Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F16236g5.426ON1460146077680.0
SAKL0G02354g5.426ON1458146069180.0
AER252C5.426ON1459146067550.0
NDAI0C016205.426ON1460146166770.0
Ecym_55255.426ON1459146066700.0
NCAS0H020405.426ON1460145666530.0
ZYRO0F09856g5.426ON1458146066520.0
TDEL0E019905.426ON1460146266510.0
KAFR0D050305.426ON1462146266460.0
KLLA0E21253g5.426ON1457145466400.0
Smik_15.2945.426ON1460146165950.0
YOR116C (RPO31)5.426ON1460146165950.0
Skud_15.2795.426ON1460146165900.0
Kpol_1016.95.426ON1460146165770.0
Suva_8.1695.426ON1460146165550.0
TBLA0A037205.426ON1458146065130.0
KNAG0B042405.426ON1455146464430.0
CAGL0L11660g5.426ON1459146164420.0
TPHA0H017605.426ON1459146163070.0
Kwal_55.214595.426ON1148114458940.0
ZYRO0F05918g7.314ON1744151218520.0
Suva_4.1047.314ON1733149818270.0
SAKL0F10472g7.314ON1730151118220.0
YDL140C (RPO21)7.314ON1733150118200.0
TPHA0A030707.314ON1719151318170.0
Kwal_56.244897.314ON1728151018120.0
NCAS0A139007.314ON1716151118090.0
KLTH0H02046g7.314ON1740152017980.0
Kpol_162.1singletonON1311116216350.0
Kwal_55.21464singletonOFF32031715190.0
CAGL0I03828g7.314ON171593114581e-173
KAFR0B010607.314ON168593514561e-173
Ecym_80657.314ON174393414521e-172
KNAG0C039707.314ON172193014461e-172
Smik_4.957.314ON171992714451e-172
KLLA0F05071g7.314ON172094214441e-171
NDAI0A021307.314ON172992914441e-171
ADR086C7.314ON174593414421e-171
TDEL0C023207.314ON172792914391e-171
Skud_4.1147.314ON172692914381e-170
TBLA0F021707.314ON172693314371e-170
ZYRO0D04532g7.51ON166798411421e-130
CAGL0E05500g7.51ON164399611251e-128
YOR341W (RPA190)7.51ON166497811231e-127
Kwal_26.69797.51ON165498011161e-127
Smik_15.5197.51ON166597611161e-126
TPHA0H028007.51ON1648108911161e-126
TDEL0H040007.51ON166597511151e-126
Skud_15.5067.51ON166598011141e-126
Kpol_1040.37.51ON165698811131e-126
KAFR0K005407.51ON166297811121e-126
KLTH0D01628g7.51ON1654100311071e-125
Suva_8.3917.51ON166597811031e-125
NDAI0H012007.51ON166997111001e-124
NCAS0F007307.51ON167491211001e-124
KLLA0F23243g7.51ON165399110991e-124
KNAG0D049707.51ON167197010981e-124
TBLA0E019307.51ON165998910821e-122
SAKL0B10736g7.51ON165099410531e-118
ADR374C7.51ON164098510401e-116
Kpol_1019.277.314ON3641141932e-14
TDEL0F040708.280ON287127791.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F16236g
         (1460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2996   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2669   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2606   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2576   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2573   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2567   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2566   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2566   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2564   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2562   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2544   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2544   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2543   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2538   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2529   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2513   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2486   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2486   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2434   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  2274   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   717   0.0  
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   708   0.0  
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   706   0.0  
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   705   0.0  
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   704   0.0  
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   702   0.0  
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   701   0.0  
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   697   0.0  
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   634   0.0  
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   589   0.0  
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   566   e-173
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   565   e-173
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   563   e-172
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   561   e-172
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   561   e-172
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   560   e-171
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   560   e-171
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   560   e-171
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   558   e-171
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   558   e-170
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   558   e-170
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   444   e-130
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   437   e-128
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   437   e-127
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   434   e-127
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   434   e-126
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   434   e-126
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   434   e-126
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   433   e-126
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   433   e-126
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   432   e-126
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   431   e-125
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   429   e-125
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   428   e-124
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   428   e-124
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   427   e-124
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   427   e-124
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   421   e-122
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   410   e-118
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   405   e-116
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    79   2e-14
TDEL0F04070 Chr6 complement(753401..754264) [864 bp, 287 aa] {ON...    35   1.2  

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2996 bits (7768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1446/1460 (99%), Positives = 1446/1460 (99%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
            HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLN              LKILH
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
            YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS
Sbjct: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720

Query: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960
            NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960

Query: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020
            QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN
Sbjct: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020

Query: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080
            IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA
Sbjct: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200
            NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT
Sbjct: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200

Query: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260
            VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ
Sbjct: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260

Query: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320
            HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE
Sbjct: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320

Query: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380
            VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD
Sbjct: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440

Query: 1441 APKPTLFESLCDSVTALKVN 1460
            APKPTLFESLCDSVTALKVN
Sbjct: 1441 APKPTLFESLCDSVTALKVN 1460

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2669 bits (6918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1268/1460 (86%), Positives = 1363/1460 (93%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVVDIAPK+IKGLEFSALSASDIVAQS+VEISTRDLFDLENGR PK GGALDT+MGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS AECSTCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ +CK CA++LLS++DK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
             QFL+ELRRPG+DNLRRMG LKK++DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEK+KWVGDWK VL HNPELERY+K+CMDDLNPLKTLNLFKQV PEDCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS VKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPG S GGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS-GGKTKPIRGFCQRLKGKQ 359

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYNK KLQQLVI
Sbjct: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVI 419

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGPN HPGANYLLKK+++ARRNLRYGDRMKLA+NLQYGDVVERH+EDGDVVLFNRQPSLH
Sbjct: 420  NGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLH 479

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFF RA   QLLSMMSDGN+QFD+PPP++MKP+
Sbjct: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPH 599

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
            Y+WTGKQVFSLLIRPNK+SPV+IN+DAKNKV++PPK K LPNEMS+NDG+VVIRGS+ILS
Sbjct: 600  YLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILS 659

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCAR+LGNRGFSIGI+DVTPG 
Sbjct: 660  GVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGA 719

Query: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            +LK KKE  VE+AYAKCD LID FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 720  DLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779

Query: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I+ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960
            NT+RTSSNGIVQFTYGGDGLDP+DMEGNAQPVNF+RSW+HANN+TF H D  LLPYQI++
Sbjct: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIE 959

Query: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020
             TN +LKPLE+KLVR+DNLGN+L+   ++++EYIDQ DAERNFY+SLRDYM EKA+HLA 
Sbjct: 960  NTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAK 1019

Query: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080
            IR  KGLK  LDEPA EL+ ++LDE  P   L +V+QLCKIS  LV  FL IAI KYH+A
Sbjct: 1020 IRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRA 1079

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200
            NAVLVN+ DERAARVVKGRIEKT+LSDV +YIQDVYKDN+SF+Q KVDLGTIEKLQLELT
Sbjct: 1140 NAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELT 1199

Query: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260
            +EDIAVAITRA+KLKI+ +DVSI+G++K+NINV+PE  K KSISTSAKEP EN +FYRMQ
Sbjct: 1200 IEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQ 1259

Query: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320
            HLRRALPGIVVKGLPDI+RAVINI+DDG RELLVEGYGLR+VMTTDGVIG KTKTNHILE
Sbjct: 1260 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319

Query: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380
            +F+VLGIEAARTSIVGEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMRD
Sbjct: 1320 IFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGT ISE DL
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDL 1439

Query: 1441 APKPTLFESLCDSVTALKVN 1460
             PK TLFESLC+ V ALK +
Sbjct: 1440 KPKHTLFESLCNDV-ALKTH 1458

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2606 bits (6755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1242/1460 (85%), Positives = 1342/1460 (91%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVVDI PKRI GLEFSALSASDIVAQS+VEI TRDLFDLE+GR PK GGALD+RMGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSSQAECSTCHG LASCHGHFGHIKL+LPVFHVGYFKATIQ+LQSICK CA LLL+EEDK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
             QFLSELRRPGIDNLRRM  LKKV+DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEKDKW+GDW  VL H+PELERY+K+ M++LNPLKTLNLFKQ++P+DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNPA+MPGG+ GGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLT+PE VTRYNK KLQQL++
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NG N HPGANYLLKK+EEARRNLRYGDR+KLA+NLQ GDVVERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFF RA FVQ+LSMMSDGNLQFDIPPP+IM+P+
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
            Y+WTGKQ+FSLLI+PNK+SPV+INLDAKNKVYI PK+K+ PNEMS NDGYVVIRGS ILS
Sbjct: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRDFGPQEA  AMNRMAKLCAR+LGNRGFSIGI+DVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720

Query: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            ELK  KE MVE AYAKCD LIDL+ +GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780

Query: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I+ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960
            NT+RTSSNGIVQFTYGGDGLDP++MEGNA+PVNF+RSW+HANN+T+NH DK +LPYQI++
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960

Query: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020
            +TN +L PLE++L RYDN+GN L P L++   YIDQ DAER FY+SLR YM EKA  LA+
Sbjct: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020

Query: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080
            I   +GLKE    PA ELQ MDLD   P   + SV+QLCKISSKLV  FL+IAI KY KA
Sbjct: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGA+GAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200
            NA LVN++DERAARVVKGR+EKTLLSDV FYIQDVY+DNMSFLQVKVDL TIEKLQLELT
Sbjct: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200

Query: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260
            VEDIA+AIT A KLKI+  DVSI+G++K+NINV  ++ K KSIST A EP EN++F++MQ
Sbjct: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260

Query: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320
            HLRRALPGIVVKGLPDI+RAVINI+DDG RELLVEGYGLR+VMTTDGV+G KTKTNH LE
Sbjct: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320

Query: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380
            V+ VLGIEAARTSI+ EIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMRD
Sbjct: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGT+IS  DL
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440

Query: 1441 APKPTLFESLCDSVTALKVN 1460
             PKPTLFE+LC S+  LKVN
Sbjct: 1441 KPKPTLFENLC-SLNTLKVN 1459

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2576 bits (6677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1228/1461 (84%), Positives = 1338/1461 (91%), Gaps = 2/1461 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQS+VEIS+RDLFDLE GR+PK+GGALD RMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICKTC+A+LLS++D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
             QFL+ELRRPG+DNLRRMGILKKV+DQCKKQRRCL+CG+LN              LKI+H
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            D FRWVGKKSAPEKDKWVGDWK VL+H+PELER+VK+C DDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLG++STVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGLEKGISINNMME WDYLQL VAMYINSDSVNPAM+PG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLT+PE VTRYN+QKLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479
            INGPN HPGANYLLK +E+ARRNLRYGDR+KLA+NLQ+GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFF RA   QLLSMM D NLQFDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
            +Y+WTGKQ+FSLLI+PNK+SPVVINLDAKNKVYIPPK K+ PNEMS NDGYV+IRGS+IL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCARFLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AYAKCD LID FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNA+PVNF+RSW+HA N+TF+     LLPYQIM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019
            + TN +LKPLE++L+RYDNLG  +      + EY+DQ DAER+FYKSLRDYM EKA  L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079
            ++R  +G+   +DEPA EL+ M+ DE  P +   SVDQL KI+  LV KFLEIA++KY K
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199
            INAVLVN NDERAARVVKGRIEKTLLSDVA+YIQDVYKDN+SF+QV++DL TIEKLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLEL 1200

Query: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259
            T+EDIAVA+TRA KLKI  SDV+I+GKDK+ INV+PE  K KSIST+AKEP EN +FYRM
Sbjct: 1201 TIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319
            QHLRRALP IVVKGLP+IARAVINI+DDG RELLVEGYGLR+VM TDGVIGMKT TNHIL
Sbjct: 1261 QHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379
            EV +VLGIEAAR+SIVGEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGT+I++  
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKES 1440

Query: 1440 LAPKPTLFESLCDSVTALKVN 1460
            L PKPTLFE+L  S  ++K+N
Sbjct: 1441 LKPKPTLFENLTSS-RSIKMN 1460

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2573 bits (6670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1232/1460 (84%), Positives = 1341/1460 (91%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVVD+APK+IKGL FSALSASDIVAQS+VEI TRDLFDLENGR PK GGALD++MGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSSQAECSTCHGNLASCHGHFGHIKL+LPVFH+GYFKATIQ+LQSICK CAA+LLSEE+K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
             QFL+ELRRPGIDNLRRM  L+KV+DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEK+KW+GDW  VL HNPELERY+K+ MD+LNPLKTLNLFKQV  +DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNPA+MPGG+ GGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYNK KLQQL+I
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLII 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGPN HPGANY+LKK+E+ARRNLRYGDR+KLA+N+Q GDVVERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            LTPKSGEPII+ATQDFITGSYLISHKDSFF RA F QLLSMM+D N+QFD+PPP+I+KP 
Sbjct: 541  LTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKPC 600

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
            Y+WTGKQVFSLLIRPNK+SPV+INLDAKNKVY+PPK+KS PNEMS NDGYV+IRGS+IL 
Sbjct: 601  YLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEILC 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRDFGP EAA AMNRMAKLCAR+LGNRGFSIGINDVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPGK 720

Query: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            ELK KKE MVE AYAKCD LIDLF +G+LETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I+ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVR+SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960
            NT+RTSSNG+VQFTYGGDGLDP++MEGNAQPVNF+RSW+HANN+TFN+ +  LLPYQIM+
Sbjct: 901  NTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIME 960

Query: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020
             +N +L PLE +L+R DN+GN +   L    EYIDQ+DAER+FY+SLR YM  KA  LA 
Sbjct: 961  TSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLAQ 1020

Query: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080
            IR  KGLK  L+EPA EL+ MDLD  A  + L S++QLCKIS  LV  FL IAI KYHKA
Sbjct: 1021 IRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYHKA 1080

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGA+GAHSIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200
            NA+LVN+NDERAARVVKGRIEKTLLSDV FYIQDVY+DNMSF+QVKVDL TIEKLQLELT
Sbjct: 1141 NALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLELT 1200

Query: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260
            +EDIA+AI+RA KLKI+  DVSI+GK+K+NI+V  ++ K KSIST   EP EN++FYRMQ
Sbjct: 1201 IEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYRMQ 1260

Query: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320
            HLRRALP IVVKGLPDI+RAVINI +DG RELLVEGYGLR+VMTTDGVIG KTKTNH LE
Sbjct: 1261 HLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHFLE 1320

Query: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380
            VF VLGIEAARTSI+ EIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMRD
Sbjct: 1321 VFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVV+GT+IS  +L
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMDEL 1440

Query: 1441 APKPTLFESLCDSVTALKVN 1460
             P PTLFE+LC++ TALKV+
Sbjct: 1441 KPNPTLFENLCNN-TALKVS 1459

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2567 bits (6653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1222/1456 (83%), Positives = 1333/1456 (91%), Gaps = 1/1456 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQS++E+S+RDLFDLE GR+PK GGALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ +CKTC+A+LL+++DK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
             QFL+ELRRPG+DNLRRMGILKKV+DQCKKQRRCL+CG+LN              LKI+H
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEKDKWVGDWK VL+H+PELER++K+C DDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGLEKGISINNMME WDYLQL VAMYINSDSVNPAM+PG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLT+PE VTRYNKQKLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479
            INGPN HPGANYLLKK+E+ARRNLRYGDR+KLA+NLQ+GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFF RA   QLLSMMS+G L+FDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
            YYMWTGKQVFSLLIRPNKESPVVINLDAKNKV++PPK K  PNEMS NDGYVVIRGS IL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRM+KLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AYAKCD LID F+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNA+PVNF+RSW+HA N+TF++++K LLPY+IM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019
            ++TN +LKPLEE+L+RYDN+G  +     ++ EY+DQ DAER+FY+SLRDY+ EKA  LA
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079
             +R  +G+ E   EP  EL+ +D DE    S   SVDQL KI+ K V  FLEIA++KY K
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199
            INAVLVN NDERAARVVKGRIEKTLLSD+A+YIQDVYKDN+SF+QV+VDLGTIEKLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLEL 1200

