Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G02354g3.500ON1401407152e-98
SAKL0F02508g3.500ON1401405271e-69
YPR153W3.500ON1401404514e-58
Smik_16.4053.500ON1391394463e-57
Suva_16.4813.500ON1391394453e-57
Skud_16.4473.500ON1401404402e-56
NCAS0F035903.500ON1401344306e-55
CAGL0L08382g3.500ON1401404245e-54
KLLA0E03895g3.500ON1401404212e-53
TDEL0D056803.500ON1401404202e-53
Kpol_480.93.500ON1411393984e-50
TBLA0C045203.500ON1401383969e-50
TPHA0A057103.500ON1411353952e-49
ZYRO0D09724g3.500ON1391283847e-48
KNAG0A079803.500ON1471373752e-46
KAFR0G037303.500ON1441323241e-38
AFR319W3.500ON1411223041e-35
Kwal_47.189033.500ON113462063e-21
Kpol_463.61.273ON65794780.060
KLTH0C04136g8.828ON31255643.4
KAFR0F033804.115ON90197635.8
KAFR0G011705.139ON78447626.0
KNAG0G028008.718ON82965627.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G02354g
         (140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...   280   2e-98
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   207   1e-69
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...   178   4e-58
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...   176   3e-57
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...   176   3e-57
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...   174   2e-56
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...   170   6e-55
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...   167   5e-54
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...   166   2e-53
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...   166   2e-53
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...   157   4e-50
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....   157   9e-50
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....   156   2e-49
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...   152   7e-48
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...   149   2e-46
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...   129   1e-38
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...   121   1e-35
Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...    84   3e-21
Kpol_463.6 s463 (13470..15443) [1974 bp, 657 aa] {ON} (13470..15...    35   0.060
KLTH0C04136g Chr3 complement(358455..359393) [939 bp, 312 aa] {O...    29   3.4  
KAFR0F03380 Chr6 (667933..670638) [2706 bp, 901 aa] {ON} Anc_4.1...    29   5.8  
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    28   6.0  
KNAG0G02800 Chr7 complement(619337..621826) [2490 bp, 829 aa] {O...    28   7.5  

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  280 bits (715), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA
Sbjct: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
           AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS
Sbjct: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120

Query: 121 AVVLILFHVSTTYSMAGIII 140
           AVVLILFHVSTTYSMAGIII
Sbjct: 121 AVVLILFHVSTTYSMAGIII 140

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  207 bits (527), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 121/140 (86%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           MKSFVT GDVP+GY TP FPSL+WP+NN++++LSYLYYT+DIW+FTV+WTLILF GFY +
Sbjct: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
           AGL AS SHRK A G+WIM FY++ GG QA+A+GTV GL++AV YKAGLF MSTW+PL  
Sbjct: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120

Query: 121 AVVLILFHVSTTYSMAGIII 140
           A++ ILF+VST+Y MAG+II
Sbjct: 121 ALMQILFNVSTSYLMAGVII 140

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score =  178 bits (451), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 104/140 (74%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           M+SFVT  D+P+GY TPKFPSL+WPINN +Y  ++LYY +DIWKF+++WTLI    FY  
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
           AG++AS++HRKKA  +WI   Y+L GG Q L  GTV G ++   Y++GLF MSTW+PLC 
Sbjct: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120

Query: 121 AVVLILFHVSTTYSMAGIII 140
           AVV ILF V  +YSM G ++
Sbjct: 121 AVVQILFDVVLSYSMVGSVM 140

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  176 bits (446), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 80/139 (57%), Positives = 102/139 (73%)

Query: 2   KSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAA 61
           +SFVT  D+P+GY TPKFPSL+WPINN RY  ++LYY +DIWKF+++WTLI    FY   
Sbjct: 1   RSFVTNNDIPVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVT 60

