Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G00704g3.568ON61561531100.0
Kwal_47.192683.568ON61661722770.0
SAKL0F00770g3.568ON63662219970.0
TDEL0D063603.568ON58561318190.0
Ecym_25983.568ON60261518070.0
AFR265C3.568ON59161018050.0
ZYRO0E09548g3.568ON59260417960.0
KLLA0A00715g3.568ON59159217930.0
Smik_7.3683.568ON65967517910.0
Suva_12.93.568ON65967717580.0
NDAI0B062803.568ON60562317490.0
TBLA0E002103.568ON63162517510.0
Kpol_507.93.568ON60360817360.0
NCAS0F039703.568ON59760117270.0
CAGL0C01969g3.568ON61962617240.0
KNAG0D029603.568ON65165216900.0
TPHA0A060103.568ON62361815880.0
KAFR0J001703.568ON60762615820.0
YFR048W (RMD8)3.568ON66223611161e-144
Skud_6.1393.568ON66124411111e-143
YDL001W (RMD1)3.209ON4302304577e-50
Suva_4.2523.209ON4302304578e-50
Skud_4.2533.209ON4302304569e-50
Smik_4.2353.209ON4312304561e-49
NCAS0A101203.209ON4232334551e-49
SAKL0C11286g3.209ON4282304532e-49
Kwal_27.110013.209ON4082304462e-48
Kpol_1045.583.209ON4472334472e-48
NDAI0A073503.209ON5222364488e-48
TBLA0A001703.209ON5052274451e-47
KLTH0G16544g3.209ON4082304392e-47
TDEL0D041303.209ON4382304402e-47
Ecym_52933.209ON4772304389e-47
AEL004W3.209ON4752304371e-46
KNAG0K014903.209ON4052354321e-46
KAFR0F025003.209ON4662304352e-46
TPHA0P005503.209ON4462334332e-46
ZYRO0A04400g3.209ON4582284333e-46
CAGL0M10483g3.209ON4322024288e-46
KLLA0E17381g3.209ON4442064174e-44
YDR282C5.291ON4142431873e-14
Skud_4.5455.291ON4132351831e-13
Suva_2.4485.291ON4172541812e-13
Ecym_47435.291ON3662301784e-13
KLLA0C11165g5.291ON3562231774e-13
Smik_4.5315.291ON4142521768e-13
Kwal_23.56435.291ON3743001679e-12
KLTH0G06622g5.291ON3922431671e-11
SAKL0G10582g5.291ON3832291642e-11
TPHA0D017105.291ON3862331633e-11
AAL122C5.291ON3662421581e-10
Kpol_1033.65.291ON4032411572e-10
CAGL0H01045g5.291ON3611681553e-10
TDEL0E033605.291ON4052501463e-09
ZYRO0G16478g5.291ON4012291447e-09
KAFR0E015305.291ON3632361437e-09
Smik_13.744.334ON584152751.7
Kpol_1008.157.516ON57945751.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G00704g
         (615 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G00704g Chr7 complement(47865..49712) [1848 bp, 615 aa] {ON...  1202   0.0  
Kwal_47.19268 s47 (1163922..1165772) [1851 bp, 616 aa] {ON} YFR0...   881   0.0  
SAKL0F00770g Chr6 complement(66976..68886) [1911 bp, 636 aa] {ON...   773   0.0  
TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON} Anc_3...   705   0.0  
Ecym_2598 Chr2 (1162883..1164691) [1809 bp, 602 aa] {ON} similar...   700   0.0  
AFR265C Chr6 complement(910790..912565) [1776 bp, 591 aa] {ON} S...   699   0.0  
ZYRO0E09548g Chr5 (760326..762104) [1779 bp, 592 aa] {ON} simila...   696   0.0  
KLLA0A00715g Chr1 complement(69861..71636) [1776 bp, 591 aa] {ON...   695   0.0  
Smik_7.368 Chr7 (606969..608948) [1980 bp, 659 aa] {ON} YFR048W ...   694   0.0  
Suva_12.9 Chr12 complement(11366..13345) [1980 bp, 659 aa] {ON} ...   681   0.0  
NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON} Anc_3...   678   0.0  
TBLA0E00210 Chr5 complement(29729..31624) [1896 bp, 631 aa] {ON}...   679   0.0  
Kpol_507.9 s507 complement(53819..55630) [1812 bp, 603 aa] {ON} ...   673   0.0  
NCAS0F03970 Chr6 (796049..797842) [1794 bp, 597 aa] {ON} Anc_3.5...   669   0.0  
CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {...   668   0.0  
KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.5...   655   0.0  
TPHA0A06010 Chr1 (1359051..1360922) [1872 bp, 623 aa] {ON} Anc_3...   616   0.0  
KAFR0J00170 Chr10 complement(27714..29537) [1824 bp, 607 aa] {ON...   613   0.0  
YFR048W Chr6 (246146..248134) [1989 bp, 662 aa] {ON}  RMD8Cytoso...   434   e-144
Skud_6.139 Chr6 (241140..243125) [1986 bp, 661 aa] {ON} YFR048W ...   432   e-143
YDL001W Chr4 (447984..449276) [1293 bp, 430 aa] {ON}  RMD1Cytopl...   180   7e-50
Suva_4.252 Chr4 (445183..446475) [1293 bp, 430 aa] {ON} YDL001W ...   180   8e-50
Skud_4.253 Chr4 (439498..440790) [1293 bp, 430 aa] {ON} YDL001W ...   180   9e-50
Smik_4.235 Chr4 (427186..428481) [1296 bp, 431 aa] {ON} YDL001W ...   180   1e-49
NCAS0A10120 Chr1 (2022090..2023361) [1272 bp, 423 aa] {ON} Anc_3...   179   1e-49
SAKL0C11286g Chr3 complement(1012631..1013917) [1287 bp, 428 aa]...   179   2e-49
Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {...   176   2e-48
Kpol_1045.58 s1045 (139327..140670) [1344 bp, 447 aa] {ON} (1393...   176   2e-48
NDAI0A07350 Chr1 complement(1671549..1673117) [1569 bp, 522 aa] ...   177   8e-48
TBLA0A00170 Chr1 (16781..18298) [1518 bp, 505 aa] {ON} Anc_3.209...   176   1e-47
KLTH0G16544g Chr7 complement(1435479..1436705) [1227 bp, 408 aa]...   173   2e-47
TDEL0D04130 Chr4 (760040..761356) [1317 bp, 438 aa] {ON} Anc_3.2...   174   2e-47
Ecym_5293 Chr5 (595331..596764) [1434 bp, 477 aa] {ON} similar t...   173   9e-47
AEL004W Chr5 (630125..631552) [1428 bp, 475 aa] {ON} Syntenic ho...   172   1e-46
KNAG0K01490 Chr11 (310336..311553) [1218 bp, 405 aa] {ON} Anc_3....   171   1e-46
KAFR0F02500 Chr6 complement(484705..486105) [1401 bp, 466 aa] {O...   172   2e-46
TPHA0P00550 Chr16 complement(110346..111686) [1341 bp, 446 aa] {...   171   2e-46
ZYRO0A04400g Chr1 (359271..360647) [1377 bp, 458 aa] {ON} simila...   171   3e-46
CAGL0M10483g Chr13 complement(1049771..1051069) [1299 bp, 432 aa...   169   8e-46
KLLA0E17381g Chr5 complement(1540387..1541721) [1335 bp, 444 aa]...   165   4e-44
YDR282C Chr4 complement(1023511..1024755) [1245 bp, 414 aa] {ON}...    77   3e-14
Skud_4.545 Chr4 complement(966078..967319) [1242 bp, 413 aa] {ON...    75   1e-13
Suva_2.448 Chr2 complement(788042..789295) [1254 bp, 417 aa] {ON...    74   2e-13
Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {O...    73   4e-13
KLLA0C11165g Chr3 complement(957421..958491) [1071 bp, 356 aa] {...    73   4e-13
Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON...    72   8e-13
Kwal_23.5643 s23 complement(1249364..1250488) [1125 bp, 374 aa] ...    69   9e-12
KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} simila...    69   1e-11
SAKL0G10582g Chr7 (900403..901554) [1152 bp, 383 aa] {ON} simila...    68   2e-11
TPHA0D01710 Chr4 complement(356399..357559) [1161 bp, 386 aa] {O...    67   3e-11
AAL122C Chr1 complement(132431..133531) [1101 bp, 366 aa] {ON} S...    65   1e-10
Kpol_1033.6 s1033 complement(11719..12930) [1212 bp, 403 aa] {ON...    65   2e-10
CAGL0H01045g Chr8 complement(98818..99903) [1086 bp, 361 aa] {ON...    64   3e-10
TDEL0E03360 Chr5 (635665..636882) [1218 bp, 405 aa] {ON} Anc_5.2...    61   3e-09
ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]...    60   7e-09
KAFR0E01530 Chr5 complement(309332..310423) [1092 bp, 363 aa] {O...    60   7e-09
Smik_13.74 Chr13 (130954..132708) [1755 bp, 584 aa] {ON} YML070W...    33   1.7  
Kpol_1008.15 s1008 complement(26135..27874) [1740 bp, 579 aa] {O...    33   1.9  

>KLTH0G00704g Chr7 complement(47865..49712) [1848 bp, 615 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048W RMD8 Cytosolic protein required for sporulation
          Length = 615

 Score = 1202 bits (3110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/615 (95%), Positives = 589/615 (95%)

Query: 1   MQSSLGFQEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTY 60
           MQSSLGFQEGPGRRTSMSRRSPSILVTDARSSKKRIGAPF              EKSDTY
Sbjct: 1   MQSSLGFQEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFAGHAAGLRGGRAAREKSDTY 60

Query: 61  QGFSASSRGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREER 120
           QGFSASSRGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREER
Sbjct: 61  QGFSASSRGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREER 120

Query: 121 LSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQMERRRPL 180
           LSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQMERRRPL
Sbjct: 121 LSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQMERRRPL 180

Query: 181 KYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXXXXXXX 240
           KYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDE         
Sbjct: 181 KYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDECLYVPYCLP 240

Query: 241 XXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDT 300
              GKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDT
Sbjct: 241 LLPGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDT 300

Query: 301 AGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPY 360
           AGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPY
Sbjct: 301 AGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPY 360

Query: 361 MESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQ 420
           MESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQ
Sbjct: 361 MESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQ 420

Query: 421 DIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILG 480
           DIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILG
Sbjct: 421 DIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILG 480

Query: 481 TVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY 540
           TVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY
Sbjct: 481 TVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY 540

Query: 541 LAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICE 600
           LAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICE
Sbjct: 541 LAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICE 600

Query: 601 IIVRSFIIRQLKNSE 615
           IIVRSFIIRQLKNSE
Sbjct: 601 IIVRSFIIRQLKNSE 615

>Kwal_47.19268 s47 (1163922..1165772) [1851 bp, 616 aa] {ON} YFR048W
           - Hypothetical ORF [contig 344] FULL
          Length = 616

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/617 (74%), Positives = 506/617 (82%), Gaps = 9/617 (1%)

Query: 1   MQSSLGFQEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTY 60
           MQ+    QEGPGRRT MSRRSPSILVTDARS++ R GAPF              E  D  
Sbjct: 1   MQNPEDVQEGPGRRTVMSRRSPSILVTDARSNRNRNGAPFAGHAAGLQGGRSSKEGKDAL 60

Query: 61  QGFSA---SSRGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRR 117
              +A    +      +S S SDL P+RRS+AKLRQQGKFSDIS+DNILSD+SDVPSGRR
Sbjct: 61  SQRTAHVSRTSMRRSSSSGSSSDLMPLRRSKAKLRQQGKFSDISVDNILSDISDVPSGRR 120

Query: 118 EERLSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQMERR 177
           EERLS SS E +      S  QYTKLINPLP RTSKTSKKLVLIPE+ DRKN  +QMERR
Sbjct: 121 EERLSTSSQEWSSSRFGRS-AQYTKLINPLPSRTSKTSKKLVLIPEELDRKNGFVQMERR 179

Query: 178 RPLKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXXXX 237
            P K N++D + +EN  EE+SRITAYNVAEGF++   S FLR THDVSPRLYDE      
Sbjct: 180 WPRK-NKNDFENRENPSEELSRITAYNVAEGFDLDLVSKFLRNTHDVSPRLYDECLYVPY 238

Query: 238 XXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFEL 297
                 GKDGFR+KSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNN+EL
Sbjct: 239 CLPLLPGKDGFRLKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNYEL 298

Query: 298 SDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEE--GRDTDQSKNISAVGNR 355
           ++   KD +RND +PTPDHLP+  ++NTASFDPSEPQFFAE   G    +S N     +R
Sbjct: 299 NEVTNKDPDRNDVVPTPDHLPSVINSNTASFDPSEPQFFAEGAWGEHPAESSNDRPPHSR 358

Query: 356 SQNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIR 415
           + +P  E+ SL+ Y SSKQ+HAEIFIF YGVVVFWNFTEIQEKNILGDIAFA++DN++IR
Sbjct: 359 TSSP--ENNSLDGYESSKQRHAEIFIFRYGVVVFWNFTEIQEKNILGDIAFADYDNLVIR 416

Query: 416 PLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRI 475
           PLDEQDIETE FHF+YDM VERPRIFNDI+TLRSGDHIIKLTLSHSIAQSTKLSRFESRI
Sbjct: 417 PLDEQDIETEHFHFDYDMEVERPRIFNDIITLRSGDHIIKLTLSHSIAQSTKLSRFESRI 476

Query: 476 SPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPS 535
           SPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPS
Sbjct: 477 SPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPS 536

Query: 536 LHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVL 595
           LHPLYLAMREYLEIDQR QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVL
Sbjct: 537 LHPLYLAMREYLEIDQRAQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVL 596

Query: 596 VSICEIIVRSFIIRQLK 612
           VSI EI+VRSFI+R+LK
Sbjct: 597 VSIGEIVVRSFIVRRLK 613

>SAKL0F00770g Chr6 complement(66976..68886) [1911 bp, 636 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048W RMD8 Cytosolic protein required for sporulation
          Length = 636

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/622 (65%), Positives = 473/622 (76%), Gaps = 38/622 (6%)

Query: 17  MSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASSRGSMRGNSA 76
           +SRRSPSILVTD+RSSK R+ APF               +SD+  G   SS    RG++ 
Sbjct: 18  LSRRSPSILVTDSRSSKNRMSAPFAGHAAGLKGG-----RSDSGNGGQGSSYA--RGSTP 70

Query: 77  SGSDLGPMRR-----------------SRAKLRQQGKFSDISIDNILSDVSDVPSGRREE 119
           +  D    RR                 S+   +Q GKFSDIS+DNILSD+SDVPSGRREE
Sbjct: 71  NAKDSRSTRRLSFSISGDHSFSQQQALSKRSKKQHGKFSDISLDNILSDMSDVPSGRREE 130

Query: 120 RLSISSHEMAPFAHHSSPG--QYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQMERR 177
           RLS+ S+E    + H  P   Q+TK+INPLPPRTSKTS+KLVLIP++ +++N  LQ ++R
Sbjct: 131 RLSLPSYEH--LSAHGRPRVRQHTKMINPLPPRTSKTSEKLVLIPDEQEKQNFLLQNDKR 188

Query: 178 RPLKYNRH--DPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXX 235
           R     R   +   +E+ D  +SRITAYNVA+G  +   S FLR THDVSPRLYDE    
Sbjct: 189 RSSSSARSYGEKMSKEHRDRILSRITAYNVADGLSLKLVSQFLRETHDVSPRLYDECLYV 248

Query: 236 XXXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNF 295
                   GKDGFRIKSN+SKKT+GGKTLIDRLID SEQRDHHYEYYSGVET+EDM+NN+
Sbjct: 249 PYCLPLLPGKDGFRIKSNISKKTVGGKTLIDRLIDTSEQRDHHYEYYSGVETMEDMHNNY 308