Query: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259
            T+EDIAVAIT+A KLKI  SDV+I+GKDK+ INVYP+  K KSIST AKEP  N +FYRM
Sbjct: 1201 TIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319
            QHLRR LP IVVKG  DI+RAVINI+DDG RELLVEGYGLR+VM TDGVIGMKT TNHIL
Sbjct: 1261 QHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379
            EV +VLGIEAAR+SI+GEIDYTMSNHGMSVDPRH+QLLGDVMTYKGEILGITRFGLSKMR
Sbjct: 1321 EVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGT+ISE+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEAD 1440

Query: 1440 LAPKPTLFESLCDSVT 1455
            L PKPTLFE L +  T
Sbjct: 1441 LKPKPTLFEKLSNCGT 1456

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2566 bits (6652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1225/1460 (83%), Positives = 1340/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVV   APK+I GLEFSALSA+DIVAQS+VEISTRDLFDLENGR PK+GGALD +MGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFH+GYFKATIQ+LQ ICK C+++LL + DK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
              FLSELRRPG+DNLRRMGILKKV+DQCKKQRRCL+CG+LN              LKI+H
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRW GKKS PEK+KW+GDW +VLAH+PELERYVK+CMDDLNPLKTLNLFKQV PEDCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST+KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMME WDYLQLAVAMYINSDSVNPA++ GG TGGK KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGG-TGGKVKPIRGFCQRLKGKQ 359

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLS+DEVAVPDRVAKVLTYPE VTRYNK KLQQLV+
Sbjct: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVV 419

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGPNE+PGANYLLKKDE+ARRNLR+GDR+KLA+NL+ GD+VERHLEDGDVVLFNRQPSLH
Sbjct: 420  NGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLH 479

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NL
Sbjct: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNL 539

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFF + +  QLLSMMSDG LQFDIPPP+I KP 
Sbjct: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPC 599

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
            Y+WTGKQ+FSLLIRPNK+SPVV+NLDAKNKVYIPPK KSLPNEMS NDG+V+IRGS+ILS
Sbjct: 600  YLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILS 659

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRD+G QEAA AMNRMAKLCAR++GNRGFSIGI+DVTP  
Sbjct: 660  GVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAE 719

Query: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            ELK KKE MVE AYAKCD LIDLF+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 720  ELKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779

Query: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I ELDN+N+ LIMA CGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSKT
Sbjct: 780  INELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKT 839

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YD
Sbjct: 840  PQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYD 899

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960
            NT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF+R+W+HA NVTFN++D+ LLPYQIMQ
Sbjct: 900  NTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQ 959

Query: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020
             T  +L+PLE +LVRYDNLGNE+    +DR+EYIDQ+DAER FY SLRD+++ KA  LA 
Sbjct: 960  VTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAK 1019

Query: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080
             R  K +KE +DEPA ELQ++DLDE  P     SVDQ+ +I+ K+V +FL +AI KY +A
Sbjct: 1020 FRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRA 1079

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200
            NAVLVN +DERAARVVKGRIEKTLLSDVAFYIQDVY+DN+S+LQV+VDL TI+KLQLELT
Sbjct: 1140 NAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELT 1199

Query: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260
            +EDIAVA+TRA KLKI ASDV I+GKDK+ INV+P+ AK KSIST AKEP ENE+FYRMQ
Sbjct: 1200 IEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQ 1259

Query: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320
             LRRALPGIVVKGL DI+RAVINI+DDG RELLVEGYGLR+VM+TDGV+G KT TNHILE
Sbjct: 1260 QLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILE 1319

Query: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380
            V+SVLGIEAAR SIVGEIDYTMSNHGMSVDPRH+QLLGDVMTYKGEILGITRFGLSKMRD
Sbjct: 1320 VYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRD 1379

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGAFKVVKGT++SE  L
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQL 1439

Query: 1441 APKPTLFESLCDSVTALKVN 1460
             PKPTLFESL +  T++KVN
Sbjct: 1440 KPKPTLFESLVNE-TSVKVN 1458

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2566 bits (6651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1224/1462 (83%), Positives = 1332/1462 (91%), Gaps = 4/1462 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQS+VEISTRDLFDLENGR P++GGALD +MGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICK C+A+LL + D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
              FLSELRRPG+DNLRRMGIL KV+DQCKKQRRCL+CG+LN              LKI+H
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRW GKKS PEKDKWVGDW  VL+HNPELERYVK+CMDDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            +GLEKGISINNMME WDYLQL+VAMYINSDSVNPAMMPG S+GG K KPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+QKLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479
            INGPN HPGANYLLKKDE+ARRNLRYGDR+KLA+NL+ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFF R    QLLSMMSDGNLQFDIP P+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
             Y+WTGKQVFSLLI+PNK+SPVVINLDAKNKV+IPPK KSLP+EMS NDGYV+IRGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE MVE AYAKCD LID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSW HA NVTFN+ ++ L PYQI 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDR-VEYIDQDDAERNFYKSLRDYMYEKASHL 1018
            ++T+ +L PL  +L+RYDN+G +L P  +D  +EYIDQ+DAERNFY SL+ +M  KA  L
Sbjct: 961  EETDKILAPLMNRLIRYDNVG-KLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELL 1019

Query: 1019 ANIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYH 1078
            A++R  +G+KE LDEP  E + +D DE  P +   SVDQLC+I+   V +FL+IAI KY 
Sbjct: 1020 ASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYR 1079

Query: 1079 KAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +A+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLE 1198
            IINAVLVN+NDERAARVVKGRIEKTLLSDVAFYIQDVY+DN+SF+QV++DL TI+KLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLE 1199

Query: 1199 LTVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYR 1258
            LT+EDIAVAITRA KLKI ASDV+I+ KDK+ INV+PE  K KSISTSAKEP EN++F+R
Sbjct: 1200 LTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFR 1259

Query: 1259 MQHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHI 1318
            MQ LRR+LPGIVVKGLPDI+RAVIN++DD  RELLVEGYGLR+VM+TDGV+G KT TNHI
Sbjct: 1260 MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHI 1319

Query: 1319 LEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKM 1378
            LEVFSVLGIEAAR SI+GEIDYTMSNHGMSVDPRH+QLLGDVMTYKGEILGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISES 1438
            RDSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTGAFKV+KGTD+ E 
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQ 1439

Query: 1439 DLAPKPTLFESLCDSVTALKVN 1460
            DL PKPTLFESL    TA+K N
Sbjct: 1440 DLRPKPTLFESLSKE-TAIKAN 1460

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2564 bits (6646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1221/1462 (83%), Positives = 1335/1462 (91%), Gaps = 2/1462 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVV+  APK+I G+EFSALSASDIVAQS+VEIS+RDLFDLE  RK K  GALD RMGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS   C TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ+ICK C+++LLS+EDK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  HQFLSELRRPG-IDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKIL 179
             ++L ELR  G IDNL++MGILKKV+DQCKKQRRCL CG+LN              LKI+
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDC 239
            HDTFRWVGKKS PEKD W+GDW  VL+H+PELER+VK+C DDLNPLKTLNLFKQV PEDC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
            ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKG 358
            KAGLEKGISINNMME WDYLQL VAMYIN+DSVNPAM+PG S+GG K KPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 359  KQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQL 418
            KQGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN++KLQ+L
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 419  VINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPS 478
            V+NGPN HPGANYLLKK+EEARRNLRYGDR+KLA+NLQYGD+VERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 479  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 538
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 539  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMK 598
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFF RA F QLLSMMSDGNLQFDIPPP+IMK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 599  PYYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKI 658
            PYY+WTGKQ+FSLLI+PN +SPVVINLDAKNKVYIPPK KSLPNEMS NDG+V+IRGS I
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 659  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTP 718
            LSGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRM+KLCARFLGNRGFSIGI+DVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 719  GFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 778
              +LK KKE +VE AYAKCD LID +NKGKLETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 779  VCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNS 838
            VCI ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 839  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 898
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 899  YDNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQI 958
            YDNT+RTSSNGIVQFTYGGDGLDP++MEG+AQPVNF+RSW+HA N+TFN+ ++ LLPYQ+
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 959  MQQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHL 1018
            M++TN VL PLEE+LVRYDNLGNE+     D++EY DQ DAER+FYK+LR Y+  K+ HL
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1019 ANIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYH 1078
            A++R  +GL E L EP  ELQ++  DE A   + +SVDQLCKI+ K VLKFLEIA+ KY 
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1079 KAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            KA+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLE 1198
            IINAVLVNNNDERAARVVKGR+EKT+LSDVA+YIQDVYKDN+SFLQ+++DL TIEKLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1199 LTVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYR 1258
            LT+EDIAVA+T+A KLKI ASDVSI G DKV +NV+PE +K KSISTSAK+P EN++FYR
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1259 MQHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHI 1318
            MQ LRRALP IVVKGLP+IARAVINI+DDG RELLVEGYGLREVM TDGVIG KT TNH+
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1319 LEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKM 1378
            LEV SVLGIEAAR+SI+GEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISES 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTG+FKVVKGTDI   
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1439 DLAPKPTLFESLCDSVTALKVN 1460
            DL PKPTLFESL  + + +K+N
Sbjct: 1441 DLKPKPTLFESLSSASSNIKLN 1462

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2562 bits (6640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1215/1454 (83%), Positives = 1324/1454 (91%), Gaps = 1/1454 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKE V+DIAPK+IKG+ FSALSA+DIV+QS+VEISTRDLFDL+NGR  K GGALD RMGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSSQAEC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQS+CK C ALLLSEEDK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
             +FL+ELRRPG+DNLRRM ILKK++DQCKKQRRC  CG LN              LKI+H
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEK++W+GDWK VL +NPELERYVK+CMDDLNPLK LNLFKQ+ P DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP+M+PG S+G K+KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPG-SSGTKSKPIRGFCQRLKGKQ 359

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAK+LTYPE VTRYNK KLQQLVI
Sbjct: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVI 419

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGP  HPGANYLLKK+E+ARRNLRYGDR+KLA+ LQYGDVVERH+EDGDVVLFNRQPSLH
Sbjct: 420  NGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLH 479

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFF RA+  QLLSMMSD NLQFDIPPPSIMKP+
Sbjct: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPH 599

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
            Y+WTGKQVFSLLI+P+++SPVVINLDAKNKVY+PP  K  PNEMS NDG+V+IRGS ILS
Sbjct: 600  YLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILS 659

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCAR+LGNRGFSIGINDVTPG 
Sbjct: 660  GVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGS 719

Query: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            +LK KKE MVE AYAKCD LIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 720  DLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779

Query: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I+ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960
            NT+RTSSNGIVQFTYGGDGLDP+DMEGNAQPVNF+RSW HANN+T N     LLPYQI+ 
Sbjct: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIA 959

Query: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020
            +TN +L+PLE KL RYDN+G EL    + + EYIDQ DAER+FY+SLR++M EKA  LA+
Sbjct: 960  ETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLAS 1019

Query: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080
            +R  +GLKE +DEPA EL+  + DE  PAS   +++QLCKIS  LV KFL IAI KYH+A
Sbjct: 1020 LRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRA 1079

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            +VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1080 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200
            NAVLVN+NDERAARVVKGR+EKTLLSDV+FY+QD+Y+DNM+FLQ+K+D  TIEKLQLELT
Sbjct: 1140 NAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELT 1199

Query: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260
            +EDI VAI +A KLKI  +D+SI+GKDK+NI V  +   +KSIST+ KEP  NE+FYRMQ
Sbjct: 1200 LEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQ 1259

Query: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320
             LRRALP IVVKG  DI+RAVINI+DDG RELLVEGYGLR+VMTTDGVIG KTKTNHILE
Sbjct: 1260 QLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319

Query: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380
            V+ VLGIEAAR+ I+ EIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGL+KMRD
Sbjct: 1320 VYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRD 1379

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440
            SVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTG+FKVVK T + E+DL
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDL 1439

Query: 1441 APKPTLFESLCDSV 1454
             PKPTLFE+LCD+V
Sbjct: 1440 TPKPTLFETLCDTV 1453

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2544 bits (6595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1210/1461 (82%), Positives = 1326/1461 (90%), Gaps = 2/1461 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIVAQS+VE+STRDLFDLE  R PK+ GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK C+A+LLSE DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
              FL ELRRPG+DNLRRMGILKK++DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEKD WVG+WK VL HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479
            +NGPN HPGANYLLK++E+ARRNLRYGDR+KLA+NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLLSMMSDG  QFDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
            YY+WTGKQVFSLLI+PN  SPVVINLDAKNKV++PPK KSLPNEMS NDG+V+IRGSKIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AY+KCD LI LFNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDN N+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF+RSW+HA N+TFN+ D+ LLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019
            Q TN +L+PLEE+LVRYDN G  +     ++ EY+DQ DAER+FY+SL++Y+  KA+ LA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079
            N+R  +G+ E L+ P  E + +D D+  P +   SV QL +IS K V KFLEIA++KY K
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199
            INAVLVN+NDERAARVVKGR+EKTLLSDVA+Y+QDVYKDN+SF+QV++DLGTI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259
            T+EDIAVAITRAAKLKI ASDV+I+GKD++ INV+PE  K +SISTSAKEP EN++FYRM
Sbjct: 1201 TIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319
            Q LRRALP +VVKGLPDI+RAVINI+DDG RELLVEGYGLR+VM TDGVIG +T TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379
            EVFSVLGIEAAR SI+ EI+YTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGT+ISE D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISERD 1440

Query: 1440 LAPKPTLFESLCDSVTALKVN 1460
            L PKP LFESL +   ALK N
Sbjct: 1441 LVPKPCLFESLSNE-AALKAN 1460

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2544 bits (6595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1215/1461 (83%), Positives = 1323/1461 (90%), Gaps = 2/1461 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIVAQS+VE+STRDLFDLE  R PK+ GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK C+A+LLSE DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
             QFL ELRRPG+DNLRRMGILKK++DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEKD WVG+WK VLAHNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479
            +NGPN HPGANYLLK++E+ARRNLRYGDRMKLA+NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLLSMMSDG   FDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
            YY+WTGKQVFSLLI+PN  SPVVINLDAKNKV++PPK KSLPNEMS NDG+V+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AY KCD LI LFNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDN N+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF+RSW+HA N+TFN+ DK LLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019
            +  N +L PLEE+LVRYDN G  +     ++ EY+DQ DAER+FY SLR+Y+  KA+ LA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079
            N+R  +G+   L+ PA ELQ +D DE  P +   SV QL +IS K V KFLEIA+FKY K
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199
            INAVLVN+NDERAARVVKGR+EKTLLSDVAFY+QDVYKDN+SF+QV++DLGTI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259
            T+EDIAVAITRA+KLKI ASDV+I+GKD++ INV+PE  K KSISTSAKEP EN++FYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319
            Q LRRALP +VVKGLPDI+RAVINI+DDG RELLVEGYGLR+VM TDGVIG +T TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379
            EVFSVLGIEAAR SI+ EI+YTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGT+ISE D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1440 LAPKPTLFESLCDSVTALKVN 1460
            L PK  LFESL +   ALK N
Sbjct: 1441 LVPKRCLFESLSNE-AALKAN 1460

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2543 bits (6590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1208/1461 (82%), Positives = 1324/1461 (90%), Gaps = 2/1461 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIVAQS+VE+STRDLFDLE  R PK+ GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK C+A+LLSE DK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
              FL ELRRPG+DNLRRMGILKK++DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEKD WVG+WK VL HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479
            +NGPN HPGANYLLK++E+ARRNLRYGDRMKLA+NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLLSMMSDG  QFD+PPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
            YY+WTGKQVFSLLI+PN  SPVVINLDAKNKV++PPK KSLP+EMS NDG+V+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AY KCD LI LFNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDN N+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF+RSW+HA N+TFN+ D+ LLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019
            +  N +L+PLEE+LVRYDN G+ +    +DR EY+DQ DAER+FY+SLR+Y+  KA+ LA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079
            N+R  +G+ E L+ P  EL+ +DLDE  P +   SV QL +IS K V KFLEIA+FKY K
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140

Query: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199
            INAVLVN+NDERAARVVKGR+EKTLLSDVA+Y+QDVYKDN+SF+QV++DL TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200