Query: 62  GLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSA 121
           GL+AS++HRKKA  LWI + Y++ GG Q L  GTV G ++   Y++GLF MSTWIPLC A
Sbjct: 61  GLYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 VVLILFHVSTTYSMAGIII 140
           VV ILF V   YSM G ++
Sbjct: 121 VVQILFDVVLGYSMVGSVM 139

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  176 bits (445), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 80/139 (57%), Positives = 103/139 (74%)

Query: 2   KSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAA 61
           +SF+T  D+P+GY TPKFPSL+WPIN+ RY  ++LYY +DIWKF+++WTLI    FY AA
Sbjct: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60

Query: 62  GLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSA 121
           GL+AS++HRKKA  +WI   Y+  GG Q L AGT+ G ++   Y++GLF MSTWIPLC A
Sbjct: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 VVLILFHVSTTYSMAGIII 140
           VV ILF V   YSM G I+
Sbjct: 121 VVQILFDVVLGYSMIGSIM 139

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score =  174 bits (440), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 78/140 (55%), Positives = 102/140 (72%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           M+SFVT  D+P+GY TPKFPSL+WPIN+ RY +++LYY +DIWKF+++WTLI    FY  
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
            GL+AS++HRKK   +WI   Y++ GG Q L  GTV G ++   Y++GLF MSTWIPLC 
Sbjct: 61  TGLYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCC 120

Query: 121 AVVLILFHVSTTYSMAGIII 140
           AVV ILF V   YSM G ++
Sbjct: 121 AVVQILFDVILGYSMIGSVM 140

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  170 bits (430), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 79/134 (58%), Positives = 96/134 (71%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           M+SF+T  D+PIGY TPKFPSL+WPINNK+Y +++LY  +DIWKFT++WTLI    FY A
Sbjct: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
           AGL AS SHR+   G+WIM  Y+   G Q LA GT+ G ++   Y AGLF MSTWIPLC 
Sbjct: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120

Query: 121 AVVLILFHVSTTYS 134
           AV  ILF V   YS
Sbjct: 121 AVAQILFDVIMAYS 134

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score =  167 bits (424), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 100/140 (71%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           MKSF+T  DVPIGY TP FPSL+WPIN++RY  ++LY+  DIWKFT++WT I    FY  
Sbjct: 1   MKSFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFYGG 60

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
           AGL+AS++H K+  GLWI   Y+L  G Q +  GTV G ++   Y++GLF MSTW+P+C 
Sbjct: 61  AGLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPMCC 120

Query: 121 AVVLILFHVSTTYSMAGIII 140
           AVV IL  V+ +YSM G I+
Sbjct: 121 AVVQILLDVTMSYSMVGSIM 140

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  166 bits (421), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 78/140 (55%), Positives = 103/140 (73%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           MK+F   GDVP+GY  P FPSL+WP+NN +++++YLYY  DIW+FT+FWT+ILF   Y  
Sbjct: 1   MKTFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGT 60

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
            G  A  +H+K   G W++  YI++G  QA  +GTV G+++A+ YKAGLF MSTWIPLC 
Sbjct: 61  TGAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCC 120

Query: 121 AVVLILFHVSTTYSMAGIII 140
           AVV ILF+VST+YSM   II
Sbjct: 121 AVVQILFNVSTSYSMTSPII 140

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score =  166 bits (420), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           M+SF+T  DVPIGY TP FPSL WPI+N +++L+ LY    IWKFT++W+LI    FY  
Sbjct: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
           AGLWAS SHR++A GLWIMA Y++ GG QA+AAGTV G ++   Y AGLF MSTWIP C 
Sbjct: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120

Query: 121 AVVLILFHVSTTYSMAGIII 140
            +V ILF  S +Y  +G I+
Sbjct: 121 VIVQILFDFSVSYLSSGTIM 140

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score =  157 bits (398), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 103/139 (74%)

Query: 2   KSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAA 61
            SF+T  D+P+GY  P FPSL+WPI++K+Y +SYLY T  IW+FTV+W++IL  GFY  +
Sbjct: 3   SSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLIS 62