Query: 296 ELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEG----RDTDQSKNISA 351
           E+ +    D +R DS   PDHLPN S++ TASFDPSEPQ+FAEE        ++ +++  
Sbjct: 309 EIDEGGANDADRVDSTSVPDHLPNPSTS-TASFDPSEPQYFAEETPLEQERREREEHLQI 367

Query: 352 VGNRSQNPYMESQSLENYGS---SKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAE 408
           +   S       Q  ++  S   SKQQHAEIFIF YGV+VFWNFTEIQEKNILGDIAFA+
Sbjct: 368 ISTNSSTAPSGKQPTKDTKSRDLSKQQHAEIFIFGYGVIVFWNFTEIQEKNILGDIAFAD 427

Query: 409 HDNMIIRPLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKL 468
           + +++IRPLDEQDIETEQFHFEYDM+ ERPRIFNDI+TLRSGDHIIKLTLSH+IAQSTKL
Sbjct: 428 YKSLVIRPLDEQDIETEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKL 487

Query: 469 SRFESRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEF 528
           SRFESRISPILGTVSKLPKRLAL+GTLGLKREQLLKKSGKLFKLRVDVNLSSS+LDTP+F
Sbjct: 488 SRFESRISPILGTVSKLPKRLALHGTLGLKREQLLKKSGKLFKLRVDVNLSSSILDTPDF 547

Query: 529 FWSFEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIA 588
           FWS EPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIA
Sbjct: 548 FWSLEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIA 607

Query: 589 VIFVSVLVSICEIIVRSFIIRQ 610
           VIFVSVLVSI EI+VR FII++
Sbjct: 608 VIFVSVLVSIAEILVRYFIIKK 629

>TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON}
           Anc_3.568 YFR048W
          Length = 585

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/613 (61%), Positives = 441/613 (71%), Gaps = 37/613 (6%)

Query: 5   LGFQEGPGRRTS-----MSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDT 59
           + ++ G G R+      ++RRSPSILVTD+RSS+KR+ APF                   
Sbjct: 1   MSYKVGDGDRSDANGLPLARRSPSILVTDSRSSRKRMSAPFAG----------------- 43

Query: 60  YQGFSASSRGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREE 119
                  SR  +    +SGS    +   R   R  G+FS+ISIDNILS++SDVPSGRREE
Sbjct: 44  -HAAGVRSRDELPNMKSSGSFGNKVSNKR---RTSGRFSEISIDNILSEMSDVPSGRREE 99

Query: 120 RLSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSD-RKNNALQMERRR 178
           RLS SS +    +       Y+K+INPLP RTSKTS+KLVLIPE++D R+++A    R+R
Sbjct: 100 RLSSSSADRHYASDKPRSLNYSKMINPLPARTSKTSQKLVLIPEEADGRESSANAFSRKR 159

Query: 179 PLKYNRHDPDGQENY--DEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXXX 236
                +   +   +   DE+++RITAYNVAEGF +   S FL+ TH+VSPR+YDE     
Sbjct: 160 STTSMKGYGESARHAKKDEKLARITAYNVAEGFNLKLMSKFLKCTHEVSPRMYDECLYVA 219

Query: 237 XXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFE 296
                  GKDGFR+KSN+SKK +GGKTLI++LID SEQRDHHYEYYSGVET+ED  N FE
Sbjct: 220 YTLPLLLGKDGFRVKSNISKKVVGGKTLIEKLIDTSEQRDHHYEYYSGVETLEDARNAFE 279

Query: 297 LSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRS 356
           L  TA      ND    P+HLPN    N  SFDPSEPQFFAEE     + +       R 
Sbjct: 280 LDPTAVL--VENDPNIIPNHLPN-PPGNLDSFDPSEPQFFAEETPTEQKLRE-----RRE 331

Query: 357 QNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRP 416
           Q     +       SS  QHAEIFIF YGV+VFWNFTEIQEKNILGDIAFA++ N++IRP
Sbjct: 332 QFNMPANNKRHGTTSSGDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADYKNLVIRP 391

Query: 417 LDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRIS 476
           LDEQDIE EQFHF+YD + ERPRIFNDIVTLRSGDHII+LTLSH+IAQS+KLSRFESRIS
Sbjct: 392 LDEQDIEREQFHFDYDKDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRIS 451

Query: 477 PILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSL 536
           PIL  V+KLPKRLALYGTLG+KREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSL
Sbjct: 452 PILTAVTKLPKRLALYGTLGMKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSL 511

Query: 537 HPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLV 596
           HPLY+AMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVA+RN+AR+TWWFI  I V V+ 
Sbjct: 512 HPLYIAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVADRNIARVTWWFIIAIIVGVVF 571

Query: 597 SICEIIVRSFIIR 609
           S+ EI+VR  II+
Sbjct: 572 SLSEILVRYIIIQ 584

>Ecym_2598 Chr2 (1162883..1164691) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii AFR265C
          Length = 602

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/615 (63%), Positives = 450/615 (73%), Gaps = 36/615 (5%)

Query: 11  PGRRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASSRGS 70
           P  R  MSRRSPSILVTD+RS+KKR  APF              +K          +   
Sbjct: 8   PQSRNMMSRRSPSILVTDSRSTKKRPSAPFAGNANTRR------DKVGNIFPTVIENHSG 61

Query: 71  MRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISSHEMAP 130
            R  S SG D  P   +R    +QGKFSD+S+D+ILS++SDVPSGRREERLS SS++   
Sbjct: 62  KRIASLSGRDYIPKHSTRRA--RQGKFSDVSMDSILSEMSDVPSGRREERLSSSSYDSY- 118

Query: 131 FAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQMERRRPLKYNRHDPDG- 189
                 P QY K+INPLP RTSKTS+K VLIPE+  +K    Q   +R + YN  D DG 
Sbjct: 119 --DRLRPLQYNKMINPLPSRTSKTSEKFVLIPEEGSKK--FAQGFNKRSI-YN-ADSDGI 172

Query: 190 -QENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXXXXXXXXXXGKDGF 248
            +E     +  + AYNVAEGF +   S FL+ THDVSPR YDE            GK+GF
Sbjct: 173 FKEARSHGLPSLMAYNVAEGFNLKLASKFLKETHDVSPRRYDECLYVPYCLPLLPGKNGF 232

Query: 249 RIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDTAGKDNERN 308
           R++SN+SK+TIGGKTL+DRLID SEQRDHHYEYYSGVETVEDM NNFE+S+ +   N R+
Sbjct: 233 RLRSNISKQTIGGKTLMDRLIDTSEQRDHHYEYYSGVETVEDMRNNFEISEIS---NSRD 289

Query: 309 -DSLPTPDHLPNNSSNNTASFDPSEPQFFAEEG---RDTDQSKNISAVGNR--------- 355
            + L +PDHL   S  N+ +F+P EPQ+FAEE     ++D S  + A+GN+         
Sbjct: 290 AEGLRSPDHLSGIS--NSEAFNPGEPQYFAEEMSMEANSDSSSEL-ALGNKIFKSKPADQ 346

Query: 356 SQNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIR 415
                 + Q  +     +QQHAEIFIF+YGVVVFWNFTEIQEKNILGDIAF++  NM+IR
Sbjct: 347 HHQQQQQQQQQQQQQQQQQQHAEIFIFNYGVVVFWNFTEIQEKNILGDIAFSDMKNMVIR 406

Query: 416 PLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRI 475
           PLDEQDIE EQFHFEYDM  ERPRIFNDI+TLRSGDHIIKLTLSH+IAQSTKLSRFE RI
Sbjct: 407 PLDEQDIEIEQFHFEYDMETERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRI 466

Query: 476 SPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPS 535
           SPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPS
Sbjct: 467 SPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPS 526

Query: 536 LHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVL 595
           LHPLY AMREYLEID RVQVLN+RCKVFLEFFDICV+S+AER+MARITWW + VIF+SVL
Sbjct: 527 LHPLYTAMREYLEIDTRVQVLNERCKVFLEFFDICVNSIAERDMARITWWLVTVIFLSVL 586

Query: 596 VSICEIIVRSFIIRQ 610
           VSI EI+VR FIIR+
Sbjct: 587 VSIAEILVRYFIIRR 601

>AFR265C Chr6 complement(910790..912565) [1776 bp, 591 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR048W
           (RMD8)
          Length = 591

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/610 (62%), Positives = 439/610 (71%), Gaps = 61/610 (10%)

Query: 14  RTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASSRGSMRG 73
           R  MSRRSPSILVTDARS+KKR  APF                ++T +  +  S  ++  
Sbjct: 17  RNMMSRRSPSILVTDARSTKKRSSAPFAG-------------NANTRRDKTGGSMPTVIE 63

Query: 74  NSASGSDLGPMR------RSRAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISSHE 127
           N A G  +GPM       ++ +   +QGKFS++S+DNILS++SDVPSGRR+ERLS SS  
Sbjct: 64  NRA-GRRMGPMGGREFMPKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSS-- 120

Query: 128 MAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQMERRRP------LK 181
              F +   P  Y K I PLP RTSKTS+K VLIP D + K  A    +R        L 
Sbjct: 121 ---FEYERRPAHYNKTIRPLPSRTSKTSEKFVLIP-DENVKRFAQGFHKRSASRVFSELS 176

Query: 182 YNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXXXXXXXX 241
           Y  H+  G       +  ITAYNVAEGF ++  S FL+ TH+VS R YDE          
Sbjct: 177 YGEHNTAG-------LPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDECLYVPYCLPL 229

Query: 242 XXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDTA 301
             GKDGFRI+SNVSKK +GGKTLIDRLID SEQRDHHYEYYSGVETVEDM+NNFE+++  
Sbjct: 230 LPGKDGFRIRSNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENG 289

Query: 302 -GKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPY 360
            G+D    D L   DHL   SSN   SFDPSEPQFFAEE         +S +G    +P 
Sbjct: 290 NGRDP---DGLRNADHLAPLSSN-MQSFDPSEPQFFAEE---------LSEIG---LHPI 333

Query: 361 MESQSLENYGSSK----QQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRP 416
            +S S E +   K    QQHAEIFIF+YGV+VFWNFTE++EKNILGDIAF+   NM+ RP
Sbjct: 334 QDSSS-EQHEREKVLDAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRP 392

Query: 417 LDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRIS 476
           LDEQDIE EQFHFEYDM+ ERPRIFNDI+TLRSGDHIIKLTLSH+IAQSTKLSRFE RI+
Sbjct: 393 LDEQDIEIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRIT 452

Query: 477 PILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSL 536
           PILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSL
Sbjct: 453 PILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSL 512

Query: 537 HPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLV 596
           HPLY AMREYLEID RVQVLNDRCKVFLEFFDICV+S+AE++MARITWW + VIF+SVLV
Sbjct: 513 HPLYTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWLVIVIFISVLV 572

Query: 597 SICEIIVRSF 606
           S  EI+ R F
Sbjct: 573 STAEILARIF 582

>ZYRO0E09548g Chr5 (760326..762104) [1779 bp, 592 aa] {ON} similar
           to uniprot|P43620 Saccharomyces cerevisiae YFR048W RMD8
           Cytosolic protein required for sporulation
          Length = 592

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/604 (60%), Positives = 435/604 (72%), Gaps = 32/604 (5%)

Query: 11  PGRR---TSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASS 67
           PG++    SMS+RSPSILVTD+RS+ KR+ APF                         + 
Sbjct: 11  PGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDH-----------VAD 59

Query: 68  RGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISSHE 127
           R  +    ++GS    +RR     R  G+FSDISIDNILSD SDVPSGRREER S SS +
Sbjct: 60  RNRLAPYPSNGSKSSSVRR-----RPSGRFSDISIDNILSDASDVPSGRREERQSSSSLD 114

Query: 128 MAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQM--ERRRPLKYNRH 185
               +    P  YTK++NPLP RTSKTS+KLVLIPE+   + ++      +R     N  
Sbjct: 115 RFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNAT 174

Query: 186 DPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXXXXXXXXXXGK 245
               Q     ++SRITAYNVAEGF +   +DFL+ TH+VSPR+YDE            GK
Sbjct: 175 GKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGK 234

Query: 246 DGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDTAGKDN 305
           DGFR++SNVSKK +GGKTLID+LID SEQRDHHYEYYSGVET+ED++NNFEL      D 
Sbjct: 235 DGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNGNYDA 294

Query: 306 ERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPYMESQS 365
           +      TPDHLPN +  N  +F+PSEPQFFAEE     + +      N     +  S  
Sbjct: 295 D-----ITPDHLPN-AMGNQDTFNPSEPQFFAEETPVEQERRERRENFN-----FDSSSK 343

Query: 366 LENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETE 425
            ++ G+   QHAEIFIF YGV+VFWNFTEIQEKNILGDIAFA+  N++IRPLDE DIE E
Sbjct: 344 NDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIERE 403

Query: 426 QFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKL 485
           QFHF+YD ++ERPRIFNDIVTLRSGDHII+LTLSH+IAQS+KLSRFESRI+PIL + +KL
Sbjct: 404 QFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKL 463

Query: 486 PKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMRE 545
           PKRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSSS+LDTPEFFWSFEPSLHPLY+AMRE
Sbjct: 464 PKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMRE 523

Query: 546 YLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRS 605
           YLEIDQRVQV+NDR KV+LEFFD+CVDSVAERNMAR+TWWFI VI + VL S+ EI+VR 
Sbjct: 524 YLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRY 583

Query: 606 FIIR 609
            +IR
Sbjct: 584 VMIR 587

>KLLA0A00715g Chr1 complement(69861..71636) [1776 bp, 591 aa] {ON}
           weakly similar to uniprot|P43620 Saccharomyces
           cerevisiae YFR048W RMD8 Cytosolic protein required for
           sporulation
          Length = 591

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/592 (62%), Positives = 428/592 (72%), Gaps = 33/592 (5%)

Query: 24  ILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASSRGSM---RGNSASGSD 80
           ILVTDARS+K R  APF               +S    G    S+GS    RG    G  
Sbjct: 24  ILVTDARSNKNRPSAPFAGHAAGMRNVSSV-PRSAASSGGKTDSKGSRVRRRGYDMHGD- 81

Query: 81  LGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISSHEMAPFAHHSSPGQY 140
                    K     +FSD+S+DN+L DVSDVPSGRR+ERLS SS++M P  +       
Sbjct: 82  ---------KKSISSRFSDVSMDNLLLDVSDVPSGRRQERLSTSSYDMFP-RNRQRGTHI 131

Query: 141 TKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQMERRRPLKYNRHDPDGQENYDEE--MS 198
           TK+INPLP RTSKTS+KLVLIP+++    N  Q  R+R  K  R     +   D+E  + 
Sbjct: 132 TKMINPLPTRTSKTSQKLVLIPDEAHDSRNINQF-RKRANKTQRAKSSSKTKMDKEVDLP 190

Query: 199 RITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXXXXXXXXXXGKDGFRIKSNVSKKT 258
           RITAYNVAEGF +S TS F++ THDV PRLYDE            GKDGFRIKSN+SKKT
Sbjct: 191 RITAYNVAEGFNLSLTSTFMKQTHDVLPRLYDECLYVPYTLPLLPGKDGFRIKSNISKKT 250

Query: 259 IGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDTAGKDNERNDSLPTPDHLP 318
            GGK++ID LID SE+RDHHYEY+SGVET+ED+NNN+EL D  G  N  N +  TPDHLP
Sbjct: 251 QGGKSIIDYLIDTSERRDHHYEYFSGVETLEDVNNNYEL-DEGGVTNNLN-AENTPDHLP 308

Query: 319 NNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPYMESQSLENYGSSKQQHAE 378
           N   N + SFDPSEPQ+FAEE     + +  + +  ++                +QQHAE
Sbjct: 309 NPPVNTSVSFDPSEPQYFAEENNAEAELEAFNEINGKT-------------SLFQQQHAE 355

Query: 379 IFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMNVERP 438
           IFIFSYGVVVFWNFTEIQEKNILGDI+F+ + NM+++PLDEQDIE E FHFEYDM+ ERP
Sbjct: 356 IFIFSYGVVVFWNFTEIQEKNILGDISFSSYKNMVLKPLDEQDIEIESFHFEYDMDTERP 415