Query: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259
            T+EDIA+AITRA+KLKI ASDV+I+GKD++ INV+PE  K KSISTSAKEP EN++FYRM
Sbjct: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319
            Q LRRALP +VVKGLPDI+RAVINI+DD  RELLVEGYGLR+VM TDGVIG KT TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379
            EVFSVLGIEAAR SI+ EI+YTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGT+ISE D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1440 LAPKPTLFESLCDSVTALKVN 1460
            L PKP LFESL +   ALK N
Sbjct: 1441 LVPKPCLFESLSNE-AALKAN 1460

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2538 bits (6577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1205/1461 (82%), Positives = 1324/1461 (90%), Gaps = 2/1461 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PK+I GLEFSALSASDIVAQS+VE+STRDLFDLENGR PK GGALD +MGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICK C+++LL++ D+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
              FL ELRRPGIDNL+RM I+KK++DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKS+PEKD+WVGDW+ VLA+NPELER+ K+ MDDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGLEKGISINNMME WDYLQL+VAMYINSDSVNP+MMPG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN++KLQ LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479
            INGPN HPGANY+LK +EEARRNLRYGDR+K+A+ L+ GD+VERHLEDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKD+F  RA F QLLSMMSD NLQFDIPPP+I+KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
            Y +WTGKQ+FSLLI+PNK+SPVVINLDAKNKV+IPPK KSLPNEMS NDG+VVIRGS+IL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
              LK KKE +VE AYAKCD LIDLF KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG++
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSW+HA N+TF++  + LLPY I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019
             +TN +L P EE+L+RYDN+G  +  + Q + E++DQ D+ERNFY SLR YM EKAS LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079
            +IR  KGLKE   EP  E + MDLDEG  + A  +V++LCKI+ K V KFLEIA+ KY +
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A+VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199
            INAVLVN+ND+RAARVVKGRIEKTLLSDVA+Y+QDVYKDN+SFL+VK+DL TI+KLQLEL
Sbjct: 1141 INAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLEL 1200

Query: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259
            T+EDIAVA+TRA KLKI  +DV I+ KDK+ I+VYPE +K KSISTS KEP EN++FYRM
Sbjct: 1201 TIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319
            Q LRRALP IVV GLPDIARAVINI+DDG RELLVEGYGLREVM TDGVIG KT TNH+L
Sbjct: 1261 QTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHVL 1320

Query: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379
            EVFSVLGIEAAR+SI+GEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFK++K T+I   D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPDD 1440

Query: 1440 LAPKPTLFESLCDSVTALKVN 1460
            L PK TLFE+L  +  ALKVN
Sbjct: 1441 LKPKRTLFENLV-AEPALKVN 1460

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2529 bits (6555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1203/1461 (82%), Positives = 1322/1461 (90%), Gaps = 2/1461 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIVAQS+VE+STRDLFDLE  R P++ GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK C+A+LLSE DK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
             +FL ELRRPG+DNLRRMGILKK++DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEKD WVG+WK VL HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479
            +NGPN HPGANYLLKK+E+ARRNLRYGDRMKLA++LQ GDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLL MMSDG  QFD+PPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
            YY+WTGKQVFSLLI+P+ +SPVVINLDAKNKV++PPK KSLP+EMS NDG+VVIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AY KCD LI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDN N+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF+RSW+HA N+TF++ D+ LLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019
            +  N +L PLE++LVRYDN G  +    +D+ E++DQ DAER+FY+SLR+Y+  KA+ LA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079
            N+R  +G+ E ++ P  ELQ MD DE  P +   SV QL +IS + V KFLEIA+FKY K
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199
            INAVLVN+NDERAARVVKGR+EKTLLSDVA+Y+QDVYKDN+SF+QV++DLGTI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259
            T+EDIAVAITRA+KLKI A DV+I+GKDK+ INV+PE  K KSISTSAKEP EN++FYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319
            Q LRRALP +VVKGL DI+RAVINI+DDG RELLVEGYGLR+VM TDGVIG KT TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379
            EVFSVLGIEAAR SIV EI+YTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKV+KGT++SE D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440

Query: 1440 LAPKPTLFESLCDSVTALKVN 1460
            L PKP LFESL +   ALK N
Sbjct: 1441 LIPKPCLFESLSNE-AALKAN 1460

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2513 bits (6513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1201/1460 (82%), Positives = 1303/1460 (89%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVV    PK+I GLEFSALSA+DIVAQS+V I+TRDL+DLE+GR PK  GALD RMGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ+ICK+CAA+LLS+EDK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
              FLSELRRPGIDNL+RMGILKK++DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKK  PEKD WVGDW+ VL+HNPELER+VK+ MDDLNPLKTLNLFKQ+ PEDCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMME WDYLQL+VAMYINSDSVNP +MPG STG K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGNKVKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLT+PE VTRYNK+KLQ LV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALVL 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGPN HPGANYLLKKDEEARRNLRYGD++KLA+NLQ GDVVERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFF RA F QLLSMM DGNLQFDIPPP+IMKP 
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKPC 600

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
            Y+WTGKQ+FSLLI+PN  SPVVIN+DAKNKV+ PPKDKSLP+EMS NDG+VVIRGS+ILS
Sbjct: 601  YLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP  
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPDD 720

Query: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            +LKN KE +VE AYAKCD LI L+N+GKLETQPGCNEEQTLEAKI G+LSKVREEVG++C
Sbjct: 721  KLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDIC 780

Query: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            I ELDN N+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  INELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSF+SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960
            NT+RTSSNGIVQFTYGGDGLDP DMEGNAQPVNF+RSW+HA N+ F++ DK + PYQI++
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQILE 960

Query: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020
             TN +L PLEEKL+RYDN+G  + P    + E++DQ DAERNFY SLRDYM +KA+ LA+
Sbjct: 961  ITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELAD 1020

Query: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080
            +R  +G+KE L  P  E + MDLDE  P S   SV+Q+C+I+   V +FL+IAI KY +A
Sbjct: 1021 VRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRRA 1080

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            +VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200
            NAVLVN NDERAARVVKGRIEKTLLSDVA+YIQD YKDN S+L+VK+DLGTIEKLQLELT
Sbjct: 1141 NAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLELT 1200

Query: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260
            + DIA AI RA KLKI   DV      K+ I+V PE A +  IS SAKEP+EN +FYRMQ
Sbjct: 1201 MSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPE-ASVSKISASAKEPLENNVFYRMQ 1259

Query: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320
            HLRRALP IVVKGLPDIARAVINI+D+G RELLVEGYGLR+VM TDGVIG KT TNH+LE
Sbjct: 1260 HLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVLE 1319

Query: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380
            V SVLGIEAAR SI+GEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMRD
Sbjct: 1320 VNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVK T I    L
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNGTL 1439

Query: 1441 APKPTLFESLCDSVTALKVN 1460
             PK TLFESLC   T +K+N
Sbjct: 1440 KPKRTLFESLCKE-TNIKIN 1458

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2486 bits (6443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1193/1464 (81%), Positives = 1306/1464 (89%), Gaps = 13/1464 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVV    K+I G+EFSAL+A+DIVAQS+VEI+TRDLFDLE GR+ K+GGALD RMGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFHVGYFK+TIQ+LQ ICK C+A+LLS++D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
              FL ELRRPGIDNLR+M ILKKV+DQCKKQRRCL+CG LN              LKI+H
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKK  PEKD+W+G+W  +L H+PELER+VK+C DDLNPLKTL LFKQ+  EDCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+STV+SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AGL KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVP  VAKVLT+PE VTRYNK+KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479
            INGP  HPGANYLLKK+EEARRNLRYGD++KLA+NLQYGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFF      QLLSMMSD  LQFDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
            YY+WTGKQVFSLLIRPNK+SPVVINLDAKNKVYIPPKDKS PNEMSINDG+V+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA  MNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +L++KKE MV  AYAKCD LID+F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            D+T+RTS+NGIVQFTYGGDGLDP+DMEGNA+PVNF RSW+HA N+TFN  +  LLPY+I+
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019
            ++T+ VLKPLEEKL+RYDNLG  +   L D   Y D+ DAER FYKSLR YM EKA+ LA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1020 NIRAHKGLKEFLD---EPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFK 1076
             IR  +GL E      + + E+ + +L         ASVDQ+ KI+ K V  FL IA+ K
Sbjct: 1021 QIRNTRGLLEMTQNGGDTSMEVVSSELQ--------ASVDQVYKITKKNVNAFLTIALHK 1072

Query: 1077 YHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1136
            YH+AKVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS
Sbjct: 1073 YHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1132

Query: 1137 TPIINAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQ 1196
            TPIINAVLVN  DERAARVVKGRIEKTLLSD+AFYIQDVY+ NMS+L+++VDL TIEKLQ
Sbjct: 1133 TPIINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQ 1192

Query: 1197 LELTVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELF 1256
            LELT+EDIAVA++RA KLKI  +D+ I+GKDK+++NVYPE  K KSISTSAKEP ENE+F
Sbjct: 1193 LELTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVF 1252

Query: 1257 YRMQHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTN 1316
            Y+MQ LRR+LP +VVKGLPDI+RAVINI+DDG RELLVEGYGLREVM TDGVIG KT TN
Sbjct: 1253 YKMQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITN 1312

Query: 1317 HILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLS 1376
            H+LEV SVLGIEAAR SIVGEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLS
Sbjct: 1313 HVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1372

Query: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDIS 1436
            KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTG+FKVVK  D+S
Sbjct: 1373 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVS 1432

Query: 1437 ESDLAPKPTLFESLCDSVTALKVN 1460
            E DL  +PTLFESL  S TA+K N
Sbjct: 1433 ERDLKVRPTLFESLA-SETAIKAN 1455

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2486 bits (6442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1195/1461 (81%), Positives = 1308/1461 (89%), Gaps = 4/1461 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVV+   PKRI GLEFSALS +DIVAQS++EIS+RDLFDLEN R PK GGALD RMGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            S+S  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICKTC+A+LLSE+DK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
              FLSELRRPG+DNLRRM +LKKV+DQCKKQRRCL CG+LN              LKI+H
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKS PEKDKW+GDWK VL+HNPELERYVK+  DDLNPLKTLNLFKQ+A EDCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359
            AG+EKGISINNMME WDYLQ+ VAMYINSDS+NPAM+PG STGG K KPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVP  VAKVLT+PE VTRYN +KL+QLV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479
             NGPN HPGANYLLKK+EEARRNLRYGDR KLA NLQYGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFF +A   QLLSMMSDG+LQFDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
             Y+WTGKQVFSLLI+PNK SPV INLDAKNKVYIPPK K  PNEMS NDG+V++RGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRDFGPQEAA AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             +LK KKE +VE AYAKCD LIDL+NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF+RSW+HA N+TFN+ D+ LLPY+I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019
            +  + +LKPLE++L+RYD LG  +        +Y+DQ D+ER FY SLR++M +KA  LA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1020 NIRAHKGLKEFLDEPAAELQAMDLD-EGAPASALASVDQLCKISSKLVLKFLEIAIFKYH 1078
             +R  +GL + + +  +EL+  D + E   A    S+ QL +I+   V KFLEIAI KYH
Sbjct: 1021 KLRKSRGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078

Query: 1079 KAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +AKVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLE 1198
            IINAVLVNNNDERAARVVKGRIEKTLLSDV +YIQDVYK+NM++LQVKVDL TI+KLQLE
Sbjct: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198

Query: 1199 LTVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYR 1258
            LT+EDIA+AITRA KLKI  SDV+++GKDK+ INV PE    K+ STS KEP EN++FYR
Sbjct: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258

Query: 1259 MQHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHI 1318
            MQ LRRALP I+VKGL DIARAVINI+DDG RELLVEGYGLR+VM TDGVIG KT TNH+
Sbjct: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318

Query: 1319 LEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKM 1378
            LE+F+VLGIEAAR SI+GEIDYTMSNHGMSVDPRH+QLLGDVMT+KGE+LGITRFGLSKM
Sbjct: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISES 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVK TDI+E 
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438

Query: 1439 DLAPKPTLFESLCDSVTALKV 1459
            +L PK TLFESL  +V   +V
Sbjct: 1439 ELKPKRTLFESLTSNVANKQV 1459

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2434 bits (6307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1166/1461 (79%), Positives = 1290/1461 (88%), Gaps = 3/1461 (0%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVV+   PKRI GLEFSALS SDI+AQS+VEISTRDLFDLENGR P  GGALD +MGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSS  ECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQ+LQ +CK+C+A+LL++ DK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
              FL ELR+P IDNL+RM ILKK++DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKK+ PEKDKW+GDW  VL +NPELE+++K+C DDLNPLKTLNLFKQ+  EDCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTV SGRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMME WDYLQL+VAMYINSDSVN  +MPG + G K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPGSNGGTKAKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVP+ VAKVLTYPE VTRYNK KLQ+LV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLVM 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGPN HPGANYLLK +EEARRNLRYG+R KLA+ L+ GD+VERHLEDGD+VLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKNN 539
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKNN
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFF RA   QLLSMMSD NL+FDIPPP+I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFKP 600

Query: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659
              +WTGKQ+FSLLI+PNKESPVVINLDAKNKVYIPP++KS P+EMS NDGYV+IRGS+IL
Sbjct: 601  QCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQE+A AMNRMAKLCAR+LGNRGFSIGI+DVTPG
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTPG 720

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             ELK KKE +VE AY KCD LI  +NKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  EELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
            CI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFF+GL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959
            DNTIRTSSNGIVQFTYGGDGLDP+DMEGNA+PVNF R+W+HA+N+TF+   K LLPYQI+
Sbjct: 901  DNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQII 960

Query: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019
            +QTN +L+PLE  LVRY+N+G  L      + EY+DQ DA+R+FY S+R+YM EKA  LA
Sbjct: 961  KQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQLA 1020

Query: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079
             IR  + LKE + EPA ELQ +D DE  P++    VD+LCKIS   V KFLEIAI KYH+
Sbjct: 1021 KIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYHR 1080

Query: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            AKVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTPI 1140

Query: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199
            I AVLVN++D RAARVVKGRIEKTLLSDVA+YI+DVY+DN +F+++K+DL TIEKLQLEL
Sbjct: 1141 IKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLEL 1200

Query: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259
            T+EDIA+AI++A KLKI +S++ I+G DK+ I+V+ E +  KSISTS KE  EN +FY+M
Sbjct: 1201 TIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEAS--KSISTSLKESSENTVFYKM 1258

Query: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319
            Q LRRALP +VVKGL DI+RAVINIKDD   ELLVEGYGLR+VM TDGVIG KT TNHIL
Sbjct: 1259 QTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHIL 1318

Query: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379
            E+F+VLGIEAAR+SIVGEIDYTMSNHGMSVDPRH+QLLGDVMT+KGE+LGITRFGLSKMR
Sbjct: 1319 EIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMR 1378

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKD V+GVSECIILGQTMSIGTG+F VVK T +S   
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSPEQ 1438

Query: 1440 LAPKPTLFESLCDSVTALKVN 1460
            + PK TLFESL  S    K+N
Sbjct: 1439 VKPKRTLFESLVSSNDHNKLN 1459

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 2274 bits (5894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1078/1144 (94%), Positives = 1111/1144 (97%)

Query: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60
            MKEVVVDIAPKRIKGLEFSALSASDIV QSKVEISTRDLFDLENGRKPKSGGALDTRMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120
            SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICK+CAALLLSEEDK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILH 180
             QFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLN              LKILH
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240
            DTFRWVGKKSAPEKDKWVGDWKTVL+HNPELERYVKKCMDDLNPLKTLNLFKQV+PEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNK KLQQLVI
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGPNEHPGANYLLKKDEEARRNLRYGDR+KLA+NLQYGD+VERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            LTPKSGEPIIAATQDFITGSYLISHKDSF+SRAEFVQLLSMMSDGN+QFDIPPP+IMKPY
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
            YMWTGKQVFSLLIRPNK+S VVINLDAKNKVYIPPK K LPNEMSINDG+VVIRGS+ILS
Sbjct: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720
            GVMDKSVLGDGKKHSVFYTILRDFGP+EAA+AMNRMAKLCAR+LGNRGFSIGINDVTPGF
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720

