDD+T +E    
Sbjct: 132 SVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVHF 174

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/209 (18%), Positives = 84/209 (40%), Gaps = 16/209 (7%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  +DG++L A+ + T+        ++KL ++++ +    +G  AD + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNE---EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQL 148
           + + + Y   + E   +    I      + K   T         A  I AGYD++   ++
Sbjct: 79  QHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXP 208
           Y+    G+    K    G+ ++        +YK++++ +E                    
Sbjct: 130 YSIPLGGSVHKQKYAIAGSGSTFIYGYCDKNYKENMSKDETVSFMKNSLSQAIKWDGSSG 189

Query: 209 ERVEFSTITKLDNGKIAQKIFKPQEIETL 237
             +    +TK    ++   IF P++ E L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPEDYENL 215

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 83/211 (39%), Gaps = 19/211 (9%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++D +    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSY---NEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDD--RYGY 146
           + +   Y   Y   + +    +      + K   T         A  I AG+DD  + G 
Sbjct: 79  QYYLDLYTTQYGTPSTKTAASVFKTLCYENKDNLT---------AGIIVAGFDDDTKKG- 128

Query: 147 QLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXX 206
           ++Y+    G+    K    G+ ++        ++K+D+T +E                  
Sbjct: 129 EVYSVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETIHFIKHSLSQAIKWDGS 188

Query: 207 XPERVEFSTITKLDNGKIAQKIFKPQEIETL 237
               +    +T+     + + IF P E E L
Sbjct: 189 SGGVIRMVILTE---SGVERLIFYPDEYENL 216

>KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa]
           {ON} highly similar to uniprot|P06242 Saccharomyces
           cerevisiae YDL108W KIN28 Serine/threonine protein kinase
           subunit of the transcription factor TFIIH involved in
           transcription initiation at RNA polymerase II promoters
          Length = 310

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 50/96 (52%), Gaps = 13/96 (13%)

Query: 41  KDGIVLAAERKVTSKLLEQGSSSE-----KLYKLNDNITVAVAGLTADAEILI-NTARLF 94
           KDG+ ++A R+V  K L++           ++  NDN+ + +  L AD EI+I +T+ +F
Sbjct: 47  KDGLDMSALREV--KFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMF 104

Query: 95  AQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRP 130
           +   +KS+     + + +R +    + +  H  L+P
Sbjct: 105 SPADIKSW-----ILMTLRGVHHCHRNFILHRDLKP 135

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 82/208 (39%), Gaps = 13/208 (6%)

Query: 33  GTAI-GVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  V  KDG++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVAD-- 76

Query: 92  RLFAQNYLKSYNEEIPVEILVRRLSDVKQ-GYTQHGGLRPFGASFIYAGYDDRYGY-QLY 149
               Q +L+ Y  +     +    S  K   Y     L    A  I AG+DD+    ++Y
Sbjct: 77  --IVQYHLELYESQYGAPSIKTAASVFKSICYENKDNLS---AGIIVAGFDDKNEKGEVY 131

Query: 150 TSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXPE 209
           +    G+    K    G+ ++         +K+D+T +E                     
Sbjct: 132 SIPLGGSIHKQKYAIAGSGSTFIYGYCDKKFKEDMTKDETVNFIKHSLSQAIKWDGSSGG 191

Query: 210 RVEFSTITKLDNGKIAQKIFKPQEIETL 237
            +    +TK     + + IF P E E L
Sbjct: 192 VIRMVILTKEG---VERLIFYPDEYEKL 216

>Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 4   RRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIV 45
           RR++   T+  P+G LY V++A    +H G  +  +  DGI+
Sbjct: 96  RRWNKLCTLNDPKGSLYSVKFA---PAHLGLKLACLGNDGIL 134

>TBLA0E00150 Chr5 (19516..20313) [798 bp, 265 aa] {ON} Anc_3.574
           YFR050C
          Length = 265

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 79/171 (46%), Gaps = 16/171 (9%)

Query: 33  GTAIGVMA-KDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEIL---- 87
           GT++  M  K G+V+AA+   +   L + +  E+L K+  N  V V+G  +D + +    
Sbjct: 41  GTSVLAMKYKGGVVIAADNLASYGSLLRFNGIERLIKVGQNTVVGVSGDVSDMQHIERLL 100