Query: 439 RIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYGTLGLK 498
           RIFNDIVTLRSGDH+  LTLSH+IAQS KLSRFE+RI PI G+VSKLPKRLALYGTLGLK
Sbjct: 416 RIFNDIVTLRSGDHLTALTLSHAIAQSVKLSRFEARIVPIFGSVSKLPKRLALYGTLGLK 475

Query: 499 REQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRVQVLND 558
           REQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLH LY AMREYLEID RVQVLND
Sbjct: 476 REQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHSLYQAMREYLEIDPRVQVLND 535

Query: 559 RCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSFIIRQ 610
           RCKVFLEFFDICVDS+AERNMARITWWFI +IF+SVL+SI EI+VR FII++
Sbjct: 536 RCKVFLEFFDICVDSIAERNMARITWWFITIIFISVLISIVEILVRYFIIKK 587

>Smik_7.368 Chr7 (606969..608948) [1980 bp, 659 aa] {ON} YFR048W
           (REAL)
          Length = 659

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/675 (57%), Positives = 447/675 (66%), Gaps = 98/675 (14%)

Query: 8   QEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASS 67
           Q  PG    M +RSPSILVTDAR+SK R+ APF                     G +A S
Sbjct: 7   QPSPGE---MPKRSPSILVTDARTSKNRMSAPFA--------------------GHAAGS 43

Query: 68  RGSM------RGNSASGSDLGP---MRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRRE 118
           R SM      R      S++G       +  + R  G+FSDISIDNILSD SD+PS RRE
Sbjct: 44  RKSMENKNLVRSQGVRSSNIGSSSLQNPTHPRRRSSGRFSDISIDNILSDNSDIPSARRE 103

Query: 119 ERLSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKN------NAL 172
           ERLS SS++     ++       K+INPLPPRTSKTS+KLVLIPE+ D  +      NAL
Sbjct: 104 ERLSSSSNDRP--RNYERLSSRRKMINPLPPRTSKTSQKLVLIPEEDDLSHFQTMPTNAL 161

Query: 173 QMERRR--PLKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYD 230
             +R R   +K N  D   + + D+ M+RITAYNVA+GF ++    FL  TH+VSPRLYD
Sbjct: 162 DRQRPRVGSMKPNSFDRLPRHSRDKSMARITAYNVADGFNLNQLYKFLHETHEVSPRLYD 221

Query: 231 EXXXXXXXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVED 290
           E            GK GFRIKSN+SKKT+GGKTLID LID SEQRDHHYEYYSGVETVED
Sbjct: 222 ECLYVAYTLPLLPGKGGFRIKSNISKKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVED 281

Query: 291 MNNNFELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEE----------- 339
            NNN+EL      ++   D+   PDHLPN       SF+P EPQFFAEE           
Sbjct: 282 ANNNYELEANGNNNSTNQDTTIVPDHLPN-PVGQQDSFNPMEPQFFAEETPLEIEERERT 340

Query: 340 -----------------GRDTDQSKNISAVGNRSQN--------PYMESQSLENYGSSKQ 374
                            G   D+S+ +S V +   +        P   S S ++  SS +
Sbjct: 341 ERINMLKKEEKDIDGSNGEKNDESEPVSYVNDGKDHHAYSACFSPPASSASTQSALSSSR 400

Query: 375 -------------------QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIR 415
                              +HAEIFIF YGV+VFWNFTEIQEKNILGDI FA + +++IR
Sbjct: 401 DDFNRVYEVHSDNGHDGNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFAGYKSLMIR 460

Query: 416 PLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRI 475
           PLDEQDIETEQFHFEYD + ERPRIFNDIVTLRSGDHII+LTLSH+IAQS+KLSRFESRI
Sbjct: 461 PLDEQDIETEQFHFEYDRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRI 520

Query: 476 SPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPS 535
           SPIL +V+KLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPS
Sbjct: 521 SPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPS 580

Query: 536 LHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVL 595
           LHPLY+AMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMAR+TWWFI VI   V+
Sbjct: 581 LHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVI 640

Query: 596 VSICEIIVRSFIIRQ 610
            S+ EI VR  II +
Sbjct: 641 FSLTEIFVRYVIIHR 655

>Suva_12.9 Chr12 complement(11366..13345) [1980 bp, 659 aa] {ON}
           YFR048W (REAL)
          Length = 659

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/677 (57%), Positives = 449/677 (66%), Gaps = 102/677 (15%)

Query: 8   QEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASS 67
           Q  PG    M +RSPSILVTDARSS+ RI APF                     G +A S
Sbjct: 7   QPSPG---EMPKRSPSILVTDARSSRNRISAPFA--------------------GHAAGS 43

Query: 68  RGSM--------RGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREE 119
           R SM        +G  +S +   PM  +  + R  G+FSDISIDNILSD S++PS RREE
Sbjct: 44  RKSMENKSVERSQGIRSSNAGPSPMMPAHPRRRSSGRFSDISIDNILSDNSEIPSARREE 103

Query: 120 RLSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSD------RKNNALQ 173
           RLS SS +     ++       K+INPLPPRTSKTS+KLVLIPE+ D        +NAL 
Sbjct: 104 RLSSSSSDRP--RYYERLNSRRKMINPLPPRTSKTSQKLVLIPEEDDLNQFRNMPHNAL- 160

Query: 174 MERRRP----LKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLY 229
            +R+RP     K + HD   +   ++ M+RITAYNVA+GF ++    FL  TH+VSPRLY
Sbjct: 161 -DRQRPKVGSTKSSSHDRMPRHLREKPMARITAYNVADGFNLNLLYRFLEDTHEVSPRLY 219

Query: 230 DEXXXXXXXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVE 289
           DE            GK GFRIKSN+SKKT+GGKTLID LID SEQRDHHYEYYSGVETVE
Sbjct: 220 DECLYVAYTLPLLPGKGGFRIKSNISKKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVE 279

Query: 290 DMNNNFELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAE----------- 338
           D NNN+EL  + G ++   D++  PDHLPN       SF+P EPQFFAE           
Sbjct: 280 DANNNYELETSGGNNSTSQDTVTVPDHLPN-PVGQQDSFNPMEPQFFAEETPLEQEKRER 338

Query: 339 ---------EGRDTDQSKNISAVGNRSQN---------------------------PYME 362
                    E  DTD   + + + +   N                           P   
Sbjct: 339 IERMNMLKKEENDTDDKGSGNTINDDDDNEAANYVAASTDQYRTPPSSASSAYTPSPPSS 398

Query: 363 SQSLENYGSSKQQ---------HAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMI 413
           ++   N G   Q+         HAEIFIF YGV+VFWNFTEIQEKNILGDI FA++ N++
Sbjct: 399 ARRDSNRGYEMQKDNEHEGNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLM 458

Query: 414 IRPLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFES 473
           IRPLDEQDIETEQFHFEYD + ERPRIFNDIVTLRSGDHII+LTLSH+IAQS+KLSRFES
Sbjct: 459 IRPLDEQDIETEQFHFEYDSDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFES 518

Query: 474 RISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFE 533
           RISPIL +V+KLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFE
Sbjct: 519 RISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFE 578

Query: 534 PSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVS 593
           PSLHPLY+AMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMAR+TWWFI VI   
Sbjct: 579 PSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFG 638

Query: 594 VLVSICEIIVRSFIIRQ 610
           V+ S+ EI VR  II +
Sbjct: 639 VIFSLAEIFVRYIIIHR 655

>NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON}
           Anc_3.568
          Length = 605

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/623 (59%), Positives = 442/623 (70%), Gaps = 50/623 (8%)

Query: 9   EGPGRRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXX-XXXXEKSDTYQGFSASS 67
           EG GR   M++RSPSILVTD+R+SK R+ APF                ++ +Y+  + +S
Sbjct: 7   EGNGRVRPMAKRSPSILVTDSRTSKNRLSAPFAGHAAGVLNRDEHRLPRNKSYRYNATNS 66

Query: 68  RGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISSHE 127
              +RG   SG                G+FSD+SIDNILSD SDVPSGRREERLS SS E
Sbjct: 67  NAELRGRHPSGGG--------------GRFSDVSIDNILSDSSDVPSGRREERLSNSSLE 112

Query: 128 MAPFA---HHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSD-------RKNNALQMERR 177
            +P      HS      K INPLP RTSKTS++LVLIPE+ D       R N +  ++R+
Sbjct: 113 RSPLVTDRAHSRSQYQRKTINPLPSRTSKTSQRLVLIPEEGDNVSKDDIRGNISSGLDRK 172

Query: 178 R--PL-KYN--RHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEX 232
           R  P+ KYN   + P+ + +   +++RITAYNVAEGF +S  S FL+ TH+VSPR+YDE 
Sbjct: 173 RHTPIPKYNDEYYQPEPRTH---KLARITAYNVAEGFNLSLLSKFLQDTHEVSPRMYDEC 229

Query: 233 XXXXXXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMN 292
                      GKDGFRIKSNVSKK +GG TLID+LID SEQRDHHYEY+SGVET+ED N
Sbjct: 230 LYVAYTLPLLPGKDGFRIKSNVSKKFVGGMTLIDKLIDTSEQRDHHYEYFSGVETLEDAN 289

Query: 293 NNFELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEG------RDTDQS 346
           NN+EL+ T+    E  ++ P P HLP   +N  A F+PSEPQFFAEE       R+ ++ 
Sbjct: 290 NNYELNPTS-PPMENVENQPIPTHLPVPPTNPDA-FNPSEPQFFAEETPIEQKLREQNER 347

Query: 347 KNISAVGNRSQNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAF 406
            NI        N  M S  +   G    QHAEIF+F YGV+VFWNFTE+QEKN+LGDI F
Sbjct: 348 LNIVPT-----NIAMNSSQVAANG---DQHAEIFVFHYGVIVFWNFTEVQEKNLLGDITF 399

Query: 407 AEHD-NMIIRPLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQS 465
           + +  N++IRPLDEQDIETEQFHF YD N ERPRIFNDIVTLRSGDH+I+LTLSH+IAQS
Sbjct: 400 SYYRRNLVIRPLDEQDIETEQFHFGYDKNTERPRIFNDIVTLRSGDHMIELTLSHAIAQS 459

Query: 466 TKLSRFESRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDT 525
           +KLSRFESRISP+L +++KLPKRLALYGTLGLKR QLLKKSGKLFKLRVDVNLSSS+LD+
Sbjct: 460 SKLSRFESRISPLLTSITKLPKRLALYGTLGLKRSQLLKKSGKLFKLRVDVNLSSSILDS 519

Query: 526 PEFFWSFEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWW 585
           PEFFWS EPSL PLY+AMREYLEIDQRVQVLNDRC VFLEFFDICVDSVAE+N+AR TWW
Sbjct: 520 PEFFWSTEPSLSPLYIAMREYLEIDQRVQVLNDRCIVFLEFFDICVDSVAEKNIARFTWW 579

Query: 586 FIAVIFVSVLVSICEIIVRSFII 608
           F+  I V +  S+ EI VR  II
Sbjct: 580 FVIAIIVGLFFSLSEIFVRYIII 602

>TBLA0E00210 Chr5 complement(29729..31624) [1896 bp, 631 aa] {ON}
           Anc_3.568 YFR048W
          Length = 631

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/625 (57%), Positives = 448/625 (71%), Gaps = 37/625 (5%)

Query: 13  RRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEK--SDTYQGFSASSRGS 70
           ++  +S+RSPSILVTD RS++ R  APF               K  S    G+ ++   +
Sbjct: 15  QKKPLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKSTWNRN 74

Query: 71  MRGNS--ASGSDLG--PMRRSRAKLRQ--------QGKFSDISIDNILSDVSDVPSGRRE 118
           +  NS  A+G+  G  P ++S A +          QG+FSDISIDNIL D S++PS RRE
Sbjct: 75  LSNNSSAANGNVFGNKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIPSARRE 134

Query: 119 ERLSISSHE-MAPFAHH--SSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQME 175
           ER S SS+E  + F  H  SS   ++K I PLPPRTSKTS+KLVLIPE+ D ++N+L   
Sbjct: 135 ERSSGSSYERFSMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSRSNSLG-- 192

Query: 176 RRRPLKYNRHDPDGQEN-----YDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYD 230
           R R     R  P G  +         + R+TAY+++EG  +   S FL+  H+VSPRLYD
Sbjct: 193 RPRSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKYHEVSPRLYD 252

Query: 231 EXXXXXXXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVED 290
           E            GKDG+RIKSN+SKK IGGKTLID++ID SEQRDHHYEYYSGVE +ED
Sbjct: 253 ECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGVEVLED 312

Query: 291 MNNNFELS-DTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEG----RDTDQ 345
            NNN+ELS +    D + N+    PDHLPN  +N T +F+PSEPQ+FAEE     +  +Q
Sbjct: 313 ANNNYELSTNPVQADTDINN---IPDHLPNTMAN-TDNFNPSEPQYFAEETPSEQKLREQ 368

Query: 346 SKNISAVGNRSQNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIA 405
            + +  + N +      S+ +    + K QHAEIFIF YGV+VFWNFTE QEKNILGDIA
Sbjct: 369 EEQLGLIANSTITTSSSSELI----TGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIA 424

Query: 406 FAEHDNMIIRPLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQS 465
           FA++ +++IRPLDEQDIETE+FHFEYD + ERPRIFND++TLRSGDHIIKLTLSHSIAQS
Sbjct: 425 FADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHSIAQS 484

Query: 466 TKLSRFESRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDT 525
           +KLSRFESR+ P+L +V+KLPKRLALYGTLGL R+QLLKKSGKLFKLRVDVNLSSSVLDT
Sbjct: 485 SKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDT 544

Query: 526 PEFFWSFEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWW 585
           PEFFW+FEPSLHPLY+AMREYLEID+RVQV+NDRC V LEFF+ICVDSVAERN+AR+TWW
Sbjct: 545 PEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWW 604

Query: 586 FIAVIFVSVLVSICEIIVRSFIIRQ 610
           FI V+ + VL S+ EI++R  II++
Sbjct: 605 FIIVLILGVLFSLTEILIRYLIIQR 629

>Kpol_507.9 s507 complement(53819..55630) [1812 bp, 603 aa] {ON}
           complement(53819..55630) [1812 nt, 604 aa]
          Length = 603

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/608 (61%), Positives = 429/608 (70%), Gaps = 38/608 (6%)

Query: 15  TSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASSRGSMRGN 74
           +SMS+RSPSILVTD+RS+K R+ APF                       S  S  S+  N
Sbjct: 17  SSMSKRSPSILVTDSRSNKNRLSAPFARHAAGAR---------------SRESLSSVPSN 61

Query: 75  SASGSDLGPMRRS---------RAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISS 125
           S   S   P   S         RA   Q G+FSDISIDNILSD SDVPSGRREER S SS
Sbjct: 62  SIGSSSYVPYLNSNKNQVRSVNRAASPQFGRFSDISIDNILSDSSDVPSGRREERRSSSS 121

Query: 126 HEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDS----DRKNNALQMERRRPLK 181
            +            Y K ++ +PPRTSKTS KLVLIPE+S    D   N     R    K
Sbjct: 122 WDRFSIYDKLRTSNYGKGLSHIPPRTSKTSHKLVLIPENSEIPKDYMPNNFLRNRSSSYK 181

Query: 182 YNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXXXXXXXX 241
             + +   Q + DE + RITAYNVAEGF +   S FL+ TH+VSPR Y E          
Sbjct: 182 NLQSEQFQQHDRDEILPRITAYNVAEGFNLDLMSKFLKSTHEVSPRQYAECLYVAYTLPL 241

Query: 242 XXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDTA 301
             GKDG+RIKSN+SKK +GGKTLID LID SEQRDHHYEYYSGVE +ED NNN+EL+ T 
Sbjct: 242 LPGKDGYRIKSNISKKVVGGKTLIDELIDTSEQRDHHYEYYSGVEILEDANNNYELNATT 301

