Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F16280g5.425ON47345121170.0
Kwal_55.214685.425ON4654557342e-91
YDR363W (ESC2)5.425ON4562564463e-49
Smik_4.6285.425ON4582574369e-48
ZYRO0F09812g5.425ON4162324277e-47
SAKL0G02266g5.425ON4842404318e-47
Suva_2.5345.425ON4522594201e-45
Ecym_55245.425ON4152284181e-45
Skud_4.6315.425ON4582564202e-45
KAFR0E038705.425ON3962444118e-45
TBLA0A037105.425ON4612333833e-40
AER251W5.425ON4072243592e-37
NDAI0B056005.425ON4572623526e-36
TPHA0E018105.425ON4532703394e-34
KLLA0E21275g5.425ON3922303338e-34
Kpol_1027.265.425ON4432553306e-33
NCAS0F033105.425ON4422523289e-33
TDEL0E020005.425ON4362442751e-25
CAGL0A02706g5.425ON3692362651e-24
KNAG0C049805.425ON3452412358e-21
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F16280g
         (473 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   820   0.0  
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   287   2e-91
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   176   3e-49
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   172   9e-48
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   169   7e-47
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   170   8e-47
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   166   1e-45
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   165   1e-45
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   166   2e-45
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   162   8e-45
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   152   3e-40
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   142   2e-37
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   140   6e-36
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   135   4e-34
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...   132   8e-34
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   131   6e-33
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   130   9e-33
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...   110   1e-25
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   106   1e-24
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...    95   8e-21

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/451 (90%), Positives = 407/451 (90%)

Query: 1   MAMSEERQTHTGLKGATVTGDIQDQISFTDANRTVGGYIEDEQATGIIHRGKAGLPRFSS 60
           MAMSEERQTHTGLKGATVTGDIQDQISFTDANRTVGGYIEDEQATGIIHRGKAGLPRFSS
Sbjct: 1   MAMSEERQTHTGLKGATVTGDIQDQISFTDANRTVGGYIEDEQATGIIHRGKAGLPRFSS 60

Query: 61  TVEVTKTGSSTESQMSTKENKTXXXXXXXXXXXXXXXXXXXXYISSKNNAETEAAPIVME 120
           TVEVTKTGSSTESQMSTKENKT                    YISSKNNAETEAAPIVME
Sbjct: 61  TVEVTKTGSSTESQMSTKENKTDDDQDLEDFNIDDDDFFYGDYISSKNNAETEAAPIVME 120

Query: 121 KNDDIEQLSRSAERTEQAPDVEYITSSSDEERDTINTDXXXXXXXXXDASLEELAQAPRL 180
           KNDDIEQLSRSAERTEQAPDVEYITSSSDEERDTINTD         DASLEELAQAPRL
Sbjct: 121 KNDDIEQLSRSAERTEQAPDVEYITSSSDEERDTINTDSRSKRRRRSDASLEELAQAPRL 180

Query: 181 AKSPRGHPRGSSRAVRTNSLPQHXXXXXXXXXXXXXXXASRTASTVKESSPAVAQRIYNI 240
           AKSPRGHPRGSSRAVRTNSLPQH               ASRTASTVKESSPAVAQRIYNI
Sbjct: 181 AKSPRGHPRGSSRAVRTNSLPQHEKDEDDKFFEELEREASRTASTVKESSPAVAQRIYNI 240

Query: 241 KFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDG 300
           KFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDG
Sbjct: 241 KFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDG 300

Query: 301 VKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEALYEQSKHSNHELVPAFIEPG 360
           VKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEALYEQSKHSNHELVPAFIEPG
Sbjct: 301 VKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEALYEQSKHSNHELVPAFIEPG 360

Query: 361 TETPDFTVEEYEKELRNVDFNKNTSVQNQPPPQSVDDNIRIALMSQDNKKIIVTARPETT 420
           TETPDFTVEEYEKELRNVDFNKNTSVQNQPPPQSVDDNIRIALMSQDNKKIIVTARPETT
Sbjct: 361 TETPDFTVEEYEKELRNVDFNKNTSVQNQPPPQSVDDNIRIALMSQDNKKIIVTARPETT 420