Query: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
            ELKNKKE+MVEDAYAKCD LID FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
            IKELDNLNSCLIMANCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960
            NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNF+RSW+HANN+TFNH DKPLLPYQIMQ
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960

Query: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020
            QTN +L+PLEEKLVRYDNLG  LDPSLQDR E+IDQDDAERNFYKSLR+Y++ KASHLA 
Sbjct: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020

Query: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080
            IR+HKGLK+FLDEPA ELQ+MDLDEG+P++ LASVDQLCKISSKLV KFLEIAIFKYHKA
Sbjct: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080

Query: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVL 1144
            NAVL
Sbjct: 1141 NAVL 1144

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1744

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1512 (34%), Positives = 767/1512 (50%), Gaps = 166/1512 (10%)

Query: 9    APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R +K ++F   S  +I A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTVKEVQFGLFSPEEICAISVAKIKFPETMD-ETQTRAKIGGLNDPRLGSIDRSLKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
             TC   +  C GHFGHI+L+ PVFH+G+     +V + +C  C  LLL E +      E 
Sbjct: 68   QTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------EQ 121

Query: 128  RRPGI---DNLRRMGILKKVVDQCKKQRRCLR--CGSLNXXXXXXXXXXXXXXLKILHDT 182
             R  I   D+ +R      V   CK +  C        +                I  D 
Sbjct: 122  MRQAIKIKDSKKR---FNAVWSLCKAKMICDTDVPSDEDPTQLISRGGCGNAQPTIRRDG 178

Query: 183  FRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCELL 242
             + VG   + +KDK  GD       N E E+ V      LN  + LN+FK ++PED   L
Sbjct: 179  LKLVG---SWKKDKNSGD-------NEEPEQRV------LNMEEILNIFKHISPEDSWKL 222

Query: 243  GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
               G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280  EHNGAPHHTIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L  LV 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVR 393

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPSLH 451

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQI 511

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            ++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P+I+KP 
Sbjct: 512  VSPQSNKPCMGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPDWDGV--IPTPAILKPK 569

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGYVVIRGSKI 658
             +WTGKQ+ S+ I      P  I+L    +    + PKD          +G +VI G +I
Sbjct: 570  PLWTGKQLLSVAI------PKGIHLQRFDEGTTLLSPKD----------NGMLVIDG-QI 612

Query: 659  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIND-VT 717
            + GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI D + 
Sbjct: 613  IFGVVDKKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGDTIA 671

Query: 718  PGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG 777
             G  ++   E + E A  K + +        L  + G    ++ E  +   L++ R++ G
Sbjct: 672  DGQTMRQITEAIAE-AKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAG 730

Query: 778  EVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKN 837
             +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731  RLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKD 790

Query: 838  SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 897
              +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791  DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 898  QYDNTIRTSSNGIVQFTYGGDGLDPIDMEGNA-QPVNFS-RSWEHANNVTFNHVDKPLLP 955
             YD T R S   I+QF YG DG+D   +E  A + +  S R++E    +   + D  L P
Sbjct: 851  HYDGTTRNSLGNIIQFIYGEDGMDAAHIEKQAVETIGGSDRNFERRYRIDLLNPDYSLDP 910

Query: 956  YQIMQQTNGVLKPL---------------EEKLVRYDNLGNELDPSLQDRVEYIDQDDAE 1000
              +++  + ++  L               + K +R   +  E++  L   +  I Q +A+
Sbjct: 911  -SLLESGSEIIGDLKLQSLLDEEYKQLVEDRKFLRRIFVDGEVNWPLPVNIRRIIQ-NAQ 968

Query: 1001 RNFY--------KSLRDYMY---EKASHLANIRAHKGLKEFLDEPAAELQAMDLDEGAPA 1049
            + F          ++RD ++   E    L  +R +  + +   E A  L    +     +
Sbjct: 969  QTFRIDRSKPSDVTIRDVVWGVKELQERLLVVRGNSRIIKEAQEDAITLFCCLMRSRLAS 1028

Query: 1050 SALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFH 1109
              +    +L K + + VL  +E+   ++ ++ V PG  VG + A SIGEP TQMTL TFH
Sbjct: 1029 RRVIQEYRLTKQAFEWVLNNIEV---QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1110 FAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSD 1167
            FAGVAS  VT GVPR+KEI+N +K + TP + A L  +   D+  A++++  IE T L  
Sbjct: 1086 FAGVASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKS 1145

Query: 1168 VAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELTVEDIAVAITRAAK----LKIAASDVSI 1223
            V    +  Y  +     +  D    E +QL  ++ D     + A +    L++     ++
Sbjct: 1146 VTVASEIYYDPDPRSTAIPEDE---EIIQLHFSLLDDETEKSLAQQSPWLLRLELDRAAM 1202

Query: 1224 MGKDKVNINVYPEMAKLKSISTSAKEPVENELFY------------RMQHLR-------- 1263
              KD            +  +    KE  +N+LF             R + +R        
Sbjct: 1203 NDKD----------LTMGQVGEKIKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMDLET 1252

Query: 1264 -------------RALPGIVVKGLPDIARAVINIKD------DGSRE------LLVEGYG 1298
                           L  I ++G+ +I R V+   D       G  +      L  +G  
Sbjct: 1253 EAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVN 1312

Query: 1299 LREVMTTDGVIGMKTKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLG 1358
            L EVMT  GV   +  TN  +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL 
Sbjct: 1313 LSEVMTVPGVDASRIYTNSFIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLV 1372

Query: 1359 DVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQ 1418
            DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ
Sbjct: 1373 DVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQ 1432

Query: 1419 TMSIGTGAFKVV 1430
               IGTGAF V+
Sbjct: 1433 MAPIGTGAFDVM 1444

>Suva_4.104 Chr4
            complement(193257..193711,193754..193782,194161..198878)
            [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1498 (34%), Positives = 764/1498 (51%), Gaps = 138/1498 (9%)

Query: 9    APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R +K ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
             TC   +  C GHFGHI L+ PVFHVG+     +V + +C  C  LLL E +      EL
Sbjct: 68   QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------EL 121

Query: 128  RRPGI---DNLRRMGILKKVVDQCKKQRRC-LRCGSLNXXXXXXXXXX-XXXXLKILHDT 182
             R  +   D  +R G +  +   CK +  C     S N                 +  D 
Sbjct: 122  MRQALAIKDTKKRFGAIWTL---CKTKMVCETDVPSENDPTQLVSRGGCGNTQPTVRKDG 178

Query: 183  FRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCELL 242
             + VG   + +KD+  GD     A  PEL          L+  + LN+FK ++ +D   L
Sbjct: 179  LKLVG---SWKKDRATGD-----ADEPELRV--------LSTEEILNIFKHISAKDSSSL 222

Query: 243  GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
               G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L QLV 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIR-DSGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            ++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P+I+KP 
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
             +W+GKQV S+ I PN    + +    +    + PKD    N M I DG +V        
Sbjct: 570  PLWSGKQVLSVAI-PNG---IHLQRFDEGTTLLSPKD----NGMLIIDGQIVF------- 614

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIND-VTPG 719
            GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D +  G
Sbjct: 615  GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADG 673

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
              ++   E  + DA  K   +        L  + G    ++ E  +   L++ R++ G +
Sbjct: 674  PTMREITET-IADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
                L +LN+   M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733  AEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTLPHFSKDDY 792

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793  SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPV--NFSRSWEHANNVTFNHVDKPLLPYQ 957
            DNT R S   ++QF YG DG+D   +E  +         ++E    +   + D  L P  
Sbjct: 853  DNTTRNSLGNVIQFIYGEDGMDASHIEKQSLDTIGGSDAAFEKRYRIDLLNPDHILDP-S 911

Query: 958  IMQQTNGVLKPL---------------EEKLVRYDNLGNELDPSLQDRVEYIDQDDAERN 1002
            +++  + +L  L               +   +R+  +  E +  L   +  I Q +A++ 
Sbjct: 912  LLESGSEILGDLKLQVLLDEEYKQLVKDRSFLRHIFVDGEANWPLPVNIRRIIQ-NAQQT 970

Query: 1003 FY--------KSLRDYMYEKASHLANIRAHKGLKEFLDEPAAELQAMDLDEGAPASALAS 1054
            F+         +++D +        N+   +G  E +    A+  A+ L      S LAS
Sbjct: 971  FHIDHTKPSDLTIKDIVIGVKDLQENLLVLRGKNEIIQN--AQQDAVTLFCCLLRSRLAS 1028

Query: 1055 --VDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAG 1112
              V Q  K++ +     L     ++ ++ V PG  VG + A SIGEP TQMTL TFHFAG
Sbjct: 1029 RRVIQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG 1088

Query: 1113 VASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSDVA- 1169
            VAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A+ ++  IE T L  V  
Sbjct: 1089 VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTLKSVTI 1148

Query: 1170 ----FYIQD----VYKDNMSFLQVKVDLGTIEK-----------LQLEL-----TVEDIA 1205
                +Y  D    V  ++   +Q+   L   E            L+LEL       +D+ 
Sbjct: 1149 ASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLT 1208

Query: 1206 VAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAK-EPVENELFYRMQHLRR 1264
            +        +   +D+ ++  +  +  +      ++  S  A+ E  E+ +  ++++   
Sbjct: 1209 MGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT-- 1266

Query: 1265 ALPGIVVKGLPDIARAVINIKD------------DGSRELLVEGYGLREVMTTDGVIGMK 1312
             L  I ++G+ +I R V+   D            +    L  +G  L EVMT  G+   +
Sbjct: 1267 MLENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMTVPGIDPTR 1326

Query: 1313 TKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITR 1372
              TN  +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR
Sbjct: 1327 IYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTR 1386

Query: 1373 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
             G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V+
Sbjct: 1387 HGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1730

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/1511 (34%), Positives = 767/1511 (50%), Gaps = 163/1511 (10%)

Query: 9    APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R IK ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNYKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
             TC   +  C GHFGHI+L+ PVFH+G+     +V + +C  C  LLL E ++    +  
Sbjct: 68   QTCGEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLLDEHNEQMKQAIK 127

Query: 128  RRPGIDNLRRMGILKKVVDQCKKQ--------RRCLRCGSLNXXXXXXXXXXXXXXLKIL 179
             +        +  L KV   C+ +        +   R G  N                I 
Sbjct: 128  IKDPKRRFNAVWTLSKVKMICETEVPSEDDPTKYISRGGCGNTQP------------SIR 175

Query: 180  HDTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDC 239
             D    VG         W  D     A  PE     K+    ++  + LN+FK + PED 
Sbjct: 176  KDGLSLVGT--------WKKDKNADDADQPE-----KRI---ISAEEVLNVFKHICPEDS 219

Query: 240  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
              LG +      RPE  +   LP PP  +RPS+   ++    EDDLT KL +I+  +  +
Sbjct: 220  WRLGFNEDF--ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINV 276

Query: 300  KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLK 357
            +     G   + + E    LQ  VA Y+++D      A+   G      +PI+    RLK
Sbjct: 277  QRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG------RPIKSIRARLK 330

Query: 358  GKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQ 417
            GK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L Q
Sbjct: 331  GKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQ 390

Query: 418  LVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQP 477
            LV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQP
Sbjct: 391  LVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQP 448

Query: 478  SLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVK 537
            SLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V 
Sbjct: 449  SLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP 508

Query: 538  NNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIM 597
              +++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P+I+
Sbjct: 509  LQIVSPQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWVPDWDGV--IPTPTIL 566

Query: 598  KPYYMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGYVVIRG 655
            KP  +W+GKQ+ S+ I      P  I+L    +    + PKD    N M I DG      
Sbjct: 567  KPKPLWSGKQILSMAI------PKGIHLQRFDEGTTLLSPKD----NGMLIVDG------ 610

Query: 656  SKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIND 715
             +I+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +L + GFSIGI D
Sbjct: 611  -QIIFGVVDKKTVG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLHNGFSIGIGD 668

Query: 716  VTPGFELKNKKEIMVEDAYAK--CDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVR 773
                 + K  +EI    A AK   + +        L  + G    ++ E  +   L++ R
Sbjct: 669  TIA--DQKTMREITEAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEAR 726

Query: 774  EEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 833
            ++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPH 786

Query: 834  FLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 893
            F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 894  DLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGNA--QPVNFSRSWEHANNVTFNHVDK 951
            D+   YD T R S   I+QF YG DG+D   +E  +        R++E    +   + D 
Sbjct: 847  DIMVHYDGTTRNSLGNIIQFIYGEDGMDAAHIEKQSIDTIAGSDRAFERRYRIDLLNPDN 906

Query: 952  PLLPYQIMQQTNGVLKPL---------------EEKLVRYDNLGNELDPSLQDRVEYIDQ 996
             L P  +++  + ++  L               + + +R   +  E +  L   +  I Q
Sbjct: 907  ALDP-SLLESGSEMMGDLKLQASLDEEYRQLVEDRRFLRKIFVDGEQNWPLPVNIRRIIQ 965

Query: 997  DDAERNFY--------KSLRDYMYEKASHLANIRAHKGLKEFLDEPAAELQAMDLDEGAP 1048
             +A++ F          ++ D +Y        +   +G  E L E  A+  A+ L     
Sbjct: 966  -NAQQTFRIDHTKPTDLTIHDVIYGVKDLQEKLLVLRGKSEMLQE--AQTNAVTLFCCLL 1022

Query: 1049 ASALASVD-----QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQM 1103
             S LAS       +L K + + VL  +E    ++ ++ V PG  VG + A SIGEP TQM
Sbjct: 1023 RSRLASRRVIEEYKLTKQTFQWVLNNVEA---QFLRSIVHPGEMVGVLAAQSIGEPATQM 1079

Query: 1104 TLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIE 1161
            TL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L +    D+  A++++  IE
Sbjct: 1080 TLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLESEESADQEKAKLIRSAIE 1139

Query: 1162 KTLLSDVA-----FYIQD----VYKDNMSFLQVKVDLGTIEKLQLELTVEDIAVAITRAA 1212
             T L  V      +Y  D    V +D+   +Q+   L   E    E +++  +  + R  
Sbjct: 1140 HTTLKSVTVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEET---EQSLDHQSPWLLRLE 1196

Query: 1213 KLKIAASDVSI-MGK--DKVNINVYPEMAKLKSISTSAK------------------EPV 1251
              + A +D  + MG+  +K+      ++  + S   + K                  E  
Sbjct: 1197 LDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAE 1256

Query: 1252 ENELFYRMQHLRRALPGIVVKGLPDIARAVINIKDDGSRE------------LLVEGYGL 1299
            E+ +  ++++    L  I ++G+ DI R V+   D  +              L  +G  L
Sbjct: 1257 EDHMLKKIENT--MLESITLRGVEDITRVVMMKYDRKTPSATGEYQKVPEWVLETDGVNL 1314

Query: 1300 REVMTTDGVIGMKTKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGD 1359
             EVM+  GV   +  TN  +++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL D
Sbjct: 1315 AEVMSVPGVDSTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVD 1374

Query: 1360 VMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQT 1419
            VMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ 
Sbjct: 1375 VMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDNCRGVSENVILGQM 1434

Query: 1420 MSIGTGAFKVV 1430
              IGTGAF V+
Sbjct: 1435 APIGTGAFDVM 1445

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
            RPO21RNA polymerase II largest subunit B220, part of
            central core; phosphorylation of C-terminal heptapeptide
            repeat domain regulates association with transcription
            and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1501 (34%), Positives = 766/1501 (51%), Gaps = 144/1501 (9%)

Query: 9    APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R +K ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
             TC   +  C GHFGHI L+ PVFHVG+     +V + +C  C  LLL E +      EL
Sbjct: 68   QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------EL 121

Query: 128  RRPGI---DNLRRMGILKKVVDQCKKQRRCLR--CGSLNXXXXXXXXXXXXXXLKILHDT 182
             R  +   D+ +R   +  +   CK +  C        +                I  D 
Sbjct: 122  MRQALAIKDSKKRFAAIWTL---CKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDG 178

Query: 183  FRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCELL 242
             + VG   + +KD+  GD     A  PEL          L+  + LN+FK ++ +D   L
Sbjct: 179  LKLVG---SWKKDRATGD-----ADEPELRV--------LSTEEILNIFKHISVKDFTSL 222