Query: 302 GKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPYM 361
              ++  +    PDHLPN  +NN+ SFDPSEPQFFAEE     + +       R +   M
Sbjct: 302 P--SQEPEVTVIPDHLPN-PTNNSDSFDPSEPQFFAEETPIEQKLRE------RKEQIKM 352

Query: 362 ESQSLE-NYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQ 420
            S S   +    + QHAEIFIF YGV+VFWNFTE QEKNILGDIAF+E+ N++IR LDEQ
Sbjct: 353 NSDSKPMSLIRDEDQHAEIFIFHYGVIVFWNFTEQQEKNILGDIAFSEYKNLVIRALDEQ 412

Query: 421 DIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILG 480
           DIETEQFHFEYD   ERPRIFNDI+TLRSGDHII+LTLSH+IAQS+KLSRFESR++PIL 
Sbjct: 413 DIETEQFHFEYDKENERPRIFNDIITLRSGDHIIELTLSHAIAQSSKLSRFESRVTPILS 472

Query: 481 TVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY 540
           +++KLP+RLALYGTLGLKREQLLK+SGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY
Sbjct: 473 SITKLPRRLALYGTLGLKREQLLKRSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY 532

Query: 541 LAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICE 600
           +AMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMAR+TWWFI +I VSVL S+ E
Sbjct: 533 VAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFIMMIIVSVLFSLAE 592

Query: 601 IIVRSFII 608
           I++R  II
Sbjct: 593 ILIRYNII 600

>NCAS0F03970 Chr6 (796049..797842) [1794 bp, 597 aa] {ON} Anc_3.568
           YFR048W
          Length = 597

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/601 (60%), Positives = 440/601 (73%), Gaps = 26/601 (4%)

Query: 13  RRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASSRGSMR 72
           R T MS+RSPSILVTD+RSSK R+ APF                + +       +RG   
Sbjct: 14  RTTPMSKRSPSILVTDSRSSKHRMSAPF------------AGHAAGSLNQPKPFNRGIPH 61

Query: 73  GNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISSHEMAPFA 132
               S + +     S+ + +  G+F D+SIDNIL D SDVPSGRREERLS SS E  PFA
Sbjct: 62  HTPYSSTGI----HSQLRKKSSGRFGDVSIDNILLDSSDVPSGRREERLSNSSQERFPFA 117

Query: 133 HHSSPGQYTKL-INPLPPRTSKTSKKLVLIPED---SDRKNNALQMERRRPLKYNRHDPD 188
                  Y K  INPLP RTSKTS+KLVLIPED        ++  ++R+R     R    
Sbjct: 118 SDRLRSSYFKRSINPLPSRTSKTSQKLVLIPEDEPIGAEVGSSNVLDRKRHATTPRSPER 177

Query: 189 GQENYDE-EMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXXXXXXXXXXGKDG 247
            + +Y E +++RITAYNVA+GF +   S FL  TH+VSPR+YDE            GK+G
Sbjct: 178 YESSYKESKLARITAYNVADGFNLKLLSKFLGDTHEVSPRMYDECLYIAYTLPLLPGKEG 237

Query: 248 FRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDTAGKDNER 307
           FRIKSN+SKKT+GG+TLID+LID SEQRDHHYEY+SGVET+ED +NN+EL   A   +  
Sbjct: 238 FRIKSNISKKTVGGQTLIDKLIDTSEQRDHHYEYFSGVETLEDAHNNYELDSNAIPIDTT 297

Query: 308 NDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPYMESQSLE 367
           + +L  P HLP  ++ N  SF+PSEPQFFAEE  + DQ   +     R +N   +S +L 
Sbjct: 298 DPNL-IPSHLPIPTT-NPDSFNPSEPQFFAEESHN-DQ--ELRKGDGRLKNQKNKSINLA 352

Query: 368 NYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQF 427
               S+ QHAE+FIF YGV+VFWNFTE++EKN+LGDIAF+++ N++IRPLDEQDIETEQF
Sbjct: 353 TTIPSEDQHAELFIFHYGVIVFWNFTEMEEKNLLGDIAFSDYKNLVIRPLDEQDIETEQF 412

Query: 428 HFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPK 487
           HFEYD + ERPRIFNDI+TLRSGDH+I+LTLSH+IAQS+KLSRFESRI+PIL +V+KLPK
Sbjct: 413 HFEYDKDTERPRIFNDILTLRSGDHMIELTLSHAIAQSSKLSRFESRITPILASVTKLPK 472

Query: 488 RLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYL 547
           RLALYGTLGL+R+QLLK+SGKLFKLRVDVNLSSSVLD+PEFFWS EPSLHPLY+AMREYL
Sbjct: 473 RLALYGTLGLQRKQLLKRSGKLFKLRVDVNLSSSVLDSPEFFWSSEPSLHPLYIAMREYL 532

Query: 548 EIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSFI 607
           EIDQRVQVLNDRCKVFLEFFDICVDSVAERN+AR+TWWFI VI V V+ S+ EI VR  I
Sbjct: 533 EIDQRVQVLNDRCKVFLEFFDICVDSVAERNIARVTWWFIIVIIVGVIFSLTEIFVRYII 592

Query: 608 I 608
           I
Sbjct: 593 I 593

>CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048w
          Length = 619

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/626 (57%), Positives = 432/626 (69%), Gaps = 49/626 (7%)

Query: 16  SMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXX------------XEKSDTYQGF 63
           +MS+RSPSILVTDAR+SK R  APF                          E      G 
Sbjct: 15  TMSKRSPSILVTDARTSKNRRSAPFAGHAAGVRSASSSTGSGSSASAERGAELMKYVNGN 74

Query: 64  SASSRG---SMRGNSASGSDLGPMRR----SRAKLRQQGKFSDISIDNILSDVSDVPSGR 116
              SRG   +  G S+S    G +      S  + R  G+FS+ISIDNILSD SDVPSGR
Sbjct: 75  LRGSRGQYAATGGRSSSNHGTGDLSNRGTSSPPRRRASGRFSEISIDNILSDRSDVPSGR 134

Query: 117 REERLSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQMER 176
           REER S SS + +       P    K+IN LP RTSKTS+KLVLIPED         +ER
Sbjct: 135 REERGSNSSFDRSMIYDRLHPQPIRKMINTLPIRTSKTSQKLVLIPEDGSVPPTRGALER 194

Query: 177 RRPLKYNRHDPD---GQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXX 233
           R    + + +P     + + D  +SRITAYN+AEGF +   S FL+ TH+V PRLYDE  
Sbjct: 195 REQPTFVKRNPTERIPKSSRDHRLSRITAYNLAEGFNLKLLSKFLKSTHEVKPRLYDECL 254

Query: 234 XXXXXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNN 293
                     GKDGFR+KSNVSKK +GGKTLI++LID SEQRDHHYEYYSGVET+ED NN
Sbjct: 255 YIAYTLPLLPGKDGFRLKSNVSKKVVGGKTLIEKLIDTSEQRDHHYEYYSGVETLEDANN 314

Query: 294 NFELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEG------RDTDQSK 347
           N+EL  T+  +   N+S   P            SFDPSEPQ+FAEE       R+  +S 
Sbjct: 315 NYELDPTSVDNENNNNSNNNP----------ADSFDPSEPQYFAEETPKEQLERERSESL 364

Query: 348 NISAVGNRSQNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFA 407
           +I        NP  +  ++    + + QHAEIF+F YGV+VFWNFTE +EKN+LGDIAF+
Sbjct: 365 HI--------NPGSKPIAV---NADEDQHAEIFVFHYGVIVFWNFTEEEEKNLLGDIAFS 413

Query: 408 EHDNMIIRPLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTK 467
           ++ N++IRPLDEQDIE EQFHFEYD + ERPRIFNDI+TLRSGDHII+LTLSH+IAQS+K
Sbjct: 414 DYKNLVIRPLDEQDIEIEQFHFEYDKDTERPRIFNDIITLRSGDHIIELTLSHAIAQSSK 473

Query: 468 LSRFESRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPE 527
           LSRFESRISPIL TV++LPKRLALYGTLGLKREQL+KKSGKLFKLRVDVNLSSSVLDTPE
Sbjct: 474 LSRFESRISPILTTVTRLPKRLALYGTLGLKREQLIKKSGKLFKLRVDVNLSSSVLDTPE 533

Query: 528 FFWSFEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFI 587
           FFWSFEPSLHPLY+AMREYLEIDQRVQVLNDRC VFLEFFDICVDS+AERN+ R+TWWF 
Sbjct: 534 FFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCMVFLEFFDICVDSIAERNIVRVTWWFF 593

Query: 588 AVIFVSVLVSICEIIVRSFIIRQLKN 613
             I ++V+ S+ E+ +R  II +LK+
Sbjct: 594 VAIVITVIFSLIEVFIRYLIINRLKH 619

>KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.568
           YFR048W
          Length = 651

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/652 (54%), Positives = 434/652 (66%), Gaps = 64/652 (9%)

Query: 9   EGPGRRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQ------- 61
           +G   R  +++RSPSILVTD+RSS+ R  APF               K    Q       
Sbjct: 8   KGVTGRDPLAKRSPSILVTDSRSSQSRSSAPFAGHAASGSMANYHKSKQLQQQKSVRGGG 67

Query: 62  --------GFSASSRGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVP 113
                    + + +RG       SG+ L     +RA+ R  G+FS++S+DNIL + S VP
Sbjct: 68  VGSGSSAGNYGSGARG------PSGNSLNSAPGARARKRPSGRFSNVSMDNILHNDSAVP 121

Query: 114 SGRREERLSISSHEMAPFAH--HSSPGQYTKLINPLPPRTSKTSKKLVLIPEDS------ 165
           SGRRE+R S SS +  P     H+S   Y K+INPLP RTSK S+KLVLIPED       
Sbjct: 122 SGRREQRGSTSSWDRFPVTEILHAS-NSYRKMINPLPSRTSKISQKLVLIPEDDTVNAEN 180

Query: 166 ----------------------DRKNNALQMERRRPLKYNRHDPDGQENYDEEMSRITAY 203
                                 DRK ++ +M        N  D +        +SR+TAY
Sbjct: 181 GTSTKGSGNPPLRKSRNIGPVLDRKRHSTRMT-----NLNEFDNESYRFNSGNLSRLTAY 235

Query: 204 NVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXXXXXXXXXXGKDGFRIKSNVSKKTIGGKT 263
           N+AEGF+++    FL+ TH+V PRLYD+            GKDGFRIKSNVSKK +GG T
Sbjct: 236 NIAEGFDLTMLHRFLQNTHEVHPRLYDDCLYVPYVLPLLPGKDGFRIKSNVSKKAVGGGT 295

Query: 264 LIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDTAGKDNERNDSLPTPDHLPNNSSN 323
           LID+LID SE+RDHHYEYYSGVET+ED NNN+EL  T G  NE +D    PDHLP  ++ 
Sbjct: 296 LIDKLIDTSERRDHHYEYYSGVETLEDANNNYELEATGGHTNEMSDVSVIPDHLPQPTAG 355

Query: 324 -NTASFDPSEPQFFAEEG------RDTDQSKNISAVGNRSQNPYMESQSLENYGSSKQQH 376
            N  +FDP EPQFFAEE       R  ++ K+I++    ++    E             H
Sbjct: 356 INPDAFDPREPQFFAEETPVEQELRQREEMKSITSDEGTNKRSSRERNLERKVSEDSTDH 415

Query: 377 AEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMNVE 436
           AE+FIF YGV+VFWNFTE QEKN+LGDI FA+  +++IRP+DEQDIETE+FHFEYDM+ E
Sbjct: 416 AELFIFHYGVIVFWNFTEEQEKNLLGDITFADDKDLMIRPIDEQDIETEEFHFEYDMDTE 475

Query: 437 RPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYGTLG 496
           RPRIFNDIVTLRSGDHI+K+TLS++IAQS+KLSRFESRI+P+L  V KLPKRLAL+GTLG
Sbjct: 476 RPRIFNDIVTLRSGDHIVKMTLSYAIAQSSKLSRFESRITPLLSAVMKLPKRLALHGTLG 535

Query: 497 LKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRVQVL 556
           L+REQLLKKSGKLFKLRVDVNLSSS+LDTP+FFWS EPSLHPLY+AMREYLEID+RVQV+
Sbjct: 536 LRREQLLKKSGKLFKLRVDVNLSSSILDTPDFFWSIEPSLHPLYIAMREYLEIDKRVQVV 595

Query: 557 NDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSFII 608
           NDRCKVFLEFFDICVDSVAERNMAR+TWWF+ VI + VL S+ EI +R  II
Sbjct: 596 NDRCKVFLEFFDICVDSVAERNMARVTWWFVVVIIIGVLFSLTEITIRYNII 647

>TPHA0A06010 Chr1 (1359051..1360922) [1872 bp, 623 aa] {ON}
           Anc_3.568 YFR048W
          Length = 623

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/618 (55%), Positives = 416/618 (67%), Gaps = 58/618 (9%)

Query: 24  ILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASSRGSMRGNSASGSDLGP 83
           ILVTD+RS++ RI APF              +++  + G SA SR     NS++G    P
Sbjct: 32  ILVTDSRSNRNRINAPFARHAAGLR------DRNSNFVGPSADSRK----NSSNGVFASP 81

Query: 84  MRRSRAKLRQQ------GKFSDISIDNILSDVSDVPSGRRE--------ERLSISSHEMA 129
               +  +  +      G+FS IS+DNILSD SDVPSGRRE        +RLS+     A
Sbjct: 82  KSHQKLHMNNKHDQVLRGRFSGISVDNILSDSSDVPSGRREERRSSSSWDRLSVYEKFKA 141

Query: 130 PFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPED------SDRKNNALQMERRRPLKYN 183
                  P Q  K +N LP RTSKTS+KLVLIPED      S   +N  Q     P+K +
Sbjct: 142 ------YPNQ--KKLNHLPSRTSKTSQKLVLIPEDIPGSEYSSPLSNLRQKPVSSPIKQS 193

Query: 184 RHD-----------PDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEX 232
           R +           P  Q NYD+ + R+TAYN+A+   + S S FL+ TH+VS RLY+E 
Sbjct: 194 RINSTDYYDSSKIRPHNQ-NYDD-LPRLTAYNIADALNLKSISKFLKETHEVSSRLYNEC 251

Query: 233 XXXXXXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMN 292
                      GKDGFRIKSN+SKK IGGKTLID LID SEQRDHHYEYYSG+E  ED +
Sbjct: 252 LYVAYTLPLLSGKDGFRIKSNISKKVIGGKTLIDELIDTSEQRDHHYEYYSGIENPEDAS 311

Query: 293 NNFELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAV 352
           NN+EL   A      ND    PDHLP+  +N+T +F+P +PQ+FAEE     + +     
Sbjct: 312 NNYELE--ANGIPAENDVTVIPDHLPS-VTNSTDAFNPGDPQYFAEETPSEKKLREKKEE 368

Query: 353 GNRSQNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNM 412
              +Q        L    + + QHAEIFIF YGV+VFWNF EIQEKNILGD+AFA+  N+
Sbjct: 369 IQINQKVNKAISLL----TDEDQHAEIFIFHYGVIVFWNFQEIQEKNILGDVAFADSKNL 424

Query: 413 IIRPLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFE 472
           + RPL E+DIE EQFHF YD + ERP IFND +TLRSGDHI+KLTLSH+IAQS+KLSRFE
Sbjct: 425 LTRPLSEEDIEIEQFHFAYDRHTERPSIFNDTITLRSGDHIMKLTLSHAIAQSSKLSRFE 484

Query: 473 SRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSF 532
           SR++PIL +++KLPKRLALYGTLGLKREQLLK+SGKLFKLRVDVNLSSSVLDTPEFFWS 
Sbjct: 485 SRVTPILHSITKLPKRLALYGTLGLKREQLLKRSGKLFKLRVDVNLSSSVLDTPEFFWSL 544

Query: 533 EPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFV 592
           EPSLHPLY+AMREYLEIDQRVQVLNDRC VFLEFFDICVDSVAER++ R+TWWF+ VI +
Sbjct: 545 EPSLHPLYIAMREYLEIDQRVQVLNDRCMVFLEFFDICVDSVAERSIVRVTWWFVFVIII 604