Query: 421 FAALAEHYQKLTSLPPQQQVLLFFDNEELHL 451
           FAALAEHYQKLTSLPPQQQVLLFFDNEELHL
Sbjct: 421 FAALAEHYQKLTSLPPQQQVLLFFDNEELHL 451

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  287 bits (734), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 175/455 (38%), Positives = 259/455 (56%), Gaps = 16/455 (3%)

Query: 3   MSEERQTHTGLKGATVTGDIQDQISFTDANRTVGGYIEDEQ-ATGIIHRGKAGLPRFSST 61
           M +E + HT LKGA +TGDIQ+QISF+DAN+T+GGYIE E  A   +   +  +P F+S+
Sbjct: 1   MVDEPRPHTALKGAKITGDIQEQISFSDANKTIGGYIEQEDVAADAVQVERNSMPIFTSS 60

Query: 62  VEVTKTGSSTESQMSTKENKTXXXXXXXXXXXXXXXXXXXXYISSKNNAETEAAPIVMEK 121
           ++  +  S+  + +S   N                      YIS+K+   T+    V+  
Sbjct: 61  IKEQRAASTASTGVSNT-NVPLEGDQHIEDDTDDDDFFYGDYISAKS-VTTDRETSVIVN 118

Query: 122 NDDIEQLSRSAERTEQAPDVEYITSSSDEERDTINTDXXXXXXXXXDASLEELAQAPRLA 181
               EQ   S + ++  P+++ IT SS +E++                S+  +  +P  A
Sbjct: 119 TSHSEQEKPSLKSSDTNPEIQEITDSSADEKE-----LDEKHTQKRRISVTSIEDSPEKA 173

Query: 182 KSPRGH----PRGSSRAVRTNSLPQHXXXXXXXXXXXXXXXASRTASTVKESSPAVAQRI 237
            SP G+     R + R++  N                    A RT ST+KE SPA A+R+
Sbjct: 174 -SPGGNHFTRSRTNKRSITANISLAAEDNEDEKFFEELQREAGRTTSTLKEGSPATAKRV 232

Query: 238 YNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKVTLY 297
           YNIKF+S+LEGS   +INVKVKGK +F +ILP+ALKT+IKEYK+   L P Y+ + V+LY
Sbjct: 233 YNIKFLSNLEGSLNDKINVKVKGKHAFSEILPIALKTLIKEYKVSKDLKPFYQPENVSLY 292

Query: 298 RDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEALYEQSKHSNHELVPAFI 357
           R+G+KILNFMNCNSL IPL ++GEVSDV +T++S+ +EQ +    EQS+H+  +L     
Sbjct: 293 RNGLKILNFMNCNSLHIPLNYEGEVSDVSMTLVSRDREQEYVKTLEQSRHATPDLSREET 352

Query: 358 EPGTETPDFTVEEYEKELRNVDFNK-NTSVQNQPPPQSVDDNIRIALMSQDNKKIIVTAR 416
            P  + P F++EE+EK+L   +  + N  +++ P  ++    I+IALM+QDNKKI V  R
Sbjct: 353 SP--KIPGFSIEEFEKDLEGFESGESNNLLEDTPQTENNHGTIKIALMAQDNKKIYVNVR 410

Query: 417 PETTFAALAEHYQKLTSLPPQQQVLLFFDNEELHL 451
             TT A L EHY+   +L   ++    FDNE+L L
Sbjct: 411 QTTTIAMLGEHYRTTKNLSSIERFKFVFDNEDLQL 445

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  176 bits (446), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 146/256 (57%), Gaps = 23/256 (8%)

Query: 219 ASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKE 278
           A ++ +  KES+P   +R+YNIKF+S LEG+  + + VKV GK  F +ILP AL  ++K 
Sbjct: 181 AKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALDGLMKS 240