Query: 88  --INTARLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYG 145
             I T   +   Y +S+ E++    + + LS V   Y++   + P   + I AG ++   
Sbjct: 101 EEIETDNNYDNTYSESF-EQLQPSYVFKYLSAVM--YSRRSKMNPLWNAIIVAGVENGAP 157

Query: 146 YQLYTSNPSGNYSGWKAISVGANTSAAQTLLQ--MDYKDDI---TVEEATE 191
           +  Y +     Y+    ++ G     A  L++  +D ++D+   T E A E
Sbjct: 158 FMRYVNLLGVTYTS-PTLATGFGAHLANPLMRRVVDREEDVANTTREAAVE 207

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 80/207 (38%), Gaps = 11/207 (5%)

Query: 33  GTAIGVMAKDG-IVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  DG ++L A+ + T+        ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY-QLYT 150
           +   + Y   Y     +E        +   Y     L    A  I AGYDD+    ++Y+
Sbjct: 79  QYHLELYTSQYGTP-SIETAAAVFKTLT--YENKDALS---AGIIVAGYDDKKKKGEVYS 132

Query: 151 SNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATELAXXXXXXXXXXXXXXPER 210
               G+    K    G+ ++        +Y++++  EE  E                   
Sbjct: 133 IPLGGSVHKQKYAIAGSGSAFIYGYCDKNYRENMNKEETVEFVKHSLSQAIKWDGSSGGV 192

Query: 211 VEFSTITKLDNGKIAQKIFKPQEIETL 237
           +    +T+     + + IF P E E L
Sbjct: 193 IRLVILTE---SGVERLIFYPDEYENL 216

>KLTH0F13750g Chr6 (1126220..1126807) [588 bp, 195 aa] {ON} highly
           similar to uniprot|P22141 Saccharomyces cerevisiae
           YER012W PRE1 20S proteasome beta-type subunit localizes
           to the nucleus throughout the cell cycle
          Length = 195

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 71/169 (42%), Gaps = 25/169 (14%)

Query: 36  IGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARLFA 95
           +G+  ++ ++LA  + VT  +    +  +K  +L++++ +A +G   DA       +   
Sbjct: 5   LGIRVQNTVILATSKAVTRGISVLKADDDKTRQLSEHVLMAYSGEAGDAVQFSEYIQANI 64

Query: 96  QNYLKSYNEEIPVEILVRRLSDVKQGYTQH-GGLRPFGASFIYAGYD-----------DR 143
           Q Y    N E+  + +    S V+Q   +     RP+  + +  GYD           D 
Sbjct: 65  QLYSIRENYELSPKAVS---SFVRQELAKSIRSRRPYQVNVLIGGYDAHQKKPELYQIDY 121

Query: 144 YGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
            G ++     +  YSG+   S          LL   Y+ D+TVEE  +L
Sbjct: 122 LGTKVELPYAAHGYSGFYTFS----------LLDHHYRPDMTVEEGLKL 160

>KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|P38236 YBR057C Saccharomyces
           cerevisiae MUM2 Cytoplasmic protein essential for
           meiotic DNA replication and sporulation
          Length = 316

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 63/127 (49%), Gaps = 15/127 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERK----VTSKLLEQGSS 62
           DSR +  S +GR  ++  +LESI H  +++ + AKD  +    R+    VT+  L   +S
Sbjct: 188 DSRVSSASQKGRTVEMPVSLESIFHKMSSV-IAAKDKELEETSRRLESIVTAIALNPSNS 246

Query: 63  SEKLYK-----LNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSD 117
             KL +     L   + V +  LT + +   + A++    Y +S  + I +E++ R   +
Sbjct: 247 VTKLGRYDEEALAHKMVVRLETLTKENQ---DMAKMLG--YGRSKEQHIELELIKRENQE 301

Query: 118 VKQGYTQ 124
           +K+  +Q
Sbjct: 302 LKRKLSQ 308

>TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa]
           {ON} Anc_2.618 YKL073W
          Length = 888