Query: 593 SVLVSICEIIVRSFIIRQ 610
            V+ S+ EI +R  +I +
Sbjct: 605 CVIFSLIEIFIRYILINK 622

>KAFR0J00170 Chr10 complement(27714..29537) [1824 bp, 607 aa] {ON}
           Anc_3.568 YFR048W
          Length = 607

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/626 (55%), Positives = 421/626 (67%), Gaps = 50/626 (7%)

Query: 8   QEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASS 67
           + G   + SM +RSPSILVTD+RSSK R+ APF                    QG     
Sbjct: 10  RNGSSTQPSMPKRSPSILVTDSRSSKNRMSAPFAGHAAFGTNSSVDPRTGRPPQG----- 64

Query: 68  RGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISSHE 127
                GNS        +  +R + RQ GKFSDIS+DNIL+D S+VPSGRREER S SS +
Sbjct: 65  -AFNDGNSTKMYRPKVINNTRIR-RQPGKFSDISLDNILADNSEVPSGRREERRSNSSWD 122

Query: 128 MAPFAH---HSSPGQYTKLINPLPPRTSKTSKKLVLIPED---SDRKNNAL--QMERRRP 179
             P  +   H+S  +  K++NPLP RTSK S+KLVLIPE+     RK N L  Q   +RP
Sbjct: 123 RFPIGNERLHASSLK-KKMMNPLPTRTSKISQKLVLIPEEELQKGRKANFLKEQSHTKRP 181

Query: 180 ----LKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDEXXXX 235
               ++YN       +     + R+TAYN+AEGF +   S+FL  THDVSPRLYD+    
Sbjct: 182 SLGNIEYNF------KKTVNNLPRLTAYNIAEGFNLKVLSNFLEETHDVSPRLYDDCLYV 235

Query: 236 XXXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVE----TVEDM 291
                   G+DGFR+KSN+SK+ +GGKTLIDRLID SEQRDHHYE++SGVE    +  D 
Sbjct: 236 PYILPLLPGRDGFRVKSNISKRIVGGKTLIDRLIDTSEQRDHHYEFFSGVEDEVNSGPDT 295

Query: 292 NNNFELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGR----DTDQSK 347
            NN    D    +    + L   D L  N+ N    FDPSEPQFFAE+      DT   +
Sbjct: 296 RNN--PHDKLNVNQVNTEELGPTDMLSINAVNQDV-FDPSEPQFFAEDSATQTMDTSNVE 352

Query: 348 NISAVGNRSQNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFA 407
           N S   +R  N       LE     + QHAEIFIF YGV+VFWNFTE+QEKN+L DI+F 
Sbjct: 353 NSSLTSSRQAN-------LE----EEDQHAEIFIFHYGVIVFWNFTEMQEKNVLADISFF 401

Query: 408 EHDN-MIIRPLDEQDIETEQFHFEYDM-NVERPRIFNDIVTLRSGDHIIKLTLSHSIAQS 465
           E    ++++PLDEQDIETE+FHFEY+  N ERPRIFNDI+TLRS DH+IKLTLS++IAQS
Sbjct: 402 EDTKRLVLKPLDEQDIETEEFHFEYNKDNNERPRIFNDIITLRSHDHMIKLTLSYAIAQS 461

Query: 466 TKLSRFESRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDT 525
           +KLSRFESRISP+   V KLPKRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSS++LDT
Sbjct: 462 SKLSRFESRISPLFTAVIKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSNILDT 521

Query: 526 PEFFWSFEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWW 585
           P FFWS EPSLHPLY+AMREYLEID+RVQV+NDRCKVFLEFFDICVDSVAE+N+AR+T W
Sbjct: 522 PGFFWSIEPSLHPLYVAMREYLEIDKRVQVVNDRCKVFLEFFDICVDSVAEKNIARVTLW 581

Query: 586 FIAVIFVSVLVSICEIIVRSFIIRQL 611
           F+ VI V VL S  EI+VR  II  L
Sbjct: 582 FLVVIIVGVLFSFTEIVVRYNIIHNL 607

>YFR048W Chr6 (246146..248134) [1989 bp, 662 aa] {ON}  RMD8Cytosolic
           protein required for sporulation
          Length = 662

 Score =  434 bits (1116), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 220/236 (93%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +HAEIFIF YGV+VFWNFTEIQEKNILGDI FA++ N++IRPLDEQDIETEQFHFEYD +
Sbjct: 423 RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRD 482

Query: 435 VERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYGT 494
            ERPRIFNDIVTLRSGDHII+LTLSH+IAQS+KLSRFESRISPIL +V+KLPKRLALYGT
Sbjct: 483 TERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGT 542

Query: 495 LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRVQ 554
           LGLKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLY+AMREYLEIDQRVQ
Sbjct: 543 LGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQ 602

Query: 555 VLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSFIIRQ 610
           VLNDRCKVFLEFFDICVDSVAERNMAR+TWWFI VI   V+ S+ EI VR  II +
Sbjct: 603 VLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHR 658

 Score =  271 bits (694), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 175/351 (49%), Positives = 212/351 (60%), Gaps = 47/351 (13%)

Query: 8   QEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASS 67
           Q  PG    M +RSPSILVTDAR+SK R+ APF                     G +A S
Sbjct: 7   QPSPG---EMPKRSPSILVTDARTSKNRMSAPFA--------------------GHAAGS 43

Query: 68  RGSM------RGNSASGSDLGP---MRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRRE 118
           R +M      +      S +GP      +  + R  G+FSDISIDNILSD SD+PS RRE
Sbjct: 44  RKNMENAGVTKSQGVRSSAIGPSPLQSFTHPRRRSSGRFSDISIDNILSDNSDIPSARRE 103

Query: 119 ERLSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKN------NAL 172
           ERLS SS +      +       K+INPLPPRTSKTS+KLVLIPED +  +      NAL
Sbjct: 104 ERLSSSSSDRP--RQYERLSSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNAL 161

Query: 173 QMERRRP----LKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRL 228
             +R+RP    +K N  D   + + ++ M+RITAYNVA+GF ++    FL+ TH+VSPRL
Sbjct: 162 --DRQRPKVGSMKSNSFDRLPRYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRL 219

Query: 229 YDEXXXXXXXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETV 288
           YDE            GK GFRIKSN+SKKT+GGKTLID LID SEQRDHHYEYYSGVETV
Sbjct: 220 YDECLYVAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETV 279

Query: 289 EDMNNNFELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEE 339
           ED NNN+EL  +   +N   D+   PDHLP N      SF+P EPQFFAEE
Sbjct: 280 EDANNNYELETSGNNNNANQDTTTVPDHLP-NPVGQQDSFNPMEPQFFAEE 329

>Skud_6.139 Chr6 (241140..243125) [1986 bp, 661 aa] {ON} YFR048W
           (REAL)
          Length = 661

 Score =  432 bits (1111), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 202/244 (82%), Positives = 221/244 (90%)

Query: 367 ENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQ 426
           +N      +HAEIFIF YGV+VFWNFTEIQEKNILGDI FA++ N+ IRPLDEQDIETEQ
Sbjct: 414 DNEHEGNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYRNLTIRPLDEQDIETEQ 473

Query: 427 FHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLP 486
           FHFEYD + ERPRIFNDIVTLRSGDHII+LTLSH+IAQS+KLSRFESRISPIL +V+KLP
Sbjct: 474 FHFEYDRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLP 533

Query: 487 KRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREY 546
           KRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLY+AMREY
Sbjct: 534 KRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREY 593

Query: 547 LEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSF 606
           LEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMAR+TWWFI VI   V+ S+ EI VR  
Sbjct: 594 LEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEICVRYV 653

Query: 607 IIRQ 610
           II +
Sbjct: 654 IIHR 657

 Score =  281 bits (719), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 214/349 (61%), Gaps = 43/349 (12%)

Query: 8   QEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFXXXXXXXXXXXXXXEKSDTYQGFSASS 67
           Q  PG    M +RSPSILVTDAR+SKKR+ APF                     G +A S
Sbjct: 7   QPSPG---EMPKRSPSILVTDARTSKKRMSAPFA--------------------GHAAGS 43

Query: 68  RGSM------RGNSASGSDLGP---MRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRRE 118
           R +M      R   A  S++GP   + +   + R  G+FSDISIDNILSD S +PS RRE
Sbjct: 44  RKTMENKDLARSQGARSSNIGPSPLLNQPHPRRRSSGRFSDISIDNILSDNSGIPSARRE 103

Query: 119 ERLSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSD----RKNNALQM 174
           ERLS SS +     H+     + K+INPLPPRTSKTS+KLVLIPED D    +      +
Sbjct: 104 ERLSSSSSDRP--RHYERLNSHRKMINPLPPRTSKTSQKLVLIPEDDDLNHFKTMPTKAL 161

Query: 175 ERRRP----LKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYD 230
           +R+RP    ++ N  D   + + ++ M+RITAYNVA+GF ++    FL+ TH+VSPRLYD
Sbjct: 162 DRQRPKVGSMRTNSFDRLPRHSREKSMARITAYNVADGFNLNHLYKFLQDTHEVSPRLYD 221

Query: 231 EXXXXXXXXXXXXGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVED 290
           E            GK GFRIKSN+SKKT+GGKTLID LID SEQRDHHYEYYSGVETVED
Sbjct: 222 ECLYVAYTLPLLPGKGGFRIKSNISKKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVED 281

Query: 291 MNNNFELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEE 339
            NNN+EL    G +    D+   PDHLP N      SF+P EPQFFAEE
Sbjct: 282 ANNNYELETNGGNNTTNQDTTIVPDHLP-NPVGQQDSFNPMEPQFFAEE 329

>YDL001W Chr4 (447984..449276) [1293 bp, 430 aa] {ON}
           RMD1Cytoplasmic protein required for sporulation
          Length = 430

 Score =  180 bits (457), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 144/230 (62%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +H ++FIF YGVVV W FTE +EK  L DI   E +      L E+DI+ E+F++ Y   
Sbjct: 201 KHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEK-----LAEEDIQVEEFNY-YVTK 254

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G ++++KL++SH+IAQS K+S FE  +   +     +P+ +A  G
Sbjct: 255 SYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAYSG 314

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 315 KVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 373

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
            +LN R +V  +   +  + +   +   + +  I ++ V VL+S+  I+V
Sbjct: 374 SLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVEVLISVINIVV 423

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 56/134 (41%), Gaps = 22/134 (16%)

Query: 113 PSGRREERLSISSHEMA-PFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPED------- 164
           P   R+ R S +   M  P +  S  G   +       RTS+T++KL L+PE+       
Sbjct: 38  PQDTRKSRASYTGSAMINPTSKQSRTGSGAQ-------RTSRTAQKLKLLPEEPFQRDSE 90

Query: 165 --SDRKNNAL--QMERRRPLKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFL-- 218
             +D KN  +  Q+ R +     R      + +   + R TAY  A  + M     +L  
Sbjct: 91  RLTDLKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLPRSTAYCTASSYNMKELVRWLKD 150

Query: 219 -RYTHDVSPRLYDE 231
            R  H   P+L+DE
Sbjct: 151 CRKLHHTHPKLFDE 164

>Suva_4.252 Chr4 (445183..446475) [1293 bp, 430 aa] {ON} YDL001W
           (REAL)
          Length = 430

 Score =  180 bits (457), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 144/230 (62%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +H ++FIF YGVVV W FTE +EK  L DI   E +      L E+DI+ E+F++ Y   
Sbjct: 201 KHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEK-----LAEEDIQVEEFNY-YVTK 254

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G ++++KL++SH+IAQS K+S FE  +   +     +P+ +A  G
Sbjct: 255 SYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAYSG 314

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 315 KVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 373

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
            +LN R +V  +   +  + +   +   + +  I ++ V VL+S+  I+V
Sbjct: 374 SLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVEVLISVINIVV 423

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 56/134 (41%), Gaps = 22/134 (16%)

Query: 113 PSGRREERLSISSHEMA-PFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPED------- 164
           P   R+ R S +   M  P +  S  G   +       RTS+T++KL L+PE+       
Sbjct: 38  PQDTRKSRASYTGSAMINPISKQSRTGAGAQ-------RTSRTAQKLKLLPEEPFQRDDE 90

Query: 165 --SDRKNNAL--QMERRRPLKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFL-- 218
             +D KN  +  Q+ R +     R      + +   + R TAY  +  + M     +L  
Sbjct: 91  GLTDLKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLPRSTAYCTSSSYNMKELIRWLKD 150

Query: 219 -RYTHDVSPRLYDE 231
            R  H   P+L+DE
Sbjct: 151 CRKIHHTHPKLFDE 164

>Skud_4.253 Chr4 (439498..440790) [1293 bp, 430 aa] {ON} YDL001W
           (REAL)
          Length = 430

 Score =  180 bits (456), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 144/230 (62%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +H ++FIF YGVVV W FTE +EK  L DI   E +      L E+DI+ E+F++ Y   
Sbjct: 201 KHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEK-----LAEEDIQVEEFNY-YVTK 254

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G ++++KL++SH+IAQS K+S FE  +   +     +P+ +A  G
Sbjct: 255 SYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAYSG 314

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 315 KVSMGKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 373

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
            +LN R +V  +   +  + +   +   + +  I ++ V VL+S+  I+V
Sbjct: 374 SLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVEVLISVINIVV 423

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 58/134 (43%), Gaps = 22/134 (16%)

Query: 113 PSGRREERLSISSHEMA-PFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPED------- 164
           P   R+ R+S + + M  P +  S  G   +       RTS+T++KL L+PE+       
Sbjct: 38  PQETRKSRVSYTGNAMINPISKQSRTGAGAQ-------RTSRTAQKLKLLPEEPFQRDDE 90

Query: 165 --SDRKNNAL--QMERRRPLKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFL-- 218
             +D KN  +  Q+ R +     R      + +   + R TAY  A  + M     +L  
Sbjct: 91  GLTDLKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLPRSTAYCTASSYNMKELIRWLKD 150

Query: 219 -RYTHDVSPRLYDE 231
            R  H   P+L+DE
Sbjct: 151 CRKIHHTHPKLFDE 164

>Smik_4.235 Chr4 (427186..428481) [1296 bp, 431 aa] {ON} YDL001W
           (REAL)
          Length = 431

 Score =  180 bits (456), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/230 (39%), Positives = 144/230 (62%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +H ++FIF YGVVV W FTE +EK  L DI   E +      L E+DI+ E+F++ Y   
Sbjct: 202 KHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEK-----LAEEDIQVEEFNY-YVTK 255

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G ++++KL++SH+IAQS K+S FE  +   +     +P+ +A  G
Sbjct: 256 SYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAYSG 315

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 316 KVSMSKEDIMKSIGELFILRININLHGSILDSPEIMWS-EPQLEPIYQATRGYLEINQRV 374

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
            +LN R +V  +   +  + +   +   + +  I ++ V VL+S+  I+V
Sbjct: 375 SLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVEVLISVINIVV 424

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 58/143 (40%), Gaps = 22/143 (15%)

Query: 104 NILSDVSDVPSGRREERLSISSHEMA-PFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIP 162
           NI       P   R+ R S +   M  P +  S  G   +       RTS+T++KL L+P
Sbjct: 30  NIRRKYVPTPQDTRKSRASYTGSAMINPISKQSRTGAGAQ-------RTSRTAQKLKLLP 82

Query: 163 ED---------SDRKNNAL--QMERRRPLKYNRHDPDGQENYDEEMSRITAYNVAEGFEM 211
           E+         ++ KN  +  Q+ R +     R      + +   + R TAY  A  + M
Sbjct: 83  EEPFQRDGDGLTELKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLPRSTAYCTASSYNM 142

Query: 212 SSTSDFL---RYTHDVSPRLYDE 231
                +L   R  H   P+L+DE
Sbjct: 143 KELIRWLKDSRKLHHTHPKLFDE 165

>NCAS0A10120 Chr1 (2022090..2023361) [1272 bp, 423 aa] {ON}
           Anc_3.209
          Length = 423