Query: 279 YKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNF 338
           YKIP  +  IY+ + VTLY +  K+L FM CNSL IP +F+ EVSD+ +TI+SK  E+NF
Sbjct: 241 YKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKEYEKNF 300

Query: 339 EALYEQSK---------HSNHELVPAFIEPGTETPDFTVEEYEKELRNV----DFNKNTS 385
           EA  E                E+     +   E  +    E+E EL+NV    +  +N +
Sbjct: 301 EATLESKLKEEEAALLIKERQEMERKLEKKRNEQEESEYREFESELKNVEETQEIKENDT 360

Query: 386 VQNQPPPQ----------SVDDNIRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLP 435
           V N    Q          S+++ +RIALM QDNKKI V  R  T F+ +AE+Y+    LP
Sbjct: 361 VMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLP 420

Query: 436 PQQQVLLFFDNEELHL 451
            + +V L FD++EL +
Sbjct: 421 QKTRVKLLFDHDELDM 436

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  172 bits (436), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 145/257 (56%), Gaps = 25/257 (9%)

Query: 219 ASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKE 278
           A +T S  KES+P   +R+YNIKF+S LEG+  + + VKV GK  F +ILP AL  + K 
Sbjct: 183 AKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLTKS 242

Query: 279 YKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNF 338
           YKIP  +  IY+ + VTLY    K+L+FM CNSL IP +F+ EVSD+ +TI+SK  E+NF
Sbjct: 243 YKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSKEYEKNF 302

Query: 339 EALYEQSKH--------SNHELVPAFIE-PGTETPDFTVEEYEKELRNV----DFNKNTS 385
           EA  E              HE +   +E    E  +    E+E ELRNV    +  +N +
Sbjct: 303 EASLESKLKEEEAALLVKEHEEIERKLERKRNEQEESEYREFEFELRNVKEKQERTENET 362

Query: 386 VQNQPPPQSVDDNI-----------RIALMSQDNKKIIVTARPETTFAALAEHYQKLTSL 434
           V N    Q  DDN+           +IAL  QDNKKI V  R  T F+ +AE+Y+    L
Sbjct: 363 VINIKNLQE-DDNLLENNSDSEKVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQL 421

Query: 435 PPQQQVLLFFDNEELHL 451
           P + ++ L FD+++L +
Sbjct: 422 PQKARIKLLFDHDKLDM 438

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  169 bits (427), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 134/232 (57%), Gaps = 13/232 (5%)

Query: 227 KESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALH 286
           +E++P   +RIYN++F+S L+GS  + + +KV GK  F  +LP  L   I+EYKIP+ + 
Sbjct: 171 RETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMK 230

Query: 287 PIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEALYEQSK 346
            IY  + VTLY    K+LNFM CNSL+IP  F+ E+SD+ +T+I K +E  FE +     
Sbjct: 231 KIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQMINSRL 290

Query: 347 HSNHELVPAFIEPGTETPDFTVEEYEKELRNVDFNKNTSVQNQPPPQSVD-------DNI 399
             + +  P   E G    D  VEE+EKEL+NVD     S  N    + +D       D +
Sbjct: 291 LEDEQNPPDTAETG--NLDARVEEFEKELKNVD----NSTTNHETTELIDLEDEGDTDLM 344

Query: 400 RIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEELHL 451
           +IAL+ +DNKKI V  R  T    +AE+Y+    LP    + L FD+EEL+L
Sbjct: 345 KIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNL 396

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  170 bits (431), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 142/240 (59%), Gaps = 16/240 (6%)

Query: 219 ASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKE 278
           A+RT++ ++ESSP + +R Y I FIS L+GS  ++I VK  GK  F +ILP  L  I+K 
Sbjct: 234 ANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFTKILPSTLDAIVKA 293

Query: 279 YKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNF 338
           Y+IP A+  +Y+ D VTLY +G KILNFM CNSL+IP  +  E++DV +T++SK  E  +
Sbjct: 294 YRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDVDITLVSKEYEMKY 353

Query: 339 EALYEQSKHSNHELVPAFIE-PGTETPDFTVEEYEKELRNVDFNKNTSVQNQPPPQSVDD 397
           EA +++     +EL  + ++    +  DF   EYE +L         S   +P      +
Sbjct: 354 EAEFKE--MVENELSGSSVDVKNVKKDDFATNEYELQLEK-------SESAEPSLLKSSE 404

Query: 398 NIR------IALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEELHL 451
           NIR      +AL+ QDNKK+ V AR  T F  +A++Y+ + +LP   ++ L FD+  L L
Sbjct: 405 NIRDGSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 1/71 (1%)

Query: 3  MSEERQTHTGLKGATVTGDIQDQISFTDANRTVGGYIEDEQ-ATGIIHRGKAGLPRFSST 61
          MS E+Q+H GLKGATVT +I++ +SF++AN+T+GGY +D   A G     +  LPRFSS 
Sbjct: 1  MSREQQSHVGLKGATVTENIEENLSFSEANKTIGGYADDSGPADGATQNVRNQLPRFSSN 60

Query: 62 VEVTKTGSSTE 72
          +E +  GS +E
Sbjct: 61 IEYSAFGSRSE 71

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  166 bits (420), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 104/259 (40%), Positives = 147/259 (56%), Gaps = 29/259 (11%)

Query: 219 ASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKE 278
           A +T S  KES+P   +R+YNIKF S LEG+  + + VKV GK  F +ILP AL  ++K 
Sbjct: 177 AKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFSRILPAALDGLMKS 236

Query: 279 YKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNF 338
           YKIP  +  IY+ + VTLY +  K+L FM CNSL IP +F+ E+SD+ +TI+SK  E+NF
Sbjct: 237 YKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDIDITIVSKEYEKNF 296

Query: 339 EALYEQSKHSNHELVPAFIEPGTETPDFTVEE------------YEKELRNV----DFNK 382
           EA  E SK    E   A      +  +  +E+            +E ELRNV    +   
Sbjct: 297 EATLE-SKLKEEE--TALFAKERQEMEMKLEKKRNEREESEFREFEFELRNVEETEELKA 353

Query: 383 NTSVQNQPPPQ---SVDDN-------IRIALMSQDNKKIIVTARPETTFAALAEHYQKLT 432
           N +  N+   +   SV +N       ++IALM QDNKKI V  R  T F  +AE+Y+   
Sbjct: 354 NETFMNEHSLREGNSVKENNGGNEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQK 413

Query: 433 SLPPQQQVLLFFDNEELHL 451
            LP + ++ L FD++EL+L
Sbjct: 414 QLPQKARIKLLFDHDELNL 432

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  165 bits (418), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/228 (38%), Positives = 129/228 (56%), Gaps = 11/228 (4%)

Query: 233 VAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETD 292
           +   IYN+ FIS LEGS  +RINV++ GK+ F   LP+ALKT +KEYKI  +LH  Y+ D
Sbjct: 166 IGTNIYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQID 225

Query: 293 KVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEALYEQSKHSNHEL 352
            V +YR+GV+I  FM C+S  I   +     D+ + I+       FE  ++Q   +  + 
Sbjct: 226 NVKIYREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKR 285

Query: 353 VPAFIEP------GTE--TPDFTVEEYEKELRNVDFNKNTSVQ--NQ-PPPQSVDDNIRI 401
           V     P      G E    DF V EYEK+L N      T +Q  NQ   P   ++ I++
Sbjct: 286 VSISASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKV 345

Query: 402 ALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEEL 449
            L+  DNKK+ V  +P TTF  LAEHY+++  LPP  +++L FD++++
Sbjct: 346 VLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDI 393

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  166 bits (420), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 142/256 (55%), Gaps = 23/256 (8%)

Query: 219 ASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKE 278
           A +  +  KE +P   +R+YNIKF+S LEG+  + + VKV GK  F +ILP AL  ++K 
Sbjct: 183 AKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLVKS 242

Query: 279 YKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNF 338
           YKIP  +  IY+   VTLY +  K+LNFM CNSL I  +F+ E+SD+ +TI+SK  E+NF
Sbjct: 243 YKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEYEKNF 302