Query: 62  GLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSA 121
           GL AS +HRK+A GLWIM  Y+ +G  Q +  GTVTG +++  Y +GLF MSTWIPLC A
Sbjct: 63  GLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCA 122

Query: 122 VVLILFHVSTTYSMAGIII 140
           +  +LF + +++S+ G+++
Sbjct: 123 ITQVLFDLCSSFSLGGMVM 141

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  157 bits (396), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 95/138 (68%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           MKSF+T  D+P+GY TP FPSL+WPINN++Y  S+LY T DIWKF+++W +IL   FY  
Sbjct: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
            G  A +SHR K   +WI+  Y+  G  Q + AGT+ G +++  Y +GLFEMSTWIP C 
Sbjct: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120

Query: 121 AVVLILFHVSTTYSMAGI 138
           AVV ILF V  ++ ++ +
Sbjct: 121 AVVQILFDVVQSFPISNL 138

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score =  156 bits (395), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%)

Query: 3   SFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAAG 62
           +F+T  D+P+GY TP FPSL+WPINN +Y  +YLY +  IW FTV+W+LIL   FY  AG
Sbjct: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63

Query: 63  LWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSAV 122
             A  +HRKK  G WI+A Y+++GG Q +  GT+ G I++ TY + LF MSTWIPLC AV
Sbjct: 64  ALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLCCAV 123

Query: 123 VLILFHVSTTYSMAG 137
             +LF V+T+YS+ G
Sbjct: 124 AQVLFEVTTSYSLVG 138

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score =  152 bits (384), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 70/128 (54%), Positives = 88/128 (68%), Gaps = 1/128 (0%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           M+SF+T  DVP+GY TP FPSL+WP    R +L  +Y  + IWKFT++W+LI   GFY  
Sbjct: 1   MRSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
            GLWAS SHRK+A GLWIMA Y   GG Q +A GT+TG ++   Y +GLF MSTWIP C 
Sbjct: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119

Query: 121 AVVLILFH 128
           AV  +L+ 
Sbjct: 120 AVAQVLYD 127

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score =  149 bits (375), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (67%)

Query: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60
           +++FV   ++P+GY TP FPSL+WPI+N+ Y+L++LY   DIWKFT++W LIL   FY  
Sbjct: 8   LRTFVANNEIPVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGT 67

Query: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120
           +GL A+ISH K    + I+  Y+L  G Q +  G + GL+L   Y+AGLF MSTWIPLC 
Sbjct: 68  SGLVATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCC 127

Query: 121 AVVLILFHVSTTYSMAG 137
           AV  ILF V  +YS  G
Sbjct: 128 AVAQILFDVVMSYSHVG 144

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score =  129 bits (324), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 87/132 (65%), Gaps = 1/132 (0%)

Query: 10  VPIGYTTPKFPSLFWPIN-NKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAAGLWASIS 68
           VPIGY TPKFPSL+WPI  ++ +  ++LY   DIWKFT++W+LI    FY +AG  A ++
Sbjct: 13  VPIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGAFYVSAGAVACLT 72

Query: 69  HRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSAVVLILFH 128
            +KK+  L I A Y + GG Q +  GTV G ++   Y+AGLF MS WIP+C AV  IL+ 
Sbjct: 73  TKKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWIPMCCAVAQILYD 132

Query: 129 VSTTYSMAGIII 140
           V  +YS  G I+
Sbjct: 133 VLVSYSTVGRIM 144

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score =  121 bits (304), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 79/122 (64%), Gaps = 1/122 (0%)

Query: 6   TIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAAGLWA 65
           + G+ P GY +P FPSL W  ++ R   + LYYT DI +FT+FWTLIL  G Y A GL A
Sbjct: 8   SFGNPPAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIA 66

Query: 66  SISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSAVVLI 125
             SHR+   G+ I+A Y+L+G   A+  GT +GLI A  Y+A L  MSTWIPL SAVV  
Sbjct: 67  GYSHRRITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLASAVVQA 126