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 10/56 (17%)

Query: 111 LVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY-----QLYTSNPSGNYSGWK 161
           L++ L D K+    HGGL     +F  AGY+ +  +       Y SNP    SGW+
Sbjct: 697 LIKELEDAKE--VTHGGLASINETFNQAGYNSQQEFAKINLPHYISNP---LSGWQ 747

>NDAI0E03630 Chr5 complement(783559..784146) [588 bp, 195 aa] {ON}
           Anc_7.162 YER012W
          Length = 195

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 73/173 (42%), Gaps = 33/173 (19%)

Query: 36  IGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTAD----AEILINTA 91
           +G+  +D ++LA  + VT  +     S +K  +L+ +I ++ +G   D    AE +    
Sbjct: 5   LGIKVQDSVILATSKAVTRGISILKDSDDKTRQLSPHILMSFSGEAGDTVQFAEYIQANI 64

Query: 92  RLFAQNYLKSYNEEIPVEILVRRLSDVKQGYTQH-GGLRPFGASFIYAGYD--------- 141
           +L+A   ++   E  P  +     S V+Q   +     RP+ A+ +  G+D         
Sbjct: 65  QLYA---MREDYELSPHAV----SSFVRQELAKSIRSRRPYQANVLIGGFDTKKDTPGLY 117

Query: 142 --DRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
             D  G ++     +  YSG+   S          LL   Y+ D+T EE  +L
Sbjct: 118 QIDYLGTKVELPYAAHGYSGFYTFS----------LLDRHYRPDMTTEEGLKL 160

>KLLA0B11660g Chr2 complement(1024265..1024852) [588 bp, 195 aa]
           {ON} highly similar to uniprot|P22141 Saccharomyces
           cerevisiae YER012W PRE1 20S proteasome beta-type subunit
           localizes to the nucleus throughout the cell cycle
          Length = 195

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 69/171 (40%), Gaps = 29/171 (16%)

Query: 36  IGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARLFA 95
           +G+  KD ++LA+ + VT  +     S +K  +L  +  ++ +G   D        +   
Sbjct: 5   LGIRVKDSVILASSKAVTRGISILKDSDDKTRQLLPHTLMSFSGEAGDTVQFAEYIQANM 64

Query: 96  QNYLKSYNEEIPVEI---LVRRLSDVKQGYTQHGGLRPFGASFIYAGYD----------- 141
           Q YL   N E+        VR  +++ +        +PF  + +  GYD           
Sbjct: 65  QLYLIRENYELSPHAASSFVR--TELAKSLRSR---KPFQVNVLIGGYDTKNEKAELYQI 119

Query: 142 DRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
           D  G ++     +  Y+G+   S          LL   Y++D+TV+EA  L
Sbjct: 120 DYLGTKVELPYAAHGYAGFYTFS----------LLDRHYREDLTVDEALGL 160

>ZYRO0B03146g Chr2 complement(254858..255475) [618 bp, 205 aa] {ON}
           highly similar to uniprot|P25451 Saccharomyces
           cerevisiae YER094C PUP3 Beta subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit C10
          Length = 205

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 28  SISHAGTAIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEIL 87
           S  + G  + +  KD + +A + ++  + L   ++ EK++K   ++ + + GL  D   L
Sbjct: 5   STINGGVCVAMTGKDCVAIACDLRLGMQSLGVSNNFEKIFKYG-HVFLGLTGLATDVTTL 63

Query: 88  INTARLFAQNYLKSYNEEIPVE 109
             T R   +  L +  E+ P+E
Sbjct: 64  SETFRY--KTNLYNLKEDRPIE 83

>Skud_5.116 Chr5 (174986..175582) [597 bp, 198 aa] {ON} YER012W
           (REAL)
          Length = 198

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 70/164 (42%), Gaps = 15/164 (9%)

Query: 36  IGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTAD----AEILINTA 91
           +G+  +D ++LA+ + VT  +     S +K  +L+ +  ++ AG   D    AE +    
Sbjct: 5   LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANI 64