Query: 243  GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
               G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
            GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L QLV 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
            NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIR-DSGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
            ++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P+I+KP 
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
             +W+GKQ+ S+ I PN    + +    +    + PKD    N M I DG       +I+ 
Sbjct: 570  PLWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPKD----NGMLIIDG-------QIIF 614

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIND-VTPG 719
            GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D +  G
Sbjct: 615  GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADG 673

Query: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
              ++   E + E A  K   +        L  + G    ++ E  +   L++ R++ G +
Sbjct: 674  PTMREITETIAE-AKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
                L +LN+   M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733  AEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDY 792

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793  SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPV--NFSRSWEHANNVTFNHVDKPLLPYQ 957
            DNT R S   ++QF YG DG+D   +E  +         ++E    V   + D  L P  
Sbjct: 853  DNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDP-S 911

Query: 958  IMQQTNGVLKPL---------------EEKLVRYDNLGNELDPSLQDRVEYIDQDDAERN 1002
            +++  + +L  L               + K +R   +  E +  L   +  I Q +A++ 
Sbjct: 912  LLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQ-NAQQT 970

Query: 1003 FY--------KSLRDYMYEKASHLANIRAHKGLKEFLDEPAAELQAMDLDEGAPASALAS 1054
            F+         +++D +        N+   +G  E +    A+  A+ L      S LA+
Sbjct: 971  FHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQN--AQRDAVTLFCCLLRSRLAT 1028

Query: 1055 VD-----QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFH 1109
                   +L K +   VL  +E    ++ ++ V PG  VG + A SIGEP TQMTL TFH
Sbjct: 1029 RRVLQEYRLTKQAFDWVLSNIEA---QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1110 FAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSD 1167
            FAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  
Sbjct: 1086 FAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKS 1145

Query: 1168 VA-----FYIQD----VYKDNMSFLQVKVDLGTIEK-----------LQLEL-----TVE 1202
            V      +Y  D    V  ++   +Q+   L   E            L+LEL       +
Sbjct: 1146 VTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDK 1205

Query: 1203 DIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAK-EPVENELFYRMQH 1261
            D+ +        +   +D+ ++  +  +  +      ++  S  A+ E  E+ +  ++++
Sbjct: 1206 DLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIEN 1265

Query: 1262 LRRALPGIVVKGLPDIARAVINIKD------------DGSRELLVEGYGLREVMTTDGVI 1309
                L  I ++G+ +I R V+   D            +    L  +G  L EVMT  G+ 
Sbjct: 1266 T--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGID 1323

Query: 1310 GMKTKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILG 1369
              +  TN  +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  
Sbjct: 1324 PTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTS 1383

Query: 1370 ITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKV 1429
            +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V
Sbjct: 1384 VTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDV 1443

Query: 1430 V 1430
            +
Sbjct: 1444 M 1444

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1719

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1513 (34%), Positives = 776/1513 (51%), Gaps = 168/1513 (11%)

Query: 9    APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R +K ++F   S  ++ + S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTVKEVQFGLFSPEEVRSISVAKIKFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSE--EDKHQFLS 125
             TC   +  C GHFGHI L+ PVFH+G+     +V + IC  C  LLL E  E   Q +S
Sbjct: 68   QTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNEQMRQVMS 127

Query: 126  ELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
                   D+ +R   +  +   CK +  C                     +    D  + 
Sbjct: 128  IK-----DSKKRFNAIWTL---CKTKTVC------------------ETDVPSEDDPTQL 161

Query: 186  VGK------KSAPEKD--KWVGDWKTVLAHNP--ELERYVKKCMDDLNPLKTLNLFKQVA 235
            + +      +    KD  K VG WK   A N   E E+ V      LN  + LN+FK ++
Sbjct: 162  ISRGGCGNAQPTIRKDGLKLVGSWKKDKATNDGDEPEQRV------LNTEEILNIFKHIS 215

Query: 236  PEDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWT 295
              D   LG +   +  RP+  I   LP PP  +RPS+   +S    EDDLT KL +I+  
Sbjct: 216  VHDSNTLGFNE--QFARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKA 272

Query: 296  SSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFC 353
            +  ++     G   + + E    LQ  +A Y+++D      A+   G      +P++   
Sbjct: 273  NISLETLEHNGAPHHAIEEAESLLQFHIATYMDNDIAGQPQALQKSG------RPVKSIR 326

Query: 354  QRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQ 413
             RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  
Sbjct: 327  ARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNID 386

Query: 414  KLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLF 473
            +L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLF
Sbjct: 387  RLTQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLF 444

Query: 474  NRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 533
            NRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L
Sbjct: 445  NRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQL 504

Query: 534  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFD--I 591
              V   +++P+S +P +   QD + G   ++ +D F    + + +L  + D    +D  I
Sbjct: 505  CSVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDCFIELDQLLNMLYWVPD----WDGII 560

Query: 592  PPPSIMKPYYMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDG 649
            P P+I+KP  +W+GKQ+ S+ I      P  I+L    +    + PKD    N M I DG
Sbjct: 561  PTPAIIKPVPLWSGKQILSIAI------PKGIHLQRFDEGTTMLSPKD----NGMLIIDG 610

Query: 650  YVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGF 709
                   +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GF
Sbjct: 611  -------QIIFGVVDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGF 662

Query: 710  SIGIND-VTPGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGL 768
            S GI D +  G  +K   E  + DA  K + +        L  + G    ++ E  +   
Sbjct: 663  STGIGDTIADGGTMKEITET-IADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRF 721

Query: 769  LSKVREEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQD 828
            L++ R++ G +    L++LN+   M + GSKGS +N++QM A VGQQ + G R+  GF D
Sbjct: 722  LNEARDKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVD 781

Query: 829  RSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRL 888
            R+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL
Sbjct: 782  RTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRL 841

Query: 889  MKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDP-------IDMEGNAQPVNFSRSWEHA 941
            +K+LED+   YD+T R S   ++QF YG DG+D        ID  G +    F + +   
Sbjct: 842  VKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIEKQSIDTIGGSDAA-FEKRY-RI 899

Query: 942  NNVTFNHVDKPLLPYQIMQQTNGV---------LKPL--EEKLVRYDNLGNELDPSLQDR 990
            + ++ NH   P L    ++ T  V          K L  + + +R   +  E +  L   
Sbjct: 900  DLMSPNHALDPSLLESGLEITGDVKLQSILDTEYKQLVDDRRFLRNVFIDGEPNWHLPVN 959

Query: 991  VEYIDQDDAERNFY--------KSLRDYMYEKASHLANIRAHKGLKEFLDEPAAELQAMD 1042
            +  I Q +A++ F          ++ + + + A    N+   +G  + ++E  A+  A+ 
Sbjct: 960  IRRIIQ-NAQQTFRIDHTKPSDLTINEVIRDVARLQENLLVLRGKGKIIEE--AQNDAIT 1016

Query: 1043 LDEGAPASALA--SVDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPG 1100
            L      S LA   V Q  +++ +     L     ++ ++ V PG  VG + A SIGEP 
Sbjct: 1017 LFCCLVRSRLAVRRVLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPA 1076

Query: 1101 TQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKG 1158
            TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP     L      D+  A++++ 
Sbjct: 1077 TQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRS 1136

Query: 1159 RIEKTLLSDVA-----FYIQD----VYKDNMSFLQVKVDLGTIEK-----------LQLE 1198
             IE T L  V      +Y  D    V  ++   +Q+   L   E            L+LE
Sbjct: 1137 AIEHTTLKSVTVASEIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLE 1196

Query: 1199 L---TVEDIAVAITRAA-KLK-IAASDVSIM----GKDKVNINVYPEMAKLKSISTSAKE 1249
            L    + D  + + +   K+K    +D+S++      DK+ I     + + KS+     E
Sbjct: 1197 LDRAAMNDKDLTMVQVGEKIKETFRNDLSVIWSEDNADKLIIRC--RVVRPKSLDAET-E 1253

Query: 1250 PVENELFYRMQHLRRALPGIVVKGLPDIARAVINIKD------DGSRE------LLVEGY 1297
              E+ +  ++++    L  I ++G+ DI R V+   D       G  +      L  +G 
Sbjct: 1254 AEEDHMLKKIENT--MLESITLRGVEDIERVVMMKYDRKMPSETGEYQKVPEWVLETDGV 1311

Query: 1298 GLREVMTTDGVIGMKTKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLL 1357
             L EVMT  GV G +  TN  +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL
Sbjct: 1312 NLMEVMTVPGVDGSRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALL 1371

Query: 1358 GDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILG 1417
             DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILG
Sbjct: 1372 VDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILG 1431

Query: 1418 QTMSIGTGAFKVV 1430
            Q   IGTGAF V+
Sbjct: 1432 QMAPIGTGAFDVM 1444

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL140C
            (RPO21) - RNA polymerase II large subunit [contig 161]
            FULL
          Length = 1728

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1510 (34%), Positives = 762/1510 (50%), Gaps = 145/1510 (9%)

Query: 1    MKEVVVDIAPKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMG 59
            M E     AP R +K ++F   S  ++ A S  +I   +  D E   + K GG  D R+G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGMFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLG 59

Query: 60   VSSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEED 119
                  +C TC   +  C GHFGHI+L+ PVFH+GY     +V + +C  C  LLL E  
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120  KHQFLSELRRPGI---DNLRRMGILKKVVDQCKKQRRC-LRCGSLNX-XXXXXXXXXXXX 174
                 SEL +  I   D  RR      V   CK +  C     S N              
Sbjct: 119  -----SELMKQAIKIKDPKRR---FNAVWSLCKVKMVCETEVPSDNDPSQYVSRGGCGNT 170

Query: 175  XLKILHDTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQV 234
               +  D    VG     +KDK   D     A  PE  R +      ++  + LN+FK +
Sbjct: 171  QPSVRKDGLSLVG---TWKKDKGADD-----ADQPE--RRI------ISADEVLNVFKHI 214

Query: 235  APEDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVW 294
            +PED   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +I+ 
Sbjct: 215  SPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILK 271

Query: 295  TSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGF 352
             +  ++     G   + + E    LQ  VA Y+++D      A+   G      +PI+  
Sbjct: 272  ANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG------RPIKSI 325

Query: 353  CQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNK 412
              RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN 
Sbjct: 326  RARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNI 385

Query: 413  QKLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVL 472
             +L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VL
Sbjct: 386  DRLTQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVL 443

Query: 473  FNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAIN 532
            FNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   
Sbjct: 444  FNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQ 503

Query: 533  LMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIP 592
            L  V   +++ +S +P +   QD + G   ++ +D+F    + + +L  + D +    IP
Sbjct: 504  LCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELEQVLNMLYWIPDWDGV--IP 561

Query: 593  PPSIMKPYYMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGY 650
             P I+KP  +W+GKQ+ S+ I      P  I+L    +    + PKD    N M I DG 
Sbjct: 562  TPIILKPKPLWSGKQILSIAI------PTGIHLQRFDEGTTLLSPKD----NGMLIIDG- 610

Query: 651  VVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFS 710
                  +I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + GFS
Sbjct: 611  ------QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNYWLLHNGFS 663

Query: 711  IGINDVTPGFELKNKKEIM--VEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGL 768
            IGI D     + K+ +EI   +  A  K + +        L  + G    ++ E  +   
Sbjct: 664  IGIGDTIA--DEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRY 721

Query: 769  LSKVREEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQD 828
            L++ R++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF D
Sbjct: 722  LNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFAD 781

Query: 829  RSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRL 888
            R+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL
Sbjct: 782  RTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRL 841

Query: 889  MKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGNA------QPVNFSRSW---- 938
            +K+LED+   YD T R S   ++QF YG DG+D   +E  A          F R +    
Sbjct: 842  VKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQAIDTIACSDAAFERRFKIDL 901

Query: 939  ---EHANNVTFNHVDKPLL-PYQIMQQTNGVLKPLEE--KLVRYDNLGNELDPSLQDRVE 992
               +HA + +       ++   ++    +   K L E  + +R   +  E +  L   + 
Sbjct: 902  LNPKHALDPSLLESGSEIIGDLKLQALLDEEFKQLSEDRQFLRKIFVDGEQNWPLPVNIR 961

Query: 993  YIDQDDAERNFY--------KSLRDYMYEKASHLANIRAHKGLKEFLDEPAAELQAMDLD 1044
             I Q +A++ F          S+RD +Y        +   +G  + L E  A++ A+ L 
Sbjct: 962  RIIQ-NAQQTFRIDHTKPTDLSIRDVIYGVKELQEKLLVLRGKSKILQE--AQVNAVTLF 1018

Query: 1045 EGAPASALAS--VDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQ 1102
                 S LAS  V Q  +++ +     L     ++ ++ V PG  VG + A SIGEP TQ
Sbjct: 1019 CCLLRSRLASRRVIQEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVLAAQSIGEPATQ 1078

Query: 1103 MTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRI 1160
            MTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  I
Sbjct: 1079 MTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDEEHAADQEKAKLIRSAI 1138

Query: 1161 EKTLLSDVA-----FYIQD----VYKDNMSFLQVKVDLGTIEKLQ---------LELTVE 1202
            E T L  +      +Y  D    V +D+   +Q+   L   E  Q         L L ++
Sbjct: 1139 EHTTLKSITVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDYQSPWLLRLELD 1198

Query: 1203 DIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKL----------KSISTSAKEPVE 1252
              A+        ++          D   I       KL          K++   A E  E
Sbjct: 1199 RAAMNDKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLVIRCRVVRDPKTLDAEA-EAEE 1257

Query: 1253 NELFYRMQHLRRALPGIVVKGLPDIARAVINIKDDGSRE------------LLVEGYGLR 1300
            + +  R+++    L  I ++G+ DI R V+   D                 L  +G  L 
Sbjct: 1258 DHMLKRIENT--MLESITLRGVEDITRVVMMKYDRKVPSPAGDYHKIPEWVLETDGVNLA 1315

Query: 1301 EVMTTDGVIGMKTKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDV 1360
            EVM   GV   +  TN  +++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DV
Sbjct: 1316 EVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDV 1375

Query: 1361 MTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM 1420
            MT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ  
Sbjct: 1376 MTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVA 1435

Query: 1421 SIGTGAFKVV 1430
             IGTGAF V+
Sbjct: 1436 PIGTGAFDVM 1445

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_7.314
          Length = 1716

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1511 (33%), Positives = 753/1511 (49%), Gaps = 164/1511 (10%)

Query: 9    APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
            AP R +K ++F   S  ++   S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9    APLRTVKEVQFGLFSPEEVRGISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68   STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
             TC   +  C GHFGHI L+ PVFHVG+     +V +S+C  C  LLL E ++    +  
Sbjct: 68   QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNEQMRQAMA 127

Query: 128  RRPGIDNLRRMGILKKVVDQCKKQRRCLR--CGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
             +   D+ +R      V   CK +  C        +                I  D  + 
Sbjct: 128  IK---DSKKR---FNAVWTLCKTKMICETDVPSDDDPTTLISRGGCGNAQPSIRKDGLKL 181

Query: 186  VGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCELLGID 245
            VG         W  +  T     PE +R        L+  + LN+FK ++PED   +G  
Sbjct: 182  VGS--------WKKEKNTSDGDEPE-QRV-------LSTEEILNIFKHISPEDSTRMGFS 225

Query: 246  STVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEK 305
                  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226  EEF--ARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306  GISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQGRF 363
            G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+GR 
Sbjct: 283  GAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRI 336

Query: 364  RGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVINGP 423
            RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN  +L QLV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 424  NEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLHRLS 483
            NEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMS 454

Query: 484  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 543
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ 
Sbjct: 455  MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSA 514

Query: 544  KSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMS-----DGNLQFDIPPPSIMK 598
            +S +P +   QD + G   ++ +D+F    EF Q+L+M+      DG     IP P+++K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDTFI---EFDQVLNMLYWVPDWDGV----IPTPAVLK 567

Query: 599  PYYMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGYVVIRGS 656
            P  +WTGKQV S  I      P  I+L    +    + PKD          +G +VI G 
Sbjct: 568  PKPLWTGKQVLSAAI------PKGIHLQRFDEGTTLLSPKD----------NGMLVIDG- 610