 Score =  179 bits (455), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 145/233 (62%), Gaps = 8/233 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +H+E+FIF YGVVV W FTE +EK  L D+   E +      L ++DI+ E+F++ Y   
Sbjct: 194 KHSELFIFEYGVVVMWGFTEREEKCFLTDLERFEKEK-----LADEDIQVEEFNY-YVTK 247

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G ++++KL++SH+IAQS K+S FE  +   +     +P+ +A  G
Sbjct: 248 SYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIASSG 307

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 308 KVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 366

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSF 606
            +LN R +V  +   +  + +   +   + +  I ++ V VL+S+  I V  F
Sbjct: 367 ALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIILVGVEVLISVINIAVDMF 419

>SAKL0C11286g Chr3 complement(1012631..1013917) [1287 bp, 428 aa]
           {ON} highly similar to uniprot|Q05210 Saccharomyces
           cerevisiae YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 428

 Score =  179 bits (453), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 91/230 (39%), Positives = 144/230 (62%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  ++FIF YGV+V W FTE +EK +L D+   E +      L E+D++ EQF++ Y   
Sbjct: 199 KQPDLFIFEYGVIVMWGFTEREEKALLNDVEKFEKEK-----LAEEDVQVEQFNY-YITQ 252

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G +++IKL++SH+IAQS K+S FE  +   +     +P+ +A  G
Sbjct: 253 SYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIASSG 312

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 313 KVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 371

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
            +LN R +V  +   +  + +   +   + +  I ++ V VL+S+  IIV
Sbjct: 372 ALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIIIVLVGVEVLISVINIIV 421

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 13/97 (13%)

Query: 148 PPRTSKTSKKLVLIPEDS-DRKNNALQMERRRPLKYNRHDPDGQENYDEE---------M 197
           P RTS+T++KL L+PE+   RK+  L++  +          D     D E         +
Sbjct: 66  PQRTSRTAQKLKLLPEEPFQRKDEELELVDKDVYSQVNRITDKPARRDAEKLGKGHRHLL 125

Query: 198 SRITAYNVAEGFEMSSTSDFL---RYTHDVSPRLYDE 231
            R+TAY  A  + M     +L   +  H    +L+DE
Sbjct: 126 PRVTAYCTASSYSMKELIRWLKDCKRIHHTHTKLFDE 162

>Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {ON}
           YDL001W - Hypothetical ORF [contig 32] FULL
          Length = 408

 Score =  176 bits (446), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 144/230 (62%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  ++FIF YGVVV W FTE +EK  L D+   E +      L E+D++ EQF++ Y   
Sbjct: 179 KQPDLFIFEYGVVVMWGFTEREEKAFLNDLEKFEKEK-----LAEEDVQLEQFNY-YITQ 232

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G +++IKL++SH+IAQS K+S FE  +   +     +P+++A  G
Sbjct: 233 SYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQQIASSG 292

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 293 KVSMGKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLEINQRV 351

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
            +LN R +V  +   +  + +   +   + +  I ++ V VLVS+  IIV
Sbjct: 352 ALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIIIVLVGVEVLVSLINIIV 401

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 20/101 (19%)

Query: 148 PPRTSKTSKKLVLIPEDS-DRKNNALQMERRRPLKYN---------RHDPD----GQENY 193
           P RTS+T++KL L+PE+  +R+ + L     R +            R D +    GQ + 
Sbjct: 45  PQRTSRTTQKLKLLPEEPFNRQQDELLSSTDREVYSQVGRITDTPARRDAEKLGKGQRHL 104

Query: 194 DEEMSRITAYNVAEGFEMSSTSDFL---RYTHDVSPRLYDE 231
              + R+TAY  +  + M     +L   +  H   P+L+DE
Sbjct: 105 ---LPRVTAYCTSSSYNMKELIRWLKDCKKVHHTHPKLFDE 142

>Kpol_1045.58 s1045 (139327..140670) [1344 bp, 447 aa] {ON}
           (139329..140672) [1344 nt, 448 aa]
          Length = 447

 Score =  176 bits (447), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 93/233 (39%), Positives = 143/233 (61%), Gaps = 8/233 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  ++FIF YGVVV W FTE +EK  L DI   E +      L E+D++ E+F++ Y   
Sbjct: 216 KQPDVFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEK-----LAEEDVQVEEFNY-YITE 269

Query: 435 VERPRIFNDIVTLR-SGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR + +++IKL++SH +AQS K+S FE  +   +     +P+ +A  G
Sbjct: 270 SYQPRIYNDFITLRDASNYMIKLSISHGLAQSVKISLFEELVDNTIEDTQDIPQEIASSG 329

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y AMR YLEI+QRV
Sbjct: 330 KVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQAMRGYLEINQRV 388

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSF 606
            +LN R +V  +   +  + +   +   + +  I ++ V VLVSI  I V  F
Sbjct: 389 ALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIILVGVEVLVSIINIAVDLF 441

>NDAI0A07350 Chr1 complement(1671549..1673117) [1569 bp, 522 aa]
           {ON} Anc_3.209
          Length = 522

 Score =  177 bits (448), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 146/236 (61%), Gaps = 8/236 (3%)

Query: 372 SKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEY 431
           S +++ ++FIF YGV+V W FTE +EK  L D+   E +      L E+DI+ E+F++ Y
Sbjct: 289 SDKRYPDLFIFEYGVIVMWGFTEREEKRFLNDLEKFEKEK-----LAEEDIQIEEFNY-Y 342

Query: 432 DMNVERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLA 490
                +PRI+ND +TLR G +++ KL++SH+IAQS K+S FE  +   +     +P+ +A
Sbjct: 343 VTKSYQPRIYNDFITLRDGSNYMTKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIA 402

Query: 491 LYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEID 550
             G + + +E+++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+
Sbjct: 403 SSGKVSMTKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEIN 461

Query: 551 QRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSF 606
           QRV +LN R +V  +   +  + +   +   + +  I ++ V V++S+  I V  F
Sbjct: 462 QRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIFLVAVEVIISLVNIAVDMF 517

>TBLA0A00170 Chr1 (16781..18298) [1518 bp, 505 aa] {ON} Anc_3.209
           YDL001W
          Length = 505

 Score =  176 bits (445), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 142/227 (62%), Gaps = 8/227 (3%)

Query: 378 EIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMNVER 437
           ++FIF YGV+V W F E +E+ +L DI   E +      L E+DI+ E+F++ Y     +
Sbjct: 279 DLFIFEYGVIVMWGFIEREEQALLADIERFEREK-----LAEEDIQIEEFNY-YVTQSYQ 332

Query: 438 PRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYGTLG 496
           PRI+ND +TLR G ++++KL++SH+IAQS K+S FE  +   +     +P+ +AL G + 
Sbjct: 333 PRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQGIPQEIALSGKVS 392

Query: 497 LKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRVQVL 556
           + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV +L
Sbjct: 393 MSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRVALL 451

Query: 557 NDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
           N R +V  +   +  + +   +   + +  I ++ V VL+S+  I V
Sbjct: 452 NQRLEVISDLLQMLKEQLGHSHEEYLEFIVIVLVGVEVLISLINIAV 498

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 16/100 (16%)

Query: 148 PPRTSKTSKKLVLIPE------------DSDRKNNALQMERRRPLKYNRHDPDG-QENYD 194
           P RTS+T++KL L+PE            D   +        R   K  R D +   + + 
Sbjct: 140 PQRTSRTARKLKLLPEGPFQMTPAEFQTDIFPEQEVYSQVNRITDKNARRDAEKLGKAHR 199

Query: 195 EEMSRITAYNVAEGFEMSSTSDFLRYT---HDVSPRLYDE 231
             + R TAY  A  + M     +L+ T   H  +P+L+DE
Sbjct: 200 HLLPRTTAYCTASSYNMRGLIHWLKETKKAHQTTPKLFDE 239

>KLTH0G16544g Chr7 complement(1435479..1436705) [1227 bp, 408 aa]
           {ON} similar to uniprot|Q05210 Saccharomyces cerevisiae
           YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 408

 Score =  173 bits (439), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 143/230 (62%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  ++FIF YGV+V W FTE +EK  L D+   E +      L E+D++ EQF++ Y   
Sbjct: 179 KQPDLFIFEYGVIVMWGFTEREEKAFLNDVEKFEKEK-----LAEEDVQVEQFNY-YITQ 232

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G ++++KL++SH+IAQS K+S FE  +   +     +P+++A  G
Sbjct: 233 SYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQQIASSG 292

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +  ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 293 KVSMGKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLEINQRV 351

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
            +LN R +V  +   +  + +   +   + +  I ++ V VL+S+  I+V
Sbjct: 352 ALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIIIVLVGVEVLISLINIVV 401

>TDEL0D04130 Chr4 (760040..761356) [1317 bp, 438 aa] {ON} Anc_3.209
           YDL001W
          Length = 438

 Score =  174 bits (440), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 142/230 (61%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  E++IF YGV+V W FTE +EK  L D+   E +      L E+D++ E+F++ Y   
Sbjct: 209 KQPELYIFEYGVIVLWGFTEREEKAFLNDLERFEKEK-----LAEEDVQVEEFNY-YVTQ 262

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G +++IKL++SH+IAQS K+S FE  +   +     +P+ +A  G
Sbjct: 263 SYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIACSG 322

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 323 KVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLEINQRV 381

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
            +LN R +V  +   +  + +   +   + +  I ++ + VL+++  I V
Sbjct: 382 ALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGMEVLIAVVNIAV 431

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 13/95 (13%)

Query: 150 RTSKTSKKLVLIPEDSDRKNNALQMERRRPL---------KYNRHDPDG-QENYDEEMSR 199
           RTS+T++KL L+PE+  +++  +Q  R R +         K  R D +   + +   + R
Sbjct: 78  RTSRTAQKLKLLPEEPFQRDEEMQELRDRDVYSQVSRITDKPARRDAEKLGKGHRHLLPR 137

Query: 200 ITAYNVAEGFEMSSTSDFL---RYTHDVSPRLYDE 231
            TAY  A  + M     +L   R  H   P+L+DE
Sbjct: 138 ATAYCTASSYHMKELIKWLKDCRKIHHTHPKLFDE 172

>Ecym_5293 Chr5 (595331..596764) [1434 bp, 477 aa] {ON} similar to
           Ashbya gossypii AEL004W
          Length = 477

 Score =  173 bits (438), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 89/230 (38%), Positives = 142/230 (61%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  ++FIF YGVVV W FTE +EK  L D+   E +      L E+D++ E+F++ Y   
Sbjct: 246 KQPDLFIFEYGVVVMWGFTEREEKAFLNDVEKFEKEK-----LAEEDVQVEEFNY-YVTQ 299

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G +++IKL++SH+I+QS K+S FE  +   +     +P+ +A  G
Sbjct: 300 SYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEELVDNTIEDTQDIPQEIASSG 359

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +  ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 360 KVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 418

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
            +LN R +V  +   +  + +   +   + +  I ++ V VL+S+  IIV
Sbjct: 419 ALLNQRLEVVSDLLQMLKEQLGHSHEENLEFIVILLVGVEVLISLINIIV 468

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 16/113 (14%)

Query: 134 HSSPGQYTKLINPLPPRTSKTSKKLVLIPEDS---DRKNNALQMERRRPLKYNRHDPDGQ 190
           H  P   T      P RTS+T++KL L+PE+     R+ +   ++R    + NR   D  
Sbjct: 98  HVKPTNNTATTKLGPQRTSRTAQKLKLLPEEPFQRIREQDCDIIDRDVYSQVNRIT-DKP 156

Query: 191 ENYDEE---------MSRITAYNVAEGFEMSSTSDFLRY---THDVSPRLYDE 231
              D E         + R TAY  A  + M     +L+Y   TH   P+L+DE
Sbjct: 157 ARRDAEKLGKSQRHLLPRATAYCTASSYNMKELVRWLKYCKKTHHTHPKLFDE 209

>AEL004W Chr5 (630125..631552) [1428 bp, 475 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL001W (RMD1)
          Length = 475

 Score =  172 bits (437), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 89/230 (38%), Positives = 142/230 (61%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  ++FIF YGVVV W FTE +EK  L D+   E +      L E+D++ E+F++ Y   
Sbjct: 246 KQPDLFIFEYGVVVMWGFTEREEKAFLNDLERFEKEK-----LAEEDVQVEEFNY-YITQ 299

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G +++IKL++SH+I+QS K+S FE  +   +     +P+ +A  G
Sbjct: 300 SYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEELVDNTIEDTQDIPQEIASSG 359

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +  ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 360 KVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 418

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
            +LN R +V  +   +  + +   +   + +  I ++ V VL+S+  IIV
Sbjct: 419 ALLNQRLEVVSDLLQMLKEQLGHSHEENLEFIVILLLGVEVLISVVNIIV 468

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 14/98 (14%)

Query: 148 PPRTSKTSKKLVLIPED-----SDRKNNALQME-----RRRPLKYNRHDPDG-QENYDEE 196
           P RTS+T++KL L+PE+      +++++++  E      R   K  R D +   +++   
Sbjct: 112 PQRTSRTAQKLKLLPEEPFQRSQEQEDDSVDREVYSQVNRITDKPARRDAEKLGKSHRHL 171

Query: 197 MSRITAYNVAEGFEMSSTSDFL---RYTHDVSPRLYDE 231
           + R+TAY  A  + M     +L   + TH   P+L+DE
Sbjct: 172 LPRVTAYCTASSYNMKELVRWLKDCKRTHHTHPKLFDE 209

>KNAG0K01490 Chr11 (310336..311553) [1218 bp, 405 aa] {ON} Anc_3.209
           YDL001W
          Length = 405

 Score =  171 bits (432), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 145/235 (61%), Gaps = 10/235 (4%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  ++F+F YGVVV W FTE +EK  L DI   E +      L ++D++ E+F++ Y   
Sbjct: 177 KQPDLFVFEYGVVVMWGFTEREEKAFLSDIDRFEKEK-----LADEDVQVEEFNY-YVTQ 230

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G ++++KL+++H+IAQS K+S FE  +   +     +P+ +AL G
Sbjct: 231 SYQPRIYNDFITLRDGSNYMVKLSIAHAIAQSVKISFFEELVDNTIEDTQDIPQEIALSG 290

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E+++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 291 KVSMTKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 349

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSFII 608
            +LN R +V  +   +  + +   +   +   FI +I V V V I  + V S II
Sbjct: 350 ALLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVIILVGVEVVISLVNVFSDII 402

>KAFR0F02500 Chr6 complement(484705..486105) [1401 bp, 466 aa] {ON}
           Anc_3.209 YDL001W
          Length = 466

 Score =  172 bits (435), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 143/230 (62%), Gaps = 8/230 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  ++FIF YGV+V W FTE +EK  L DI   E +      L E+D++ E+F++ Y   
Sbjct: 237 KQPDLFIFEYGVIVMWGFTEREEKAFLNDIERFEKEK-----LAEEDVQVEEFNY-YVTQ 290

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR+G +++ KL++SH+IAQS K+S FE  +   +     +P+++A  G
Sbjct: 291 SYQPRIYNDFITLRNGSNYMTKLSISHAIAQSVKISLFEELVDNTIEDTEDIPQQIASSG 350

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E +++  G+LF LR+++NL  SVLD+P+  WS EP L P+Y A R YLEI+QRV
Sbjct: 351 KVSMSKEDIMRSIGELFILRININLHGSVLDSPDIMWS-EPQLEPIYQATRGYLEINQRV 409

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIV 603
           ++LN R +V  +   +  + +       + +  I ++ V VL+S+  I V
Sbjct: 410 ELLNQRLEVVSDLLQMLKEQLGHSQEEYLEFIVIILVGVEVLISVINIAV 459

>TPHA0P00550 Chr16 complement(110346..111686) [1341 bp, 446 aa] {ON}
           Anc_3.209 YDL001W
          Length = 446