Query: 339 EALYEQSKHSN---------HELVPAFIEPGTETPDFTVEEYEKELRNV----DFNKNTS 385
           EA  E     +          E+     +   E  +    E+E ELRNV    +  +N  
Sbjct: 303 EATLESKLKEDEAALLVKQRQEIERKLEKKRNEQEESEYREFEFELRNVKETQELEENEI 362

Query: 386 VQNQPPPQ---SVDDN-------IRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLP 435
           + N  P Q   S+  N       I++ALM QDNKKI V  R  T    +AE+Y+    LP
Sbjct: 363 IINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLP 422

Query: 436 PQQQVLLFFDNEELHL 451
            + ++ L FD++EL++
Sbjct: 423 QKARIRLLFDHDELNM 438

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  162 bits (411), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 140/244 (57%), Gaps = 21/244 (8%)

Query: 219 ASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKE 278
           A + + T  ES+    +RIYNI+FIS L+GS  + + VKV GK  F +ILP ALK +I  
Sbjct: 143 AQKKSVTGTESAAKRPKRIYNIRFISKLDGSINKSVKVKVLGKFPFSKILPAALKGLIDA 202

Query: 279 YKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNF 338
           YKIP  +  IY+ + V LY +  K+LNFM C+SL IPL F+ E+S+V + I+SK   +  
Sbjct: 203 YKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDSLSIPLAFENEISNVDILIVSKEFGEKL 262

Query: 339 E------ALYEQSKHSNHELVPAFIEPGTETPDFTVEEYEKELRNV-----DFNKNTSVQ 387
           E       L E++K    E     I+   E  DF ++E+E ELR+V     + + +T  +
Sbjct: 263 EKLDQMKTLQEEAKLERQEE----IKDVDEGDDFVLKEFEAELRDVAPSNANLSLDTDGE 318

Query: 388 NQPPPQSVDDNIRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNE 447
           +  P       +++ALM QDNKKI V  R  T  + L E+Y+K  +L    +V L FD++
Sbjct: 319 DSEPL------MKLALMGQDNKKIYVNVRSSTQISKLVEYYKKQKNLARNVKVKLLFDHD 372

Query: 448 ELHL 451
           EL L
Sbjct: 373 ELDL 376

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  152 bits (383), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 88/233 (37%), Positives = 134/233 (57%), Gaps = 22/233 (9%)

Query: 235 QRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKV 294
           +RIYN++FIS +EG+  +++ VKV GK  F +ILP ALK   +EYKIP+ L   Y  + V
Sbjct: 215 KRIYNVRFISKIEGTLDKKVQVKVLGKFPFSKILPPALKAFSEEYKIPNVLKQYYRVNNV 274

Query: 295 TLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEALYEQSKHSNHELVP 354
           TLY +  K+LNFM CNSL IP  ++ E+SDV + +I+K  E+++E     S   N E   
Sbjct: 275 TLYWNDSKLLNFMTCNSLNIPQIYENEISDVEIIVITKTNEKSYEDKINMSLKQNIE--Q 332

Query: 355 AFIEPGTETPDF-----------TVEEYEKELR-----NVDFNKNTSVQNQPPPQSVDDN 398
              +   E  +            +++E+EKEL+      VD  +  ++ + P     + +
Sbjct: 333 NLAQKSNEIKELRKLKVESFEHNSIQEFEKELKELSQDGVDTKQTANIDDIPN----ESH 388

Query: 399 IRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEELHL 451
           I+IAL++QDNKK+ V  R  T F+ L  ++++   L   QQ+ L FDNEEL L
Sbjct: 389 IKIALLTQDNKKLYVKVRNSTPFSELVNYFREQKQLGETQQIKLIFDNEELDL 441

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  142 bits (359), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 121/224 (54%), Gaps = 8/224 (3%)

Query: 236 RIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKVT 295
           R+YN+ FIS +EGS  RR+NVKV G++ F   L +AL    K++ I  +L P Y+ D+V 
Sbjct: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQFATFLAIALAAFSKQHNIRKSLKPKYQADQVK 223