Query: 657  KILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIND- 715
            +I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D 
Sbjct: 611  QIIFGVVDKKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTGIGDT 669

Query: 716  VTPGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 775
            +  G  +K   E + E A  K + +        L  + G    ++ E  +   L++ R++
Sbjct: 670  IADGQTIKEITETIAE-AKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 728

Query: 776  VGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFL 835
             G +    L++LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFS 788

Query: 836  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 895
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 896  SCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGN------AQPVNFSRSW-------EHAN 942
               YD T R S   ++QF YG DG+D   +E           V F R +       EH+ 
Sbjct: 849  MVHYDGTTRNSLGNVIQFIYGEDGIDAAHIEKQTLDTIGGSDVAFERRYRIDLLNPEHSL 908

Query: 943  NVTFNHVDKPL---LPYQIMQQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDA 999
            + T       +   L  Q +          + + +R   +  E +  L   +  I Q +A
Sbjct: 909  DPTLLESGSEIAGDLKLQALLDEEYKQLVEDRRFLREIFVDGESNWPLPVNIRRIIQ-NA 967

Query: 1000 ERNFY--------KSLRDYMY---EKASHLANIRAHKGLKEFLDEPAAELQAMDLDEGAP 1048
            ++ F          ++RD ++   E   HL  +R    + E     A  L    +     
Sbjct: 968  QQTFRIDHSKPSDLTIRDIVFGIKELQEHLLVLRGKSEIIEKAQSDAITLFCCLVRSRLA 1027

Query: 1049 ASALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTF 1108
               +    +L K + + VL  +E    ++ ++ V PG  VG + A SIGEP TQMTL TF
Sbjct: 1028 TRRILQEYKLTKQAFQWVLNNVE---SQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTF 1084

Query: 1109 HFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVN--NNDERAARVVKGRIEKTLLS 1166
            HFAGVAS  VT GVPR+KEI+N +K + TP +   L +  ++D+  A+ ++  IE T L 
Sbjct: 1085 HFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSAIEHTTLK 1144

Query: 1167 DVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELTVEDIAVAITRAAK--LKIAASDVSIM 1224
             +     ++Y D      V  +   I +L   L  ++   ++ R +   L++     ++ 
Sbjct: 1145 SITV-ASEIYYDPDPRSTVIPEDDEIIQLHFSLMDDETEQSLDRQSPWLLRLELDRAAMN 1203

Query: 1225 GKDKVNINVYPEMAKLKSISTSAKEPVENELFY------------RMQHLR--------- 1263
             KD            +  +    KE  +N+LF             R + +R         
Sbjct: 1204 DKD----------LTMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETE 1253

Query: 1264 ------------RALPGIVVKGLPDIARAVINIKD------DGSRE------LLVEGYGL 1299
                          L  I ++G+ +I R V+   D       G  E      L  +G  L
Sbjct: 1254 AEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNL 1313

Query: 1300 REVMTTDGVIGMKTKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGD 1359
             EVMT  G+   +  TN  +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL D
Sbjct: 1314 SEVMTVPGIDATRIYTNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVD 1373

Query: 1360 VMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQT 1419
            VMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ 
Sbjct: 1374 VMTTQGGLTSVTRHGFNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQM 1433

Query: 1420 MSIGTGAFKVV 1430
              IGTGAF V+
Sbjct: 1434 APIGTGAFDVM 1444

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1740

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1520 (34%), Positives = 768/1520 (50%), Gaps = 165/1520 (10%)

Query: 1    MKEVVVDIAPKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMG 59
            M E     AP R +K ++F   S  ++ A S  +I   +  D E   + K GG  D R+G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLG 59

Query: 60   VSSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEED 119
                  +C TC   +  C GHFGHI+L+ PVFH+GY     +V + +C  C  LLL E  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120  KHQFLSELRRPGI---DNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXL 176
                 SEL R  I   D  RR      V   CK +  C                     +
Sbjct: 119  -----SELMRQAIKIKDPKRR---FNAVWSLCKAKMVC------------------ETEV 152

Query: 177  KILHDTFRWVGK------KSAPEKD--KWVGDWKTVLAHNP--ELERYVKKCMDDLNPLK 226
               +D  ++V +      + +  KD    VG WK     +   + ER V      ++  +
Sbjct: 153  PSDNDPAQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRV------ISADE 206

Query: 227  TLNLFKQVAPEDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK ++PED   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGG 344
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D      A+   G    
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 345  KTKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYP 404
              +PI+    RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYP
Sbjct: 320  --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 405  EMVTRYNKQKLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERH 464
            E+VT YN  +L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH
Sbjct: 378  EVVTPYNIDRLTQLVRNGPNEHPGAKYIIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 524
            + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436  IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 525  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSD 584
            E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F    + + +L  + D
Sbjct: 496  ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPD 555

Query: 585  GNLQFDIPPPSIMKPYYMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPN 642
             +    IP P I+KP  +W+GKQ+ S+ I      P  I+L    +    + PKD    N
Sbjct: 556  WDGV--IPTPIILKPKPLWSGKQILSIAI------PSGIHLQRFDEGTTLLSPKD----N 603

Query: 643  EMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCAR 702
             M I DG       +I+ GV+DK  +G      + + + R+ GP+  A   + + K+   
Sbjct: 604  GMLIIDG-------QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNF 655

Query: 703  FLGNRGFSIGINDVTPGFELKNKKEIM--VEDAYAKCDALIDLFNKGKLETQPGCNEEQT 760
            +L + GFSIGI D     + K+ +EI   +  A  K + +        L  + G    ++
Sbjct: 656  WLLHNGFSIGIGDTIA--DEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTLRES 713

Query: 761  LEAKIGGLLSKVREEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGN 820
             E  +   L++ R++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G 
Sbjct: 714  FEDSVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGK 773

Query: 821  RVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAE 880
            R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAE
Sbjct: 774  RIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAE 833

Query: 881  TGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEH 940
            TGY+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E   Q ++   S + 
Sbjct: 834  TGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIASSDA 891

Query: 941  ANNVTF--------NHVDKPLLP--------YQIMQQTNGVLKPLEE--KLVRYDNLGNE 982
            A    F        + +D  LL          ++    +   K L E  + +R   +  E
Sbjct: 892  AFERRFRIDLLNPRHALDPSLLESGSEIIGDLKLQALLDEEFKQLVEDREFLRKIFVDGE 951

Query: 983  LDPSLQDRVEYIDQDDAERNFY--------KSLRDYMYEKASHLANIRAHKGLKEFLDEP 1034
             +  L   +  I Q +A++ F          ++RD +Y        +   +G  + L E 
Sbjct: 952  QNWPLPVNIRRIIQ-NAQQTFRIDQTKPTDLTIRDVVYGVKELQEKLLVLRGKSKILQE- 1009

Query: 1035 AAELQAMDLDEGAPASALAS--VDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVG 1092
             A+  A+ L      S LA+  V Q  +++ +     L     ++ ++ V PG  VG + 
Sbjct: 1010 -AQQNAVTLFCCLLRSRLATRRVIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVLA 1068

Query: 1093 AHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DE 1150
            A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  ++  D+
Sbjct: 1069 AQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAADQ 1128

Query: 1151 RAARVVKGRIEKTLLSDVA-----FYIQD----VYKDNMSFLQVKVDLGTIEKLQ----- 1196
              A++++  IE T L  +      +Y  D    V +++   +Q+   L   E  Q     
Sbjct: 1129 EKAKLIRSAIEHTTLKSITVASEIYYDPDPRSTVIEEDEEIIQLHFSLMDEETEQSLDYQ 1188

Query: 1197 ----LELTVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKL----------KS 1242
                L L ++  A+        ++          D   I       KL          K+
Sbjct: 1189 SPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKT 1248

Query: 1243 ISTSAKEPVENELFYRMQHLRRALPGIVVKGLPDIARAVINIKD------DGSRE----- 1291
            +   A E  E+ +  R+++    L  I ++G+ DI R V+   D       G        
Sbjct: 1249 LDAEA-EAEEDHMLKRIENT--MLESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPEW 1305

Query: 1292 -LLVEGYGLREVMTTDGVIGMKTKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVD 1350
             L  +G  L EVM   GV   +  TN  +++ +VLGIEA R ++  E+   +++ G  V+
Sbjct: 1306 VLETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVN 1365

Query: 1351 PRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGV 1410
             RH+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GV
Sbjct: 1366 YRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGV 1425

Query: 1411 SECIILGQTMSIGTGAFKVV 1430
            SE ++LGQ   IGTGAF V+
Sbjct: 1426 SENVLLGQVAPIGTGAFDVM 1445

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
            complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1162 (37%), Positives = 622/1162 (53%), Gaps = 115/1162 (9%)

Query: 347  KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEM 406
            +P++    RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+
Sbjct: 2    RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 407  VTRYNKQKLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLE 466
            VT YN  +L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ 
Sbjct: 62   VTPYNIDRLTQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 467  DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 526
            D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120  DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 527  RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMS--- 583
            RAE   L  V   +++P+S +P +   QD + G   ++ +DSF    EF Q+L+M+    
Sbjct: 180  RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFI---EFDQVLNMLYWVP 236

Query: 584  --DGNLQFDIPPPSIMKPYYMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKS 639
              DG     IP P+I+KP  +WTGKQ+ S+ I      P  I+L    +    + PKD  
Sbjct: 237  DWDGV----IPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTMLSPKD-- 284

Query: 640  LPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKL 699
                    +G +VI G +I+ GV+DK  +G      + + + R+ GPQ  A     + K+
Sbjct: 285  --------NGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKV 334

Query: 700  CARFLGNRGFSIGIND-VTPGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEE 758
               +L + GFS GI D +  G  +K   E + E A  K + +        L  + G    
Sbjct: 335  VNFWLLHNGFSTGIGDTIADGETMKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLR 393

Query: 759  QTLEAKIGGLLSKVREEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIIS 818
            ++ E  +   L++ R++ G +    L++ N+   M + GSKGS +N++QM A VGQQ + 
Sbjct: 394  ESFEDNVVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVE 453

Query: 819  GNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKT 878
            G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKT
Sbjct: 454  GKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKT 513

Query: 879  AETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDP-------IDMEGNAQP 931
            AETGY+ RRL+K+LED+   YD+T R S   ++QF YG DG+D        ID  G +  
Sbjct: 514  AETGYIQRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIEKQSIDTIGGSNQ 573

Query: 932  VNFSR------SWEHANNVTFNHVDKPLL-PYQIMQQTNGVLKPL--EEKLVRYDNLGNE 982
                R      S EH+ + T       ++   +I    +   K L  + + +R   +  E
Sbjct: 574  AFEKRYRIDLMSPEHSLDTTLLESGSEIIGDVKIQSMLDEEYKQLVNDRRFLRNVFIDGE 633

Query: 983  LDPSLQDRVEYIDQDDAERNFY--------KSLRDYMY---EKASHLANIRAHKGLKEFL 1031
             +  L   +  I Q +A++ F          ++RD +Y   E  S L  +R    + E  
Sbjct: 634  QNWPLPVNIRRIVQ-NAQQTFRIDHTKPSDLTIRDVVYGVKELESKLLVLRGKSKIIEEA 692

Query: 1032 DEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAV 1091
               A  L    L     A  +    +L K +   VL  +E    ++ ++ V PG  VG +
Sbjct: 693  QNDAITLFCCLLRSRLAARRVLEEYRLTKQAFDWVLSNIE---SQFLRSIVHPGEMVGVL 749

Query: 1092 GAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--D 1149
             A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP     L      D
Sbjct: 750  AAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLEPEYAID 809

Query: 1150 ERAARVVKGRIEKTLLSDVA-----FYIQD----VYKDNMSFLQVKVDLGTIEK------ 1194
            +  A+ ++  IE T L  V      +Y  D    V  D+   +Q+   L   E       
Sbjct: 810  QEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIPDDEEIIQLHFSLLDDETEKALDN 869

Query: 1195 -----LQLEL-----TVEDIAVAITRAAKLKIAASDVSIM----GKDKVNINVYPEMAKL 1240
                 L+LEL       +D+ +        +   +D+ ++      DK+ I     + + 
Sbjct: 870  QSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSEDNADKLIIRC--RVVRP 927

Query: 1241 KSISTSAKEPVENELFYRMQHLRRALPGIVVKGLPDIARAVINIKD------DGSRE--- 1291
            KS+     E  E+ +  ++++    L  I ++G+ DI R V+   D      +G+ E   
Sbjct: 928  KSLDAET-EAEEDHMLKKIENT--MLESITLRGVEDIERVVMMKYDRKMPSENGAYEKVP 984

Query: 1292 ---LLVEGYGLREVMTTDGVIGMKTKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMS 1348
               L  +G  L EVMT  GV   +  TN  +++  VLGIEA R ++  E+   +++ G  
Sbjct: 985  EWVLETDGVNLLEVMTVTGVDPTRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSY 1044

Query: 1349 VDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVE 1408
            V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   
Sbjct: 1045 VNYRHMALLVDVMTTQGSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCR 1104

Query: 1409 GVSECIILGQTMSIGTGAFKVV 1430
            GVSE +ILGQ   +GTGAF V+
Sbjct: 1105 GVSENVILGQMAPVGTGAFDVM 1126

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/317 (90%), Positives = 304/317 (95%)

Query: 1144 LVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELTVED 1203
            LVN NDERAARVVKGRIEKTLLSDVAFYIQDVYKDN+SFLQVK+DLGTIEKLQLELT+ED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1204 IAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQHLR 1263
            IAVAITRA+KLKIAA DVSI+GKDKVNINVYPE +KLKSISTSAKEP+ENELFYR+QHLR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1264 RALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILEVFS 1323
            R+LPGIVVKGLPDIARAVINIK DGSRELLVEGYGLR+VMTTDGV+G KTKTNHILEV S
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1324 VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVL 1383
            VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGE+LGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1384 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDLAPK 1443
            QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGT++S  +L PK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1444 PTLFESLCDSVTALKVN 1460
             TLFESLC +  ALK+N
Sbjct: 304  ATLFESLCGNTAALKIN 320

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  566 bits (1458), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 365/931 (39%), Positives = 508/931 (54%), Gaps = 73/931 (7%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  +I A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEIRAISVAKIRLPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
            TC   +  C GHFGHI L+ PVFH+G+     +V +S+C  C  LLL E +      E 
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHN------EQ 121

Query: 128 RRPGIDNLRRMGILKKVVDQCKKQRRCLR--CGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
            R  I           V   CK +  C        +                I  D  + 
Sbjct: 122 MRQAIQIKDPKKRFNAVWSLCKTKMVCETDVPSEDDPTKLISRGGCGNTQPTIRKDGLKL 181

Query: 186 VGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCELLGID 245
           VG   + +KDK  GD     A  PE +R        L+  + LN+FK ++PED   LG +
Sbjct: 182 VG---SWKKDKSTGD-----ADEPE-QRV-------LSTEEILNIFKHISPEDSYRLGFN 225

Query: 246 STVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEK 305
                 RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226 EEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306 GISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQGRF 363
           G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+GR 
Sbjct: 283 GAPHHAVEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRI 336

Query: 364 RGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVINGP 423
           RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN  +L QLV NGP
Sbjct: 337 RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRNGP 396

Query: 424 NEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLHRLS 483
           NEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH++S
Sbjct: 397 NEHPGAKYVIR-DNGDRIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMS 454

Query: 484 ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 543
           +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455 MMAHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 544 KSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMS-----DGNLQFDIPPPSIMK 598
           +S +P +   QD + G   ++ +D+F    EF Q+L+M+      DG     IP P+I+K
Sbjct: 515 QSNKPCMGIVQDTLCGIRKLTLRDTFL---EFDQVLNMLYWVPDWDGV----IPTPAIIK 567

Query: 599 PYYMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGYVVIRGS 656
           P  +W+GKQ+ S+ I      P  I+L    +    + PKD          +G +VI G 
Sbjct: 568 PKPLWSGKQILSVAI------PKGIHLQRFDEGTTLLSPKD----------NGMLVIDG- 610

Query: 657 KILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIND- 715
           +I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D 
Sbjct: 611 EIIFGVVDKKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDT 669