Query: 92  RLFAQNYLKSYNEEIP--VEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGY-QL 148
           +L++   ++   E  P  V   VR     K+        RP+  + +  GYD R    +L
Sbjct: 65  QLYS---IREDYELSPQAVSSFVR-----KELAKSIRSRRPYQVNVLIGGYDKRRNKPEL 116

Query: 149 YTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
           Y  +  G        + G +     +LL   Y+ D+T EE   L
Sbjct: 117 YQIDYLGTKVELPYGAHGYSGFYTFSLLDRHYRPDMTTEEGLNL 160

>AAR019W Chr1 (375421..376008) [588 bp, 195 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER012W (PRE1)
          Length = 195

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 68/159 (42%), Gaps = 5/159 (3%)

Query: 36  IGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARLFA 95
           +G+  +D ++LA  + VT  +    +  +K  +L+ +  ++ +G   DA       +   
Sbjct: 5   LGIRVQDSVILATSKAVTRGISVLKADDDKTRQLSPHSLMSFSGEPGDAVQFSEYIQANM 64

Query: 96  QNYLKSYNEEIPVEILVRRL-SDVKQGYTQHGGLRPFGASFIYAGYDDRY-GYQLYTSNP 153
           Q Y+   N E+  +     + S++ +        +PF  + +  GYD R    +LY  + 
Sbjct: 65  QLYMIRENYELSPQAQASYVRSELAKSLRSR---KPFQVNVLIGGYDTRAEKPELYQIDY 121

Query: 154 SGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
            G        + G +     +LL   Y+ D+T EE  +L
Sbjct: 122 LGTKVELPYAAHGYSGFYTFSLLDHHYRPDMTTEEGLKL 160

>Kwal_55.21028 s55 (654604..655191) [588 bp, 195 aa] {ON} YER012W
           (PRE1) - 22.6 kDa proteasome subunit [contig 135] FULL
          Length = 195

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 69/170 (40%), Gaps = 25/170 (14%)

Query: 35  AIGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARLF 94
            +G+  +D ++LA  + VT  +    S+ +K  +L+++  +A  G   D        +  
Sbjct: 4   VLGIRVQDTVILATSKAVTRGISILKSTDDKTRQLSEHTLMAYTGEAGDTVQFAEYVQAN 63

Query: 95  AQNYLKSYNEEIPVEILVRRLSDVKQGYTQHGGLR-PFGASFIYAGYD-----------D 142
            Q Y    N E+  + +    S V+Q   +    R P+  + +  GYD           D
Sbjct: 64  MQLYTIRENYELSPQAVS---SFVRQELAKSIRSRKPYQVNVLIGGYDIHKEKPELYQID 120

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
             G ++     +  YSG+   S          LL   Y+ D+T++E  +L
Sbjct: 121 YLGTKVELPYAAHGYSGFYTFS----------LLDRHYRPDMTLDEGLKL 160

>YER012W Chr5 (177835..178431) [597 bp, 198 aa] {ON}  PRE1Beta 4
           subunit of the 20S proteasome; localizes to the nucleus
           throughout the cell cycle
          Length = 198

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 72/170 (42%), Gaps = 27/170 (15%)

Query: 36  IGVMAKDGIVLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARLFA 95
           +G+  +D ++LA+ + VT  +     S +K  +L+ +  ++ AG   D    +  A  + 
Sbjct: 5   LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDT---VQFAE-YI 60

Query: 96  QNYLKSYNEEIPVEILVRRLSD-VKQGYTQH-GGLRPFGASFIYAGYD-----------D 142
           Q  ++ Y+     E+  + +S  V+Q   +     RP+  + +  GYD           D
Sbjct: 61  QANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQID 120

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDYKDDITVEEATEL 192
             G ++     +  YSG+   S          LL   Y+ D+T EE  +L
Sbjct: 121 YLGTKVELPYGAHGYSGFYTFS----------LLDHHYRPDMTTEEGLDL 160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,265,466
Number of extensions: 944238
Number of successful extensions: 2541
Number of sequences better than 10.0: 264
Number of HSP's gapped: 2305
Number of HSP's successfully gapped: 264
Length of query: 251
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 144
Effective length of database: 41,212,137
Effective search space: 5934547728
Effective search space used: 5934547728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)