Query: 296 LYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTII----SKGQEQNFEALYEQSKH--SN 349
           +YR+GV++  FM C+S  I   +    +D+ + I+    +   EQ ++  +E+     SN
Sbjct: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSN 283

Query: 350 HELVPAFIEPGTETPDFTVEEYEKELRNVDFNKNT--SVQNQPPPQSVDDNIRIALMSQD 407
              +    +   +  DF V EYEK L N      T  +V+   P       ++I L+  D
Sbjct: 284 SSFLEVMDDIEDDNDDFLVNEYEKALVNARSLNETELAVREGTPADESSQLLKIVLLGSD 343

Query: 408 NKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEELHL 451
           NKK+ +  RP TT   +AEHY+    LPP  Q+ L FD+EE+ L
Sbjct: 344 NKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDL 387

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  140 bits (352), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 94/262 (35%), Positives = 140/262 (53%), Gaps = 31/262 (11%)

Query: 219 ASRTASTVKESSP-AVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIK 277
           A +  S  KES+P  + +RIYNI+FIS L+G+  + + VKV GK  F +ILP AL  +IK
Sbjct: 178 AKKIPSLTKESTPDKLPKRIYNIRFISKLDGTMNKCVQVKVLGKFQFQKILPAALTGLIK 237

Query: 278 EYKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQE-Q 336
            Y IP  L   Y  D V+LY +  K+L+FM CNSL IP  F+ EV++V + +ISK  E +
Sbjct: 238 AYSIPSVLQKYYSVDNVSLYWNHAKLLDFMTCNSLNIPQAFENEVTNVDIELISKDDEIE 297

Query: 337 NFEALYEQSKHSNHELVPAFIEPGTETPDFTVEEYEK----------------------- 373
           N +A+ E+      E V   +E   +  +   E+  K                       
Sbjct: 298 NEKAITEKLLKDERE-VSLKLEAAKKEKEIQ-EKLAKELAKEEKENEVFEEFEHELENVS 355

Query: 374 ELRNVDFNKNTSVQNQPPPQSVD----DNIRIALMSQDNKKIIVTARPETTFAALAEHYQ 429
           EL+   ++ + S  N+    +++    D ++IAL+ QDNKKI V  R  T F+ +AE+Y+
Sbjct: 356 ELKTNGYDADASTVNEANELALEEGNADVMKIALVGQDNKKIHVNVRGTTPFSKVAEYYR 415

Query: 430 KLTSLPPQQQVLLFFDNEELHL 451
               LP   ++ L FD+EEL L
Sbjct: 416 IQKQLPQNAKIKLVFDHEELSL 437

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  135 bits (339), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 142/270 (52%), Gaps = 37/270 (13%)

Query: 219 ASRTASTVKES-SPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIK 277
           AS+  ST+  S +P +  R YNI +IS L GS  RRI  KV G Q+F ++LP  L T++K
Sbjct: 164 ASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFAKVLPPILNTLLK 223

Query: 278 EYKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQN 337
             KIP  L  +Y+ + VTLY +  K+LNFMNC+SL+IP  ++ E+S++ + +ISK +EQ 
Sbjct: 224 VNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNEISELEIILISKEEEQK 283

Query: 338 FEALYEQSKHSNHELVPAFIEPGTETP------DFTVEEYEKELRNV---DFNKNTSVQN 388
           FE  ++     + +L    IE   ++       + +  EYEKEL N    DFN    V +
Sbjct: 284 FEEQFKMQLLEDEQLSQKNIENFNDSNKPFDILNTSYNEYEKELENWNSKDFNVTNDVLD 343

Query: 389 QPPPQSVDDN---------------------------IRIALMSQDNKKIIVTARPETTF 421
               ++  +N                           I+I+LMS DNKKI V  R  T  
Sbjct: 344 VSNDENSSNNVKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDNKKIFVNVRSSTKI 403

Query: 422 AALAEHYQKLTSLPPQQQVLLFFDNEELHL 451
             L ++++K  +L   Q++ + FD++ L L
Sbjct: 404 QKLVDYFKKCKNLTSNQRIKVIFDHDVLSL 433

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score =  132 bits (333), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 126/230 (54%), Gaps = 15/230 (6%)

Query: 233 VAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETD 292
           V +RIYNI FIS LEGS  +R+NVKV G ++F+ ILP+ ++T I+ YKIP  L   Y   
Sbjct: 145 VTKRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPA 204

Query: 293 KVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEALYEQSKHSNHEL 352
           ++ L+R GV++L F NC+SL+IP       + V L I+      N++  Y++ + S    
Sbjct: 205 ELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESR--- 261

Query: 353 VPAFIEPGT-------ETP--DFTVEEYEKELRN---VDFNKNTSVQNQPPPQSVDDNIR 400
           + +F++          E P  D   + +EKEL +   +    +  +          ++IR
Sbjct: 262 LQSFLDESNIEEQDPLEQPARDEKFKLFEKELESAPKLAERTDDVIDLLDSDIESSNSIR 321

Query: 401 IALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEELH 450
           + L+ + NK+  ++  P TTF  +A  Y+ ++SL     VLL FDNEEL+
Sbjct: 322 LTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELN 371

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  131 bits (330), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 130/255 (50%), Gaps = 35/255 (13%)

Query: 229 SSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPI 288
           +S     RIYNI F S L+GS  +++  +V GKQ F +I+   L +  K YK+       
Sbjct: 171 TSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRN 230

Query: 289 YETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEA------LY 342
           Y+TD VT+Y D  K+L FM CNSL+IPLEF+ E+S + LTIISK  EQ FEA        
Sbjct: 231 YKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEV 290

Query: 343 EQSKHSNHELVPAFIEPGTETPDFTVEEYEKELRNVDFNKNTSVQNQPP-------PQSV 395
           +Q +++N   V +    G E+    ++E +K+    +   N S+    P       P  +
Sbjct: 291 DQKENTNKTEVGSSKNFGIES---QIDENKKKYEEYENELNESIPISVPSQGTAEDPMHI 347

Query: 396 DDN-------------------IRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPP 436
           D +                   +++AL+  DNKKI V AR  T F  LAE+Y     LP 
Sbjct: 348 DGDEENAVDIIGKATTDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPK 407

Query: 437 QQQVLLFFDNEELHL 451
             +V L FD+E++ L
Sbjct: 408 STKVKLIFDDEQIDL 422

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  130 bits (328), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 137/252 (54%), Gaps = 28/252 (11%)

Query: 227 KESSP-AVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDAL 285
           KE++P    +R+Y+I+F+S L+G+  + + VKV GK  F +ILP  L+ +IK Y IP  L
Sbjct: 172 KEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVL 231

Query: 286 HPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEA----- 340
              Y+ D VTLY +  K+LNFM CNSL IP  F+ EV++V + I+SK +E   E      
Sbjct: 232 QKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSKEKEIENENELRKK 291

Query: 341 --LYEQSKHSNHELVPAFIE----------PGTETPDFTVEEYEKELRNVDFNKNTSVQN 388
             L E++     +L     +            TE     + E+EKEL++    K++ V  
Sbjct: 292 LLLEEKAAQMKLDLEKEREKEGEKNKPKESKNTEYAK-AIAEFEKELKDATELKDSQVHG 350

Query: 389 QPPPQSVD----DN-----IRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQ 439
                +++    DN     ++IAL+  DNKKI V  R  T F+ LAE+Y+    LP   +
Sbjct: 351 GENDGNMNIDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAK 410

Query: 440 VLLFFDNEELHL 451
           + L FD++EL+L
Sbjct: 411 IQLMFDHDELNL 422

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score =  110 bits (275), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 132/244 (54%), Gaps = 25/244 (10%)

Query: 229 SSPA----VAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDA 284
           SSPA      Q+I+N+ F+S LEG+  R I +KV GK  F  IL   L+ +++E+KIP  
Sbjct: 178 SSPAKGTKARQKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLERVVEEFKIPYP 237