Query: 126 LF 127
           L+
Sbjct: 127 LY 128

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR153W
           - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score = 84.0 bits (206), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 38/46 (82%), Positives = 43/46 (93%)

Query: 55  MGFYTAAGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLI 100
           MGFY AAGLWAS+SHR+ A GLWIMAFY+LVGGFQA+AAGTVTGL+
Sbjct: 1   MGFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46

>Kpol_463.6 s463 (13470..15443) [1974 bp, 657 aa] {ON}
           (13470..15443) [1974 nt, 658 aa]
          Length = 657

 Score = 34.7 bits (78), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 14/94 (14%)

Query: 12  IGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAAGLWASISHRK 71
           IGY   K+P+ F  I N+R  +           FTV +++ L  G    AGL++S+ H  
Sbjct: 189 IGYRLNKYPARFNLITNERAVMV----------FTVMFSVWLIWG----AGLFSSLLHIP 234

Query: 72  KASGLWIMAFYILVGGFQALAAGTVTGLILAVTY 105
              GL+     +L  GF  ++  TV   IL++ Y
Sbjct: 235 FCDGLYFSVVSLLTIGFGDISPNTVALRILSLVY 268

>KLTH0C04136g Chr3 complement(358455..359393) [939 bp, 312 aa] {ON}
           weakly similar to uniprot|Q03760 Saccharomyces
           cerevisiae YML107C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the nuclear periphery
          Length = 312

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 15  TTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAAGLWASISH 69
           T    P  +W   +K Y L++ YY  D+  +  F  +   +G Y  +G+   + H
Sbjct: 160 TERHVPGCYW--RSKTYNLAHNYYLTDVSLYLEFERINKELGKYKDSGVMPDVPH 212

>KAFR0F03380 Chr6 (667933..670638) [2706 bp, 901 aa] {ON} Anc_4.115
           YGL008C
          Length = 901

 Score = 28.9 bits (63), Expect = 5.8,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 40/97 (41%), Gaps = 5/97 (5%)

Query: 43  WKFTVFWTLILFMGFYTAAGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILA 102
           W     W + + +GF  A G W +++      G  I  F   + G   L        ++ 
Sbjct: 732 WNLPRLWGISIILGFLLAVGSWITLTTMFLPKGGIIQNFGS-IDGVMFLQISLTENWLIF 790

Query: 103 VTYKAGLF--EMSTWIPLCSAVVLILFHVSTTYSMAG 137
           VT  AG F   M +W    +  VL++  ++T + + G
Sbjct: 791 VTRAAGPFWSSMPSW--QLTGAVLVVDIIATMFCLFG 825

>KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.139
           YGR200C
          Length = 784

 Score = 28.5 bits (62), Expect = 6.0,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 66  SISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEM 112
           SI H K  +GL +  +   VGG   +AAG   G IL  TY++  FE+
Sbjct: 694 SIRHEKPVTGLSV--YDKTVGGKILVAAGLEDGNILIYTYQSDGFEL 738

>KNAG0G02800 Chr7 complement(619337..621826) [2490 bp, 829 aa] {ON}
           Anc_8.718 YOR270C
          Length = 829

 Score = 28.5 bits (62), Expect = 7.5,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 13/65 (20%)

Query: 63  LWA-SISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSA 121
           LWA S++H + +S LW M   I  G         V GL L V    GLF M  W  L   
Sbjct: 732 LWALSLAHNQLSSVLWTMTIQISFG---------VPGL-LGVCMTVGLFAM--WFVLTCC 779

Query: 122 VVLIL 126
           +++++
Sbjct: 780 ILVVM 784

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.141    0.464 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,621,234
Number of extensions: 569233
Number of successful extensions: 1753
Number of sequences better than 10.0: 40
Number of HSP's gapped: 1749
Number of HSP's successfully gapped: 40
Length of query: 140
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 42
Effective length of database: 42,244,131
Effective search space: 1774253502
Effective search space used: 1774253502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 60 (27.7 bits)