Query: 716 VTPGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 775
           V  G  ++   E + E A  K +A+        L  + G    ++ E  +   L++ R+ 
Sbjct: 670 VADGQTMREISETIAE-AKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDR 728

Query: 776 VGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFL 835
            G +    L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729 AGRLAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFS 788

Query: 836 KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 895
           K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789 KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 896 SCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
              YD T R S   ++QF YG DG+D   +E
Sbjct: 849 MVHYDGTTRNSLGNVIQFIYGEDGMDAGHIE 879

 Score =  169 bits (429), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 134/415 (32%), Positives = 206/415 (49%), Gaps = 47/415 (11%)

Query: 1057 QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASM 1116
            +L K + + VL  +E    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLTKEAFEWVLNNVEA---QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLV--NNNDERAARVVKGRIEKTLLSDVA----- 1169
             VT GVPR+KEI+N +K + TP +   L    + D+  A++V+  IE T L  V      
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSAIEHTTLKSVTVASEI 1152

Query: 1170 FYIQD----VYKDNMSFLQVKVDL--GTIEKLQLELTVEDIAVAITRAA--KLKIAASDV 1221
            +Y  D    V  ++   +Q+   L     EKL  + +   + + + RAA     +    V
Sbjct: 1153 YYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSPWLLRLELDRAAMNDKDLTMGQV 1212

Query: 1222 SIMGKDKVNINVYP--------------EMAKLKSISTSAKEPVENELFYRMQHLRRALP 1267
                KD    +++                + + K++     E  E+ +  ++++    L 
Sbjct: 1213 GERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAET-EAEEDHMLKKIENT--MLE 1269

Query: 1268 GIVVKGLPDIARAVINIKD------DGSRE------LLVEGYGLREVMTTDGVIGMKTKT 1315
             I ++G+  I R V+   D       G  +      L  +G  L EVMT  GV   +  T
Sbjct: 1270 NITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSEVMTVPGVDPTRIYT 1329

Query: 1316 NHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGL 1375
            N  +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G 
Sbjct: 1330 NSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGF 1389

Query: 1376 SKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V+
Sbjct: 1390 NRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1685

 Score =  565 bits (1456), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 359/935 (38%), Positives = 506/935 (54%), Gaps = 81/935 (8%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++ A S  ++   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKVRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
            TC   +  C GHFGHI L+ PVFHVG+     +V +S+C  C  LLL E ++ Q    L
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNE-QMRQVL 126

Query: 128 RRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRWVG 187
           +   I + ++      V   CK +  C                     +   +D  + + 
Sbjct: 127 K---IKDPKKR--FNAVWSLCKTKMIC------------------ETDVPSENDPTQLIS 163

Query: 188 K------KSAPEKD--KWVGDWKT--VLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPE 237
           +      +    KD  K VG WK     +   E E+ V      L   + LN+FK ++PE
Sbjct: 164 RGGCGNAQPTVRKDGLKLVGSWKKDKATSDGEEPEQRV------LGVEEILNIFKHISPE 217

Query: 238 DCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSS 297
           D   LG D      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  + 
Sbjct: 218 DSTKLGFDEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANI 274

Query: 298 LIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQR 355
            ++     G   + + E    LQ  VA Y+++D      A+   G      +P++    R
Sbjct: 275 SLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRAR 328

Query: 356 LKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKL 415
           LKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN  +L
Sbjct: 329 LKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRL 388

Query: 416 QQLVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNR 475
            QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNR
Sbjct: 389 TQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNR 446

Query: 476 QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 535
           QPSLH++S++SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447 QPSLHKMSMMSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 536 VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFD--IPP 593
           V   +++P+S +P +   QD + G  +++ KD+F      + +L  + D    +D  IP 
Sbjct: 507 VPLQIVSPQSNKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPD----WDGIIPT 562

Query: 594 PSIMKPYYMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGYV 651
           P+I+KP  +WTGKQ+ S  I      P  I+L    +    + PKD    N M I DG  
Sbjct: 563 PAILKPKPLWTGKQILSAAI------PKGIHLQRFDEGTTLLSPKD----NGMLIIDG-- 610

Query: 652 VIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSI 711
                +I+ GV+DK  +G      + + + R+ GPQ  +     + K+   +L + GFS 
Sbjct: 611 -----QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFST 664

Query: 712 GINDVTPGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSK 771
           GI D     E   +    + +A  K + +        L  + G    ++ E  +   L++
Sbjct: 665 GIGDTIANGETIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 724

Query: 772 VREEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 831
            R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725 ARDKAGRLAEVNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTL 784

Query: 832 PHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 891
           PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785 PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 892 LEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
           LED+   YD T R S   I+QF YG DG+D   +E
Sbjct: 845 LEDIMVHYDGTTRNSLGNIIQFIYGEDGIDASHIE 879

 Score =  170 bits (430), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 127/394 (32%), Positives = 191/394 (48%), Gaps = 40/394 (10%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVLVNN--NDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIE 1193
             TP +   L      D+  A+ ++  IE T L  V     ++Y D      V  D   I 
Sbjct: 1112 KTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKSVTV-ASEIYYDPDPRSTVIEDDEEII 1170

Query: 1194 KLQLELTVEDIAVAITRAAK--LKIAASDVSIMGKDKVNINVYPEMAKL--KSISTSAKE 1249
            +L   L  E++  ++ + +   L++     ++  KD     V   + +   K +     E
Sbjct: 1171 QLHFSLLDEEMEASLDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKETFKKDLFVIWSE 1230

Query: 1250 PVENELFYRMQHLR---------------------RALPGIVVKGLPDIARAVINIKD-- 1286
                +L  R + +R                       L  I ++G+ +I R V+   D  
Sbjct: 1231 DNAEKLIIRCRVVRPKGLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRK 1290

Query: 1287 ----DGSRE------LLVEGYGLREVMTTDGVIGMKTKTNHILEVFSVLGIEAARTSIVG 1336
                 G  +      L  +G  L EVMT  GV   +  TN  +++  VLGIEA R ++  
Sbjct: 1291 VPSKTGEFQKVPEWVLETDGVNLAEVMTIPGVDTTRIYTNSFIDIMEVLGIEAGRAALYK 1350

Query: 1337 EIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLF 1396
            E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+T + LF
Sbjct: 1351 EVYNVIASDGSYVNYRHMALLVDVMTCQGGLTSVTRHGFNRANTGALMRCSFEETVEILF 1410

Query: 1397 DAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            +A    + D   GVSE ++LGQ   IGTGAF V+
Sbjct: 1411 EAGASAELDDCRGVSENVLLGQMAPIGTGAFGVM 1444

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
           Ashbya gossypii ADR086C
          Length = 1743

 Score =  563 bits (1452), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 365/934 (39%), Positives = 508/934 (54%), Gaps = 79/934 (8%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R IK ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNYKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
            TC   +  C GHFGHI+L+ PVFH+G+     +V + +C  C  LLL E       +EL
Sbjct: 68  QTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNEL 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFR 184
            R  I   D  RR      V   CK +  C                     +    D  +
Sbjct: 122 MRQAIKIKDPKRR---FNAVWSLCKSKMVC------------------DTEVPSEDDPSK 160

Query: 185 WVGK------KSAPEKD--KWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAP 236
           ++ +      + +  KD    VG WK     N E     +K +  L+  + LN+FK + P
Sbjct: 161 YISRGGCGNAQPSIRKDGLSLVGTWKK--DKNSEDSDQPEKRI--LSAEEILNVFKHITP 216

Query: 237 EDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
           ED   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217 EDSLRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297 SLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQ 354
             ++     G   + + E    LQ  VA Y+++D      A+   G      +PI+    
Sbjct: 274 INVQRLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSG------RPIKSIRA 327

Query: 355 RLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQK 414
           RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +
Sbjct: 328 RLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDR 387

Query: 415 LQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFN 474
           L QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFN
Sbjct: 388 LTQLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFN 445

Query: 475 RQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 534
           RQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L 
Sbjct: 446 RQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLC 505

Query: 535 GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPP 594
            V   +++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P
Sbjct: 506 AVPQQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPKP 563

Query: 595 SIMKPYYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIR 654
           +I+KP  +W+GKQ+ S+ I PN    + +    +   Y+ PKD    N M I DG     
Sbjct: 564 TILKPKPLWSGKQLLSMAI-PNG---IHLQRFDEGTTYLSPKD----NGMLIIDG----- 610

Query: 655 GSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIN 714
             +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFSIGI 
Sbjct: 611 --QIIFGVVDKKTVG-SSSGGLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFSIGIG 667

Query: 715 DVTPGFELKNKKEIMVEDAYAK--CDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKV 772
           D     + K  +EI    A AK     +        L  + G    ++ E  +   L++ 
Sbjct: 668 DTIA--DEKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEA 725

Query: 773 REEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 832
           R++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726 RDKAGRSAELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLP 785

Query: 833 HFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 892
           HF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786 HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 893 EDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
           ED+   YD T R S   I+QF YG DG+D   +E
Sbjct: 846 EDIMVHYDGTTRNSLGNIIQFVYGEDGMDASHIE 879

 Score =  176 bits (445), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 210/418 (50%), Gaps = 52/418 (12%)

Query: 1057 QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASM 1116
            +L K + + VL  +E    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLTKQTFQWVLNNIEA---QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVAFYIQD 1174
             VT GVPR+KEI+N +K + TP +   L  +   D+  A++++  IE T L  V    + 
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLNEDYAADQEKAKLIRSAIEHTTLKSVTVSSEI 1152

Query: 1175 VYKDNMSFLQVKVDLGTIEKLQLELTVED--------------IAVAITRAA-------- 1212
             Y  + S   ++ D    E +QL  ++ D              + + + RAA        
Sbjct: 1153 YYDPDPSSTVIEEDE---EIIQLHFSLMDEETENSLKHQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1213 -----KLKIAASD--VSIMGKDKV-NINVYPEMAKLKSISTSAKEPVENELFYRMQHLRR 1264
                 K+K    +    I  +D   N+ +   + +      +  E  E+ +  ++++   
Sbjct: 1210 GQVGEKIKETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLDAEAEAEEDHMLKKIENT-- 1267

Query: 1265 ALPGIVVKGLPDIARAVINIKD----DGSRE--------LLVEGYGLREVMTTDGVIGMK 1312
             L  I ++G+ DI R V+   D    + + E        L  +G  L EVMT  GV   +
Sbjct: 1268 MLESITLRGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETDGVNLSEVMTVPGVDPTR 1327

Query: 1313 TKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITR 1372
              TN  +++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR
Sbjct: 1328 IYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTR 1387

Query: 1373 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
             G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V+
Sbjct: 1388 HGFNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQMAPIGTGAFDVM 1445

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1721

 Score =  561 bits (1446), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 357/930 (38%), Positives = 511/930 (54%), Gaps = 82/930 (8%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIKFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSE--EDKHQFLS 125
            TC   ++ C GHFGHI L+ PVFHVG+     +V + +C  C  LLL E  E   Q ++
Sbjct: 68  QTCQEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQVMA 127

Query: 126 ELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
            ++ P     +R      +   CK +  C                     +   +D  + 
Sbjct: 128 -IKDPK----KRFNATWAL---CKTKMVC------------------ETDVPSENDPTKL 161

Query: 186 VGK------KSAPEKD--KWVGDWK---TVLAHNPELERYVKKCMDDLNPLKTLNLFKQV 234
           V +      +    KD  K VG WK   T+    PE +R        L+  + LN+FK +
Sbjct: 162 VSRGGCGNTQPTVRKDGLKLVGSWKRKKTIEGEEPE-QRV-------LSTEEILNIFKHI 213

Query: 235 APEDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVW 294
           + ED   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+ 
Sbjct: 214 STEDFIRLGFNEEFS--RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILK 270

Query: 295 TSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGF 352
            +  ++     G   + + E    LQ  VA Y+++D      A+   G      +P++  
Sbjct: 271 ANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSI 324

Query: 353 CQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNK 412
             RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN 
Sbjct: 325 RARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNI 384

Query: 413 QKLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVL 472
            +L QLV NGPNEHPGA Y+++++ + R +LRY  R    + LQYG  VERH+ D D VL
Sbjct: 385 DRLTQLVRNGPNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVL 442

Query: 473 FNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAIN 532
           FNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   
Sbjct: 443 FNRQPSLHKMSMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQ 502

Query: 533 LMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIP 592
           L  V   +++P+S +P +   QD + G  +++ +D+F      + +L  + D +    IP
Sbjct: 503 LCAVPLQIVSPQSNKPCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPDWDGV--IP 560

Query: 593 PPSIMKPYYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVV 652
            P+I+KP  +WTGKQ+ S+ I PN    + +    +    + PKD    N M I DG   
Sbjct: 561 TPAILKPKPLWTGKQILSVAI-PNG---IHLQRFDEGTTLLSPKD----NGMLIIDG--- 609

Query: 653 IRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIG 712
               +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFS G
Sbjct: 610 ----QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTG 664

Query: 713 IND-VTPGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSK 771
           I D +  G  +K   E + E A  K + +        L  + G    ++ E  +   L++
Sbjct: 665 IGDTIADGATIKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 723

Query: 772 VREEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 831
            R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 724 ARDKAGRLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTL 783

Query: 832 PHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 891
           PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 784 PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 843

Query: 892 LEDLSCQYDNTIRTSSNGIVQFTYGGDGLD 921
           LED+   YDNT R S   ++QF YG DG+D
Sbjct: 844 LEDIMVHYDNTTRNSLGNVIQFIYGEDGID 873

 Score =  171 bits (432), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 133/418 (31%), Positives = 212/418 (50%), Gaps = 53/418 (12%)

Query: 1057 QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASM 1116
            +L K +   VL  +E    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS 
Sbjct: 1035 RLTKEAFNWVLNNIEA---QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1091

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVA----- 1169
             VT GVPR+KEI+N +K + TP +   L ++  +D+  A++++  IE T L  V      
Sbjct: 1092 KVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLKSVTVASEI 1151

Query: 1170 FYIQD----VYKDNMSFLQVKVDLGTIEKLQLELTVEDIAVAITRAAKLKIAASDVSI-M 1224
            +Y  D    V +++   +Q+   L   E   +E +++  +  + R    + A +D  + M
Sbjct: 1152 YYDPDPRSTVIEEDEEIIQLHFSLLDDE---MESSLDQQSPWLLRLELDRAAMNDKDLTM 1208

Query: 1225 GKDKVNIN---------VYPE-----------MAKLKSISTSAKEPVENELFYRMQHLRR 1264
            G+    I          ++ E           + + KS+     E  E+ +  ++++   
Sbjct: 1209 GQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAET-EAEEDHMLKKIENT-- 1265

Query: 1265 ALPGIVVKGLPDIARAVINIKD----DGSRE--------LLVEGYGLREVMTTDGVIGMK 1312
             L  I ++G+ +I R V+   D    + S E        L  +G  L EVM   GV   +
Sbjct: 1266 MLENITLRGVENIERVVMMKYDRKVPNESGEYQKVPEWVLESDGVNLAEVMQVPGVDATR 1325

Query: 1313 TKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITR 1372
              TN  +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR
Sbjct: 1326 IYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTR 1385

Query: 1373 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
             G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTGAF V+
Sbjct: 1386 HGFNRSNTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQMAPIGTGAFDVM 1443

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
           YDL140C (REAL)
          Length = 1719

 Score =  561 bits (1445), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 356/927 (38%), Positives = 507/927 (54%), Gaps = 65/927 (7%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
            TC   +  C GHFGHI L+ PVFHVG+     +V + +C  C  LLL E +      EL
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------EL 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRCLR--CGSLNXXXXXXXXXXXXXXLKILHDT 182
            R  +   D+ +R   +  +   CK +  C        +                +  D 
Sbjct: 122 MRQALAIKDSKKRFAAIWTL---CKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTVRKDG 178

Query: 183 FRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCELL 242
            + VG   + +KD+  GD     A  PEL          L+  + LN+FK ++ +D   L
Sbjct: 179 LKLVG---SWKKDRASGD-----AEEPELRV--------LSTEEILNIFKHISVKDFTSL 222