 Score =  171 bits (433), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 141/233 (60%), Gaps = 8/233 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  ++FIF YGVVV W FTE +EK  L DI   E +      L E+DI+ E+F++ Y   
Sbjct: 217 KQPDVFIFEYGVVVLWGFTEREEKEFLNDIEKYEKEK-----LAEEDIQIEEFNY-YVTE 270

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G +++ KL++SH+++QS K+S FE  +   +     +P+ +A  G
Sbjct: 271 SYQPRIYNDFITLRDGSNYMTKLSISHALSQSVKISLFEELLDNTIEDTQDIPQEIASSG 330

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 331 KVSMSKEDIMKSIGELFILRININLHGSILDSPEIMWS-EPQLEPIYQATRGYLEINQRV 389

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSF 606
            +LN R +V  +   +  + +       + +  I ++ V VL+S+  I V  F
Sbjct: 390 ALLNQRLEVVSDLLQMLKEQLGHTQEEYLEFIVIVLVGVEVLLSVINISVDLF 442

>ZYRO0A04400g Chr1 (359271..360647) [1377 bp, 458 aa] {ON} similar
           to uniprot|Q05210 Saccharomyces cerevisiae YDL001W RMD1
           Cytoplasmic protein required for sporulation
          Length = 458

 Score =  171 bits (433), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 141/228 (61%), Gaps = 8/228 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +  ++F+F YGVVV W FTE +EK  L DI   E +      L E+D++ E+F++ Y   
Sbjct: 229 KQPDLFVFEYGVVVLWGFTEREEKAFLNDIEGFEKEK-----LAEEDVQIEEFNY-YVTQ 282

Query: 435 VERPRIFNDIVTLR-SGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR + +++IKL++SH+IAQS K+S FE  +   +     +P+ +A  G
Sbjct: 283 SYQPRIYNDFITLRDASNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIASSG 342

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 343 KVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 401

Query: 554 QVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEI 601
            +LN R +V  +   +  + +   +   + +  I ++ V V++S+  I
Sbjct: 402 ALLNQRLEVVSDLLQMLKEQLGHSHEEYLEFIVILLVGVEVIISVVNI 449

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 41/95 (43%), Gaps = 13/95 (13%)

Query: 150 RTSKTSKKLVLIPEDS-DRKNNALQMERRRPLKYNRHDPDGQENYDEE---------MSR 199
           RTS+T++KL L+PE+   R   +L +  R          D     D E         + R
Sbjct: 98  RTSRTAQKLKLLPEEPFQRDEESLDLRDRDVYSQVNRITDKPARRDAEKLGKSHRHLLPR 157

Query: 200 ITAYNVAEGFEMSSTSDFLRYT---HDVSPRLYDE 231
            TAY  A G+ M     +L+     H   P+L+DE
Sbjct: 158 ATAYCTASGYSMRELVRWLKECKKIHHTHPKLFDE 192

>CAGL0M10483g Chr13 complement(1049771..1051069) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|Q03441 Saccharomyces
           cerevisiae YDL001w
          Length = 432

 Score =  169 bits (428), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 130/202 (64%), Gaps = 8/202 (3%)

Query: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434
           +H +IFIF YGV+V W FTE +EK  L D+   E +      L E+DI+ E+F++ Y   
Sbjct: 203 KHPDIFIFEYGVIVLWGFTEREEKAFLNDLEKFEKEK-----LAEEDIQIEEFNY-YVTQ 256

Query: 435 VERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYG 493
             +PRI+ND +TLR G +++IKL++SH+IAQS K+S FE  +   +     +P+ +A  G
Sbjct: 257 SYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIASSG 316

Query: 494 TLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRV 553
            + + +E+++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 317 KVSMSKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 375

Query: 554 QVLNDRCKVFLEFFDICVDSVA 575
            +LN R +V  +   +  + + 
Sbjct: 376 ALLNQRLEVISDLLQMLKEQLG 397

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 13/95 (13%)

Query: 150 RTSKTSKKLVLIPEDSDRKNNALQMERRRPL---------KYNRHDPDG-QENYDEEMSR 199
           RTS+T++KL L+PE++  ++  +   R R +         K  R D +   + +   + R
Sbjct: 72  RTSRTAQKLKLLPEEAFHRDEEVSELRDRDVYSQVNRITDKNARRDAEKLGKAHRHLLPR 131

Query: 200 ITAYNVAEGFEMSSTSDFL---RYTHDVSPRLYDE 231
            T+Y  A  + M     +L   + TH   P+L+DE
Sbjct: 132 CTSYCTASSYNMKDLIRWLKDSKKTHHTHPKLFDE 166

>KLLA0E17381g Chr5 complement(1540387..1541721) [1335 bp, 444 aa]
           {ON} similar to uniprot|Q05210 Saccharomyces cerevisiae
           YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 444

 Score =  165 bits (417), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 130/206 (63%), Gaps = 8/206 (3%)

Query: 371 SSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFE 430
           S+  +  ++FIF YGV+V W FTE +EK  L D+   E +      L E+D++ EQF++ 
Sbjct: 211 STSDKQPDLFIFEYGVIVMWGFTEREEKAFLRDLERFEKEK-----LAEEDVQVEQFNY- 264

Query: 431 YDMNVERPRIFNDIVTLRSG-DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRL 489
           Y     +PRI+ND +TLR G +++IKL++SH+IAQS K+S FE  +   +     +P+ +
Sbjct: 265 YITQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEI 324

Query: 490 ALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEI 549
           A  G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI
Sbjct: 325 ASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEI 383

Query: 550 DQRVQVLNDRCKVFLEFFDICVDSVA 575
           +QRV ++N R +V  +   +  + + 
Sbjct: 384 NQRVALVNQRLEVISDLLQMLKEQLG 409

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 24/131 (18%)

Query: 124 SSHEMAPFAHHSSPGQYTKLINPL---------PPRTSKTSKKLVLIPEDSDRKNNALQM 174
           S+ E A  A      Q   +++PL         P RTS+ ++KL L+P+++  + N    
Sbjct: 49  SATETANVARKPQQQQENTILDPLLPKVSTKVGPQRTSRKAQKLKLLPDEAFERINEDDA 108

Query: 175 ERRRPL---------KYNRHDPDG-QENYDEEMSRITAYNVAEGFEMSSTSDFL----RY 220
            + R +         K  R D +   +N    + R+TAY  A  ++M     +L    R+
Sbjct: 109 PQDRDVYSQVNRITDKPARRDAEKLGKNQRHLLPRVTAYCTASLYKMKELIRWLKDCKRF 168

Query: 221 THDVSPRLYDE 231
            H   P+L+DE
Sbjct: 169 NH-THPKLFDE 178

>YDR282C Chr4 complement(1023511..1024755) [1245 bp, 414 aa] {ON}
           Putative protein of unknown function
          Length = 414

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 107/243 (44%), Gaps = 41/243 (16%)

Query: 385 GVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHF---EYDMNVERPRIF 441
           G +V W F+E   +N +  I  A   N    PL+ +D ETE   +   E + + ++    
Sbjct: 161 GSIVSWGFSESSVRNCIVPIVKAASLN----PLNGEDFETEDMDYVEIEGEQDFDKLSSL 216

Query: 442 NDIVTLR-------SGDHII------------KLTLSHSIAQSTKLSRFESRISPILGTV 482
           ++ VT R       SGD II            K   S  +++ST L+  E  +   +   
Sbjct: 217 DNKVTPRIACESFLSGDLIIINSLDSDQGMLDKAAFSSGLSRSTNLAVLEEAMEKHISKT 276

Query: 483 SKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLA 542
             + + ++    L L+    LK  G+LF +R  +NL S +++TP+ +WS EP L  ++  
Sbjct: 277 RTITENISKGTKLNLRSSDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLEEIFKN 335

Query: 543 MREYLEIDQRVQVLN-------DRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVL 595
           +  YL+I  R+ +LN       D C+  +   +       ERN   + W  I +I   + 
Sbjct: 336 VSRYLDIGPRINILNSKLDYSTDECRALISLLN-------ERNSTFLEWIIIYLIAFELC 388

Query: 596 VSI 598
             I
Sbjct: 389 FEI 391

>Skud_4.545 Chr4 complement(966078..967319) [1242 bp, 413 aa] {ON}
           YDR282C (REAL)
          Length = 413

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 105/235 (44%), Gaps = 41/235 (17%)

Query: 385 GVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHF-EYDMNVERPRIF-- 441
           G +V W F E   +N +  +  A      I PL E+D ETE   + E +   +  ++F  
Sbjct: 161 GSIVGWGFGESTVRNKIVPLVKAAS----INPLSEEDFETEDMDYVELEKKKDLEKLFSG 216

Query: 442 NDIVTLR-------SGDHII------------KLTLSHSIAQSTKLSRFESRISPILGTV 482
           N  VTL+       SGD I+            K   S  +++ST L+  E  +   +   
Sbjct: 217 NKNVTLKTVDQSFLSGDLILINSLDSDQGMLDKAAFSSGLSRSTNLAVLEEAMERHISKT 276

Query: 483 SKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLA 542
             + + ++   TL LK    LK  G+LF +R  +NL S +++TP+ +WS EP L  ++  
Sbjct: 277 RTITENISKGTTLKLKSSDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLELIFKN 335

Query: 543 MREYLEIDQRVQVLN-------DRCKVFLEFFDICVDSVAERNMARITWWFIAVI 590
           +  YL+I  R+ +LN       D C+  +   +       ER    + W  I +I
Sbjct: 336 VSRYLDIVPRINILNSKLDYSTDECRALISLLN-------ERKGTFLEWIIIYLI 383

>Suva_2.448 Chr2 complement(788042..789295) [1254 bp, 417 aa] {ON}
           YDR282C (REAL)
          Length = 417

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 108/254 (42%), Gaps = 45/254 (17%)

Query: 385 GVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHF-----EYDM------ 433
           G +V W F E    + + D      +   I PL ++D ETE   +     + D+      
Sbjct: 161 GSIVSWGFGE----STVRDKIVPLVEGASINPLAKEDFETEDMDYVELAKKQDLEKFFSG 216

Query: 434 -NVERPRIFNDIVTLRSGDHII------------KLTLSHSIAQSTKLSRFESRISPILG 480
            N  +PR  N+  +  SGD I+            K   S  +++ST L+  E  +   + 
Sbjct: 217 NNEVKPRFVNE--SFLSGDLILINSLDADQGMLDKAAFSSGLSRSTNLAVLEEALEKHIS 274

Query: 481 TVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY 540
               + + ++    L LK    LK  G+LF +R  +NL S + +TP+ +WS EP L  ++
Sbjct: 275 KTRTITENISKGTKLNLKSSDALKSIGRLFLIRGKLNLYSELTETPDLYWS-EPQLEEIF 333

Query: 541 LAMREYLEIDQRVQVLN-------DRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVS 593
             +  YL+I  R+ +LN       D C+  +   +       ERN A + W  I +I   
Sbjct: 334 KKVSRYLDIGPRINILNSKLDYSTDECRALISLLN-------ERNGAFLEWIIIYLIAFE 386

Query: 594 VLVSICEIIVRSFI 607
           +   +     R ++
Sbjct: 387 LCFEVYHFYQRYYL 400

>Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AAL122C
          Length = 366

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 102/230 (44%), Gaps = 26/230 (11%)

Query: 385 GVVVFWNFTEI-QEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMNVERPRIFND 443
           G VV W   E  Q +NIL  +     D   I PL E+  E+E   +      E     +D
Sbjct: 118 GTVVAWGLDESSQMENILPLV-----DEARINPLKEKQYESEDLDYVELDTTESWTQLHD 172

Query: 444 IV-------TLRSGDHII------------KLTLSHSIAQSTKLSRFESRISPILGTVSK 484
           I        +   GD I+            K  LS  +++ST+LS  E+ +   +    K
Sbjct: 173 ITNRGEANESFVEGDLIVINSISANHGMLDKAALSGGLSRSTRLSVLEAALESHIAKTKK 232

Query: 485 LPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMR 544
             + L+    L      +L+ +G+LF +R ++NL S +++TP+ +WS EP L  LY  + 
Sbjct: 233 FTELLSSGKKLNFTENHILESTGRLFLIRGNLNLYSELIETPDLYWS-EPDLEKLYEKIS 291

Query: 545 EYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSV 594
             L+I  R+ +LN +     +     +  + E+   ++ W  I +I V V
Sbjct: 292 RNLDIQPRITILNKKLDYATDESRALLSVLNEKKSTKLEWIIIWLISVEV 341

>KLLA0C11165g Chr3 complement(957421..958491) [1071 bp, 356 aa] {ON}
           similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 356

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 108/223 (48%), Gaps = 14/223 (6%)

Query: 385 GVVVFWNFTE-IQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN-VERPRIFN 442
           G +V W F E +    IL  ++ A  ++++    + +D++  +   E DMN ++R    N
Sbjct: 107 GSIVSWGFNETVMRDEILPLVSTARVNSLLDSQYESEDLDYVELENEDDMNNLKRDYSIN 166

Query: 443 D-------IVTLRSGDH----IIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLAL 491
           D       ++ +   +H    + K   S  I++ST+L+  E  +   +    +  + L+ 
Sbjct: 167 DESCVTNELIIINGVEHEKALLDKAAFSSGISRSTRLAVLEVALDAHIEKTREFTESLSR 226

Query: 492 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQ 551
              L +  + +L+ +G+LF +R  +NL S +++TP+ +WS EP L  LY  +   L+I  
Sbjct: 227 GKKLNISEKAVLQSTGRLFLMRGKLNLYSELIETPDLYWS-EPQLEKLYRQISRNLDIQP 285

Query: 552 RVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSV 594
           R+ +LN +     +     +  + E+   R+ W  I +I V V
Sbjct: 286 RISILNTKLDYATDEARALMAVLNEKKGTRLEWIIIYLITVEV 328

>Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON}
           YDR282C (REAL)
          Length = 414

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 107/252 (42%), Gaps = 41/252 (16%)

Query: 385 GVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHF-EYDMNVERPRIFN- 442
           G +V W F E   +N +  +  A      I PL  Q+ ETE   + E + N +  + FN 
Sbjct: 161 GSIVSWGFDESSVRNKIVPLIEAAS----INPLSAQNFETEDMDYVELEKNQDLEKYFNR 216

Query: 443 ----------------DIVTLRSGD----HIIKLTLSHSIAQSTKLSRFESRISPILGTV 482
                           D++ + S D     + K   S  +++ST L+  E  +   +   
Sbjct: 217 NSKLTPKNADQSFLCGDLILINSLDSDQGMLDKAAFSSGLSRSTNLAVLEEAMEKHILKT 276

Query: 483 SKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLA 542
             + + ++    L LK    LK  G+LF +R  +NL S +++TP+ +WS EP L  ++  
Sbjct: 277 RTITENISRGTKLNLKSSDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLEEIFKN 335

Query: 543 MREYLEIDQRVQVLN-------DRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVL 595
           +  YL+I  R+ +LN       D C+  +   +       ERN   + W  I +I   + 
Sbjct: 336 VSRYLDIAPRINILNSKLDYSTDECRALISLLN-------ERNSTFLEWIIIYLIAFELC 388

Query: 596 VSICEIIVRSFI 607
             I     + F+
Sbjct: 389 FEIYHFYQKHFL 400

>Kwal_23.5643 s23 complement(1249364..1250488) [1125 bp, 374 aa]
           {ON} YDR282C - Hypothetical ORF [contig 11] FULL
          Length = 374

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 130/300 (43%), Gaps = 32/300 (10%)

Query: 319 NNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPYMESQSLENYGSSKQQH-- 376
           N +S N +SF  + P      G   D +K I+ +     +P  +S   +   + K  H  
Sbjct: 63  NMASVNLSSFLKTRPCTTITTGESYDLNKVINNLHTSGYHP--KSLVPDEIVTFKYFHNG 120

Query: 377 --AEIFIF-SYGVVVFWNFTE-IQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHF--- 429
             ++I I  + G VV W   E    +NIL  I  A      I PL E  +E+E   +   
Sbjct: 121 YRSDIMILGNSGTVVSWGIDESFTLENILPLIQSAR-----INPLAENAMESEDLDYLEI 175