Query: 285 LHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEAL--- 341
           +   Y  D VTLY +G K+L FM C+SL+I      EV+++ +T++SK  E+ FE     
Sbjct: 238 VMHQYTVDNVTLYWNGGKLLKFMTCDSLKISNIDNNEVTEIEVTMVSKSDEERFEEEERA 297

Query: 342 ----YEQSKHSNHELVPAF-IEPGTET--PDFTVE--EYEKELRNVDFNKNTSVQNQPPP 392
                E+   S  +L   F  +P  +    D ++E  E +   R  +  + + +     P
Sbjct: 298 RLLRVEKEAMSKAKLPTTFEADPSDDNGEADCSIEIIEMDDSSRESEMKEGSKLA----P 353

Query: 393 QSVDDN-----IRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNE 447
             ++D      I++AL+ QDN ++ V  R  T F+ +AE+Y+    LP + ++ L+FD+E
Sbjct: 354 VDLEDEDELEVIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHE 413

Query: 448 ELHL 451
           +L L
Sbjct: 414 KLDL 417

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  106 bits (265), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/236 (29%), Positives = 122/236 (51%), Gaps = 25/236 (10%)

Query: 219 ASRTAST-VKESSPAVAQ-RIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTII 276
           A R+ S  V++ S AV Q ++Y ++FIS ++G+ G+ + VK  G   F +++  AL  ++
Sbjct: 132 AKRSQSLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFSKLVAAALSGLM 191

Query: 277 KEYKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQ 336
           + +++P  + P+Y+ + V  Y +  K+L FM C++L++P  +  +  ++ L  + +    
Sbjct: 192 RAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEIQLVPVKE---- 247

Query: 337 NFEALY-EQSKHSNHELVPAFIEPGTETPDFTVEEYEKELRN--VDFNKNTSVQNQPPPQ 393
             EA Y EQ      E  P   E   E  +  + +  KE+R   VD              
Sbjct: 248 --EAQYLEQEVFEEPERAPTPEEDAEEEFERELRD-AKEVRAPVVDLES----------- 293

Query: 394 SVDDNIRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEEL 449
             ++ +R+AL  QDNKK+ V  +P TTFA + E+Y+    LP   Q+ L  D+E L
Sbjct: 294 --EEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPL 347

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score = 95.1 bits (235), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 108/241 (44%), Gaps = 46/241 (19%)

Query: 220 SRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEY 279
           + TA+T    SP     +Y ++F S LEG+ G+ + VKV G +    +LP  L  +++  
Sbjct: 119 AETATTSTVPSP-----VYRVRFQSQLEGTLGKSVQVKVIGTRPLGTVLPSVLSALVRAC 173

Query: 280 KIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTI---------- 329
           ++P  L   Y    V +YR G ++L FMNCNSL +  EF+ EV +V + +          
Sbjct: 174 RVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFENEVLEVDVVLRALNLETPAS 233

Query: 330 -ISKGQEQNFEALYEQSKHSNHELVPAFIEPGTETPDFTVEEYEKELRNVDFNKNTSVQN 388
            +S GQE        ++  S    VPA     +E+P                        
Sbjct: 234 DVSGGQEATNGT---EAAASVPVPVPAPATAASESP-----------------------G 267

Query: 389 QPPPQSVDDNIRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEE 448
            P P      ++IAL+S DN+++ V     T  + L E+Y+    LP    + L  D+E+
Sbjct: 268 NPAPAL----MKIALLSADNRRLYVKVHGGTPCSRLLEYYRMERGLPAGAPLQLRLDDEQ 323

Query: 449 L 449
           +
Sbjct: 324 V 324

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.127    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,805,900
Number of extensions: 1782654
Number of successful extensions: 4840
Number of sequences better than 10.0: 27
Number of HSP's gapped: 4960
Number of HSP's successfully gapped: 28
Length of query: 473
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 360
Effective length of database: 40,524,141
Effective search space: 14588690760
Effective search space used: 14588690760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)