Query: 430 EYDMNVERPR-----------IFNDIVTLRSGD----HIIKLTLSHSIAQSTKLSRFESR 474
           E   ++ER R           +  D++ + S D     + K   S  I++ST+L+  E  
Sbjct: 176 ESIEDLERVRHTLSRSVDGSFVEGDLIVVNSIDPELGLLDKAAFSSGISRSTRLAILEEL 235

Query: 475 ISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEP 534
           +   +    K  + L+    L L    +L+ +G LF +R  +NL S + +TP+ +WS EP
Sbjct: 236 LEAHIEKTRKFTENLSDGKRLNLTESMVLRSTGSLFLIRGKLNLYSELTETPDLYWS-EP 294

Query: 535 SLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSV 594
            L  +Y  M   L+I  R+ +LN +     E     +  + E+    + W  I +I V V
Sbjct: 295 QLERIYKQMSRSLDIQPRIAILNTKLDYATEESRAFMAVLNEKKGTHLEWIIIYLITVEV 354

>KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 392

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 109/243 (44%), Gaps = 32/243 (13%)

Query: 376 HAEIFIF-SYGVVVFWNFTE-IQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDM 433
           H++I +  + G VV W   E    +NIL  I   EH    + PL E+ +E+E   F   +
Sbjct: 136 HSDIMVLGNSGTVVAWGLEESFVFENILPLI---EHGR--VNPLTEECVESEDLDF---L 187

Query: 434 NVERPRIFNDI--VTLRS-------GDHII------------KLTLSHSIAQSTKLSRFE 472
            VE       +  +T RS       GD II            K   S  +++ST+L+  E
Sbjct: 188 QVENAEDLEKVRQITNRSAPESFVEGDLIIVNAIDSDLGLLDKAAFSSGMSRSTRLAVLE 247

Query: 473 SRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSF 532
             +   +    K  + L+    L L   ++L+ +G LF +R  +NL S +++TP+ +WS 
Sbjct: 248 HLLEAHIEKSRKFTELLSQGKKLSLTESEVLQSTGSLFLIRGKLNLYSELIETPDLYWS- 306

Query: 533 EPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFV 592
           EP L  +Y  M   L+I  R+ +LN +     E     +  + E+    + W  I +I V
Sbjct: 307 EPQLERIYKQMSRSLDIQPRISILNTKLDYATEESRAFMAVLNEKKSTHLEWIIIYLITV 366

Query: 593 SVL 595
            V 
Sbjct: 367 EVF 369

>SAKL0G10582g Chr7 (900403..901554) [1152 bp, 383 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 383

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 107/229 (46%), Gaps = 25/229 (10%)

Query: 385 GVVVFWNFTE-IQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHF---EYDMNVERPR- 439
           G VV W F E    +NIL  I+ A      + PL  +  E+E   +   E  + +E+ + 
Sbjct: 146 GSVVSWGFDETCLTENILPLISPAR-----VNPLAPKQFESEDMDYVELENSIELEQLKS 200

Query: 440 ----------IFNDIVTLRSGDH----IIKLTLSHSIAQSTKLSRFESRISPILGTVSKL 485
                     I  D++ + S D     + K   S  +++ST+L+  E  +   +    + 
Sbjct: 201 VTHKIDDGSFIEGDLIVINSTDSEQGLLDKAAFSSGMSRSTRLAVLEGALETHIEKTREF 260

Query: 486 PKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMRE 545
            + L++   L L    +LK +G+LF +R  +NL S +++TP+ +WS EP L  +Y  + +
Sbjct: 261 TELLSVGKKLNLTESDVLKYTGRLFLMRGKLNLYSELIETPDLYWS-EPRLEKIYKQISK 319

Query: 546 YLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSV 594
            L+I  R+ +LN +     +     +  + E+   R+ W  I +I + V
Sbjct: 320 NLDIHPRITILNTKLDYATDESRALMAVLNEKKSTRLEWIIIYLITIEV 368

>TPHA0D01710 Chr4 complement(356399..357559) [1161 bp, 386 aa] {ON}
           Anc_5.291 YDR282C
          Length = 386

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 103/233 (44%), Gaps = 35/233 (15%)

Query: 385 GVVVFWNFTEIQEKNILGDIAFAEHDNMI-------IRPLDEQDIETEQFHF-------E 430
           G V+ W    + EK +L        DN I       I PLDE   ETE   F        
Sbjct: 146 GSVISWG---LNEKELL--------DNFIPILSEARINPLDESKYETEDIDFIEIENSKA 194

Query: 431 YDMNVER-----PRIFNDIVTLRSGD----HIIKLTLSHSIAQSTKLSRFESRISPILGT 481
              N+E        I +D++ + S D     + K   S  IA+ST L+  E+ +      
Sbjct: 195 LSKNMESHLHNGSYIMDDLLIVNSIDPELGLLDKAAFSSGIARSTSLAVLEAALEEHTQK 254

Query: 482 VSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYL 541
              + ++ +    + LK +  L   GKLF +R  +NL S++++TP+ +WS EP L  +Y 
Sbjct: 255 SRIITEKFSRGIQINLKEKHFLTSIGKLFLIRGRLNLYSNIIETPDLYWS-EPRLEKIYK 313

Query: 542 AMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSV 594
            +  +L+I  R+ +LN +     +   + +  + E+    + W  I +I V V
Sbjct: 314 NVSHFLDIAPRINILNSKLDYCTDHSRMLLSVLNEKKGTFLEWIIIYLITVEV 366

>AAL122C Chr1 complement(132431..133531) [1101 bp, 366 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR282C
          Length = 366

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 109/242 (45%), Gaps = 26/242 (10%)

Query: 385 GVVVFWNFTEIQEK-NILGDIAFAEHDNMIIRPLDEQDIETEQFHF-------EYD---- 432
           G VV W F E   K +IL  I     D     PL +   E+E   +       E+     
Sbjct: 119 GSVVSWGFDEASHKQHILPLI-----DGARTNPLPQSLYESEDLDYVEIESKEEWSQISS 173

Query: 433 -MNV---ERPRIFNDIVTL--RSGDH--IIKLTLSHSIAQSTKLSRFESRISPILGTVSK 484
            +NV   E+  I  D++ +   SGD   + K   S  I++ST L+  E  +   + +   
Sbjct: 174 LVNVSGLEQSFIKEDLIVVDRTSGDKDMLDKAAFSSGISRSTMLAVLERNMEAHIESTRS 233

Query: 485 LPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMR 544
             + L+    L +   ++LK +G+LF +R  +NL S +++TP+ +WS EP+L  +Y  + 
Sbjct: 234 FTELLSKGNRLNITEAEILKSTGRLFLMRGKLNLYSELIETPDLYWS-EPTLETIYKQVS 292

Query: 545 EYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVR 604
             L++  R+ +LN +     +     +  + E+   R+ W  I +I V V   +     R
Sbjct: 293 RNLDVPARISILNKKLDYATDESRALMSVLNEKKSTRLEWIIIYLITVEVCFELHHFYER 352

Query: 605 SF 606
            F
Sbjct: 353 FF 354

>Kpol_1033.6 s1033 complement(11719..12930) [1212 bp, 403 aa] {ON}
           complement(11719..12930) [1212 nt, 404 aa]
          Length = 403

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 104/241 (43%), Gaps = 23/241 (9%)

Query: 385 GVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHF-------EYDMNV-- 435
           G VV W F E    N L +      ++ II PL     E+E   F       E  + +  
Sbjct: 154 GSVVSWGFDE----NTLTNNILPLIESAIINPLVPDKYESEDLDFIELDNEDETTLKLLP 209

Query: 436 -----ERPRIFNDIVTLRSGDH----IIKLTLSHSIAQSTKLSRFESRISPILGTVSKLP 486
                E   I  D++ + S D     + K   S  I++ST L+  ES +   +     + 
Sbjct: 210 SGDANEASFIAEDVIVINSIDQTSGLLDKAAFSSGISRSTSLAVLESALEEHINRSRIIT 269

Query: 487 KRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREY 546
           + ++    + L     LK  G+LF +R  +NL S +++TP+ +WS EP L  +Y  + +Y
Sbjct: 270 ESVSNGKKMNLNERDFLKSIGRLFLIRGKLNLYSEIIETPDLYWS-EPQLEKIYKNVSKY 328

Query: 547 LEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSF 606
           L++  R+ +LN +     +     +  + ER    + W  I +I   V   +     +++
Sbjct: 329 LDVVPRINILNSKLDYSTDESRALLAVLNERKSTFLEWIIIYLIAFEVCFELYHYYEKNY 388

Query: 607 I 607
           I
Sbjct: 389 I 389

>CAGL0H01045g Chr8 complement(98818..99903) [1086 bp, 361 aa] {ON}
           similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282c
          Length = 361

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 82/168 (48%), Gaps = 19/168 (11%)

Query: 439 RIFNDIVTLRSGDH----IIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYGT 494
           R+  D++ + S +     + K   S  +++ST L+  E+ +   +     + ++++    
Sbjct: 182 RLIGDVILINSIEKSEGILDKAAFSSGLSRSTALAVLENAMERHISNTRIITEKISTGIK 241

Query: 495 LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRVQ 554
           L +K    LK  G+LF +R  +NL S +++TP+ +WS EP L  ++  +  YL+I  R+ 
Sbjct: 242 LKVKESDALKSIGRLFLIRGRLNLYSELIETPDLYWS-EPELEIIFKDVSRYLDISPRIN 300

Query: 555 VLN-------DRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVL 595
           +LN       D C+  L   +       ERN + + W  I +I   V+
Sbjct: 301 ILNSKLDYSTDECRAILSLLN-------ERNSSFLEWIIIYLITFEVI 341

>TDEL0E03360 Chr5 (635665..636882) [1218 bp, 405 aa] {ON} Anc_5.291
           YDR282C
          Length = 405

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 106/250 (42%), Gaps = 35/250 (14%)

Query: 387 VVFWNFTE-IQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMNVERPRIFN--- 442
           VV W F E    +NIL  +  A      I PL +   ETE   +    N E+ +  N   
Sbjct: 152 VVSWGFDETFVSQNILHLVEEAR-----INPLAQDAFETEDMDYVEVENYEQFQSINSKA 206

Query: 443 ---------------------DIVTLRSGD----HIIKLTLSHSIAQSTKLSRFESRISP 477
                                D++ + S D     + K   S  +A+ST L+  E+ +  
Sbjct: 207 SSSATVGATLAKYGETSFLAGDLIVINSTDPDSGMLYKAAYSSGLARSTSLAVLENSMEA 266

Query: 478 ILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLH 537
            +     + ++++    L L   + L+  G+LF +R  +NL S +++TP+ +WS EP L 
Sbjct: 267 HISRTRIITEKISRGVKLNLNEGEALRSIGRLFLIRGRLNLYSELIETPDLYWS-EPLLE 325

Query: 538 PLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVS 597
            ++     YL+I  R+ +LN +     +     +  ++E+    + W  I +I + ++  
Sbjct: 326 RIFKQTSRYLDIGPRINILNTKLDYSTDECRALMGVLSEKKGTFLEWIIIYLISLEIIFE 385

Query: 598 ICEIIVRSFI 607
           I     R ++
Sbjct: 386 IYHFYERYYL 395

>ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]
           {ON} similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 401

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 102/229 (44%), Gaps = 28/229 (12%)

Query: 385 GVVVFWNFTEIQ-EKNILG------------------DIAFAEHDNMIIRPLDEQDIETE 425
           G ++ W F E    +NIL                   D+ + E +N     L  + ++ E
Sbjct: 147 GSIICWGFDEATVNQNILKLVEDARTNPLNPDEFESEDMDYVELEN----KLQLESVQLE 202

Query: 426 QFHFEYDMNVERPRIFNDIVTLRSGD----HIIKLTLSHSIAQSTKLSRFESRISPILGT 481
             +      +E   +  D++ + S D     + K   S   ++STKL+  E+ +   +  
Sbjct: 203 SANHAAVKYLETSLLVGDLILINSTDPGAGLLHKAAFSSGFSRSTKLAVLENAMERHIVE 262

Query: 482 VSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYL 541
              + ++++    L LKR   LK  G+LF +R  +NL S +++TP+ +WS EP L  ++ 
Sbjct: 263 TRIITEKVSKGVRLNLKRGDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLEKIFK 321

Query: 542 AMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVI 590
              +YL+I  R+ +LN +     E     +  ++E+N   +    I +I
Sbjct: 322 ETSKYLDIGPRINILNSKLDYSTEETRALMGVLSEKNSTVLELIIIYLI 370

>KAFR0E01530 Chr5 complement(309332..310423) [1092 bp, 363 aa] {ON}
           Anc_5.291 YDR282C
          Length = 363

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 105/236 (44%), Gaps = 25/236 (10%)

Query: 375 QHAEIFIF-SYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDM 433
           +   +FI  S G  V W      E+N+L        +N  I PL E + E E   +    
Sbjct: 108 EKGTVFIMGSDGATVSWGI----EENVLRSEIIPLIENACINPLSENEFEIEDMDYIELR 163

Query: 434 NVERPRIFNDIV------TLRSGDHII------------KLTLSHSIAQSTKLSRFESRI 475
             E      DI       +   GD I+            K+  S  +++ST L+  E+++
Sbjct: 164 KSEDLSFVQDICDREDDNSFLLGDLIMINSVGPLYGVMDKVAFSSGLSRSTMLAVLENKM 223

Query: 476 SPILGTVSKLPKRLALYGT-LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEP 534
              +    K+ ++++   T   +K + +L+  G+LF +R  +NL S +++TP+ +WS E 
Sbjct: 224 ETHIKETRKVTEKISKGVTNTKMKEKDVLRFIGRLFMIRGQLNLYSELIETPDLYWS-ET 282

Query: 535 SLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVI 590
            L  ++  +  YL++  R+ +LN +     E   + +  + ER  + + W  I +I
Sbjct: 283 QLEEIFKKISNYLDMKPRISILNSKLDYSTEECRLLISLLNERKSSFLEWIIIYLI 338

>Smik_13.74 Chr13 (130954..132708) [1755 bp, 584 aa] {ON} YML070W
           (REAL)
          Length = 584

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 64/152 (42%), Gaps = 33/152 (21%)

Query: 87  SRAKLRQQGKFSDISIDNILS-----DVSDVPSGRREERLSISSHEMAPFAHHSSPGQYT 141
           SR  L    K + I  DN+++     D   VP  + E  L+    E+     H+ PG   
Sbjct: 169 SRYGLDGTEKVAKIINDNLVTIGSSLDHCKVPGRKFESELNERQMELG-MGIHNEPG--V 225

Query: 142 KLINPLPPRTSKTSKKLV---LIPEDSDRKNNALQMERRRPLKYNRHDPDGQENYDEEMS 198
           K+++P+P      SK ++   L P D DR              + + D D     DE + 
Sbjct: 226 KVLDPIPSTEDLISKYMLPKLLDPNDKDRA-------------FVKFDED-----DEVVL 267

Query: 199 RITAYNVAEGFEMSS----TSDFLRYTHDVSP 226
            +        F ++S    T+DFL+ T+D++P
Sbjct: 268 LVNNLGGVSNFIITSIASKTTDFLKKTYDITP 299

>Kpol_1008.15 s1008 complement(26135..27874) [1740 bp, 579 aa] {ON}
           complement(26135..27874) [1740 nt, 580 aa]
          Length = 579

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 79  SDLGPMRRSRAKLRQQGKFSDISID----NILSDVSDVPSGRREE 119
           S+ GP+R+S+ K+       DI +D    NIL ++S +P  R  E
Sbjct: 6   SEFGPLRKSKGKVDSNKIIDDIKVDHEQSNILKNISLIPIKRNSE 50

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,957,753
Number of extensions: 2953019
Number of successful extensions: 14063
Number of sequences better than 10.0: 154
Number of HSP's gapped: 14460
Number of HSP's successfully gapped: 178
Length of query: 615
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 499
Effective length of database: 40,180,143
Effective search space: 20049891357
Effective search space used: 20049891357
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)