Query: 243 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
           G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303 LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
              G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361 GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
           GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L QLV 
Sbjct: 334 GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 421 NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
           NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394 NGPNEHPGAKYVIR-DSGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 481 RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
           ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452 KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 541 LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
           ++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P+I+KP 
Sbjct: 512 VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 601 YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
            +W+GKQ+ S+ I PN    + +    +    + PKD    N M I DG       +I+ 
Sbjct: 570 PLWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPKD----NGMLIIDG-------QIIF 614

Query: 661 GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIND-VTPG 719
           GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D +  G
Sbjct: 615 GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADG 673

Query: 720 FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779
             ++   E + E A  K   +        L  + G    ++ E  +   L++ R++ G +
Sbjct: 674 PTMREITETIAE-AKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 780 CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839
               L +LN+   M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDY 792

Query: 840 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900 DNTIRTSSNGIVQFTYGGDGLDPIDME 926
           DNT R S   ++QF YG DG+D   +E
Sbjct: 853 DNTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  171 bits (433), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 130/414 (31%), Positives = 206/414 (49%), Gaps = 45/414 (10%)

Query: 1057 QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASM 1116
            +L K +   VL  +E    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLTKQAFDWVLSNIEA---QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSDVA----- 1169
             VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V      
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEI 1152

Query: 1170 FYIQD----VYKDNMSFLQVKVDLGTIEK-----------LQLEL-----TVEDIAVAIT 1209
            +Y  D    V  ++   +Q+   L   E            L+LEL       +D+ +   
Sbjct: 1153 YYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQV 1212

Query: 1210 RAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAK-EPVENELFYRMQHLRRALPG 1268
                 +   +D+ ++  +  +  +      ++  S  A+ E  E+ +  ++++    L  
Sbjct: 1213 GERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT--MLEN 1270

Query: 1269 IVVKGLPDIARAVINIKD------------DGSRELLVEGYGLREVMTTDGVIGMKTKTN 1316
            I ++G+ +I R V+   D            +    L  +G  L EVMT  G+   +  TN
Sbjct: 1271 ITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDATRIYTN 1330

Query: 1317 HILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLS 1376
              +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G +
Sbjct: 1331 SFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFN 1390

Query: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V+
Sbjct: 1391 RSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140C
          Length = 1720

 Score =  560 bits (1444), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 363/942 (38%), Positives = 506/942 (53%), Gaps = 95/942 (10%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R IK ++F   S  ++   S  +I   +  D E+  K K GG  D R+G      +C
Sbjct: 9   APLRTIKEVQFGLFSPEEVRGISVAKIEFPETMD-ESQMKAKIGGLNDPRLGSIDRNYKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
            TC   +A C GHFGHI+L+ PVFH+G+     +V +S+C  C  LLL E       +E 
Sbjct: 68  QTCGEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDE------YNEQ 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRCLR----------------CGSLNXXXXXXX 168
            R  I   D  RR      V   CK +  C                  CG +        
Sbjct: 122 MRQAIKIKDPKRR---FNAVWTLCKAKMVCETEVPSPDDPTVFLSRGGCGHIQP------ 172

Query: 169 XXXXXXXLKILHDTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTL 228
                    I  D    VG         W  D     +  PE     K+    ++  + L
Sbjct: 173 --------SIRKDGLSLVGT--------WKKDKNADDSDQPE-----KRI---ISAEEIL 208

Query: 229 NLFKQVAPEDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVK 288
           N+FK ++PED   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT K
Sbjct: 209 NVFKHISPEDGWRLGFNEDFS--RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYK 265

Query: 289 LTEIVWTSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKP 348
           L +I+  +  ++     G   + + E    LQ  VA Y+++D          +     +P
Sbjct: 266 LGDILKANINVQKLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQ----AVQKSGRP 321

Query: 349 IRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVT 408
           I+    RLKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT
Sbjct: 322 IKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVT 381

Query: 409 RYNKQKLQQLVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDG 468
            YN  +L QLV NGPNEHPGA Y++++  + R +LRY  R    + LQYG  VERH+ D 
Sbjct: 382 PYNIDRLTQLVRNGPNEHPGAKYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDN 439

Query: 469 DVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARA 528
           D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RA
Sbjct: 440 DPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRA 499

Query: 529 EAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQ 588
           E   L  V   +++P+S +P +   QD + G   ++ +D+F    + + +L  + D    
Sbjct: 500 ELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPD---- 555

Query: 589 FD--IPPPSIMKPYYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSI 646
           +D  IP P+I+KP  +W+GKQV S+ I PN    + +        ++ PKD    N M I
Sbjct: 556 WDGIIPTPAILKPVPLWSGKQVLSMAI-PNG---IHLQRFDDGTTFLSPKD----NGMLI 607

Query: 647 NDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGN 706
            DG       KI+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L +
Sbjct: 608 IDG-------KIIFGVVDKKTVG-SSSGGLIHVVTREKGPEICARLFSNIQKVVNYWLLH 659

Query: 707 RGFSIGINDVTPGFELKNKKEIMVEDAYAK--CDALIDLFNKGKLETQPGCNEEQTLEAK 764
            GFSIGI D     + K  +EI    A AK   + +        L  + G    ++ E  
Sbjct: 660 NGFSIGIGDTIA--DEKTMREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDN 717

Query: 765 IGGLLSKVREEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPD 824
           +   L++ R++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+  
Sbjct: 718 VVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAF 777

Query: 825 GFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYM 884
           GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+
Sbjct: 778 GFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYI 837

Query: 885 SRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
            RRL+K+LED+   YD T R S   ++QF YG DG+D   +E
Sbjct: 838 QRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  174 bits (442), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 132/397 (33%), Positives = 200/397 (50%), Gaps = 45/397 (11%)

Query: 1076 KYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1136 STPIINAVLVNN--NDERAARVVKGRIEKTLLSDVA-----FYIQD----VYKDNMSFLQ 1184
             TP +   L      D+  A+ ++  IE T L  V      +Y  D    V +D+   +Q
Sbjct: 1112 KTPSLTVYLDPEYAADQEKAKEIRSAIEHTTLKSVTVASEIYYDPDPRSTVIEDDEEIIQ 1171

Query: 1185 VKVDLGTIEK-----------LQLEL-----TVEDIAVAITRAAKLKIAASDVSIMGKDK 1228
            +   L   E            L+LEL     T +D+ +        +   +D+ ++  + 
Sbjct: 1172 LHFSLMDEETEKSLDYQSPWLLRLELDRAAMTDKDLTMGQVGEKIKETFKNDLFVIWSED 1231

Query: 1229 VNINVYPEMAKLKSIS--TSAKEPVENELFYRMQHLRRA-LPGIVVKGLPDIARAVINIK 1285
               N    + + + I    +    VE E  + ++ +  + L  I ++G+ DI R V+   
Sbjct: 1232 ---NAEKLIIRCRVIRDPKTLDADVEAEEDHMLKKIENSMLEKITLRGVEDITRVVMMKY 1288

Query: 1286 D------DGSRE------LLVEGYGLREVMTTDGVIGMKTKTNHILEVFSVLGIEAARTS 1333
            D       G         L  +G  L EVMT  GV G +  TN  +++ +VLGIEA R +
Sbjct: 1289 DRKVPSETGEYHKVPEWVLETDGVNLSEVMTVSGVDGSRIYTNSFIDIMNVLGIEAGRAA 1348

Query: 1334 IVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTD 1393
            +  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G ++     L   SFE+T +
Sbjct: 1349 LYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRADTGALMRCSFEETVE 1408

Query: 1394 HLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
             LF+A    + D   GVSE +ILGQ   IGTGAF V+
Sbjct: 1409 ILFEAGAAAELDDCRGVSENVILGQMAPIGTGAFDVM 1445

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
           Anc_7.314
          Length = 1729

 Score =  560 bits (1444), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 359/929 (38%), Positives = 506/929 (54%), Gaps = 69/929 (7%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
            TC   +  C GHFGHI L+ PV HVG+     +V +S+C  C  LLL E +      E 
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHN------EQ 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFR 184
            R  I   D+ +R      V + CK +   + C +                      T R
Sbjct: 122 MRQAIAIKDSKKR---FNAVWNLCKTK---MICDTDVPSDDDPTQLISRGGCGNAQPTVR 175

Query: 185 WVGKKSAPEKDKWVGDWKTVLAHNP--ELERYVKKCMDDLNPLKTLNLFKQVAPEDCELL 242
             G K        VG WK     N   E E+ V      L+  + LN+FK ++PED   L
Sbjct: 176 KDGLK-------LVGSWKKEKNTNDGDEPEQRV------LSTEEILNIFKHISPEDSTRL 222

Query: 243 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
           G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNEEF--ARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303 LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
              G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361 GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
           GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +A+ LTYPE+VT YN  +L QLV 
Sbjct: 334 GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVR 393

Query: 421 NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
           NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394 NGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLH 451

Query: 481 RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
           ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452 KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 541 LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
           ++ +S +P +   QD + G   ++ +D+F    E + +L  + D +    IP P+I+KP 
Sbjct: 512 VSAQSNKPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 601 YMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGYVVIRGSKI 658
            +W+GKQV S+ I      P  I+L    +    + PKD          +G +V+ G +I
Sbjct: 570 PLWSGKQVLSIAI------PRGIHLQRFDEGTTLLSPKD----------NGMLVVDG-QI 612

Query: 659 LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIND-VT 717
           + GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D + 
Sbjct: 613 IFGVVDKKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIGDTIA 671

Query: 718 PGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG 777
            G  +K   E  + DA  K + +        L  + G    ++ E  +   L++ R++ G
Sbjct: 672 DGSTIKEITET-IADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARDKAG 730

Query: 778 EVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKN 837
            +    L++LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731 RLAEMNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKD 790

Query: 838 SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 897
             +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791 DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 898 QYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
            YD T R S   ++QF YG DG+D   +E
Sbjct: 851 HYDGTARNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  172 bits (437), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 132/423 (31%), Positives = 203/423 (47%), Gaps = 63/423 (14%)

Query: 1057 QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASM 1116
            +L K + + VL  +E    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLTKQAFEWVLNNVEA---QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVAFYIQD 1174
             VT GVPR+KEI+N +K + TP +   L ++  +D+  A+ ++  IE T L  +     +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIEHTTLKSITV-ASE 1151

Query: 1175 VYKDNMSFLQVKVDLGTIEKLQLELTVEDIAVAITRAAK--LKIAASDVSIMGKDKVNIN 1232
            +Y D      V  +   I +L   L  ++   ++ R +   L++     ++  KD     
Sbjct: 1152 IYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQSLDRQSPWLLRLELDRAAMNDKD----- 1206

Query: 1233 VYPEMAKLKSISTSAKEPVENELFY------------RMQHLR----------------- 1263
                   +  +    KE   N+LF             R + +R                 
Sbjct: 1207 -----LTMGQVGERIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAETEAEEDHMLK 1261

Query: 1264 ----RALPGIVVKGLPDIARAVINIKD------DGSRE------LLVEGYGLREVMTTDG 1307
                  L  I ++G+ +I R V+   D       G  +      L  +G  L EVMT  G
Sbjct: 1262 KIENTMLENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEVMTVPG 1321

Query: 1308 VIGMKTKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEI 1367
            V   +  TN  +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1322 VDATRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGAL 1381

Query: 1368 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAF 1427
              ITR G ++     L  +SFE+T + LF+A    + D   GVSE ++LGQ   IGTGAF
Sbjct: 1382 TSITRHGFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAF 1441

Query: 1428 KVV 1430
             V+
Sbjct: 1442 DVM 1444

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL140C
           (RPO21)
          Length = 1745

 Score =  560 bits (1442), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 361/934 (38%), Positives = 508/934 (54%), Gaps = 79/934 (8%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R IK ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNFKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
            TC   +  C GHFGHI+L+ PVFH+G+     +V + +C  C  LLL E       +EL
Sbjct: 68  QTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNEL 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFR 184
            R  I   D  RR      V   CK +  C                     +    D  +
Sbjct: 122 MRQAIKIKDPKRR---FNAVWSLCKAKMVC------------------DTEVPSEDDPSK 160

Query: 185 WVGK------KSAPEKD--KWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAP 236
           ++ +      + +  KD    VG WK     N E     +K +  ++  + LN+FK ++P
Sbjct: 161 YISRGGCGNAQPSIRKDGLSLVGTWKK--DKNAEDADQPEKRI--ISAEEILNVFKHISP 216

Query: 237 EDCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
           ED   LG +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217 EDSWRLGFNEDFS--RPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297 SLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
             ++     G   + + E    LQ  VA Y+++D          +     +PI+    RL
Sbjct: 274 INVQRLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQ----AVQKSGRPIKSIRARL 329

Query: 357 KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
           KGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L 
Sbjct: 330 KGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 417 QLVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQ 476
           QLV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQ
Sbjct: 390 QLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQ 447

Query: 477 PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 536
           PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448 PSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 537 KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSI 596
              +++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P+I
Sbjct: 508 PLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPTPTI 565

Query: 597 MKPYYMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGYVVIR 654
           +KP  +W+GKQ+ S+ I      P  I+L    +   Y+ PKD    N M I DG     
Sbjct: 566 LKPKPLWSGKQLLSMAI------PSGIHLQRFDEGTTYLSPKD----NGMLIIDG----- 610

Query: 655 GSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIN 714
             +I+ GV+DK  +G      + + + R+ GP+  A     + K+   +L + GFSIGI 
Sbjct: 611 --QIIFGVVDKKTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGIG 667

Query: 715 DVTPGFELKNKKEIMVEDAYAK--CDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKV 772
           D     + K  +EI    A AK   + +        L  + G    ++ E  +   L++ 
Sbjct: 668 DTIA--DEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEA 725

Query: 773 REEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 832
           R++ G      L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726 RDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLP 785

Query: 833 HFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 892
           HF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786 HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 893 EDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
           ED+   YD T R S   I+QF YG DG+D   +E
Sbjct: 846 EDIMVHYDGTTRNSLGNIIQFVYGEDGMDAAHIE 879

 Score =  176 bits (447), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 133/424 (31%), Positives = 204/424 (48%), Gaps = 64/424 (15%)

Query: 1057 QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASM 1116
            +L K + + VL  +E    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLTKQTFEWVLNNIEA---QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVAFYIQD 1174
             VT GVPR+KEI+N +K + TP +   L  +   D+  A++++  IE T L  V    + 
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIRSAIEHTTLKSVPVASEI 1152

Query: 1175 VYKDNMSFLQVKVDLGTIEKLQLELTVEDIAVAITRAAK--LKIAASDVSIMGKDKVNIN 1232
             Y  + S   ++ D   I+ L   L  E+   ++   +   L++    V++  KD     
Sbjct: 1153 YYDPDPSSTVIEEDEEIIQ-LHFSLMDEETEASLKHQSPWLLRLELDRVAMTDKD----- 1206

Query: 1233 VYPEMAKLKSISTSAKEPVENELFY------------RMQHLR----------------- 1263
                   +  +    KE  +N+LF             R + +R                 
Sbjct: 1207 -----LTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHML 1261

Query: 1264 -----RALPGIVVKGLPDIARAVINIKD------DGSRE------LLVEGYGLREVMTTD 1306
                   L  I ++G+ DI R V+   D       G         L  +G  L EVM+  
Sbjct: 1262 KKIENTMLESITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDGVNLSEVMSVP 1321

Query: 1307 GVIGMKTKTNHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGE 1366
            GV   +  TN  +++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G 
Sbjct: 1322 GVDPTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGF 1381

Query: 1367 ILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGA 1426
            ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+
Sbjct: 1382 LMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVILGQMAPIGTGS 1441

Query: 1427 FKVV 1430
            F V+
Sbjct: 1442 FDVM 1445

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1727

 Score =  558 bits (1439), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 353/929 (37%), Positives = 504/929 (54%), Gaps = 63/929 (6%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
            TC   +  C GHFGHI L+ PVFH+G+     +V + +C  C  LLL + ++     ++
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNE-----QM 122

Query: 128 RRPGI--DNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRW 185
           R+     D+ +R   +  +   CK +   + C S                      T R 
Sbjct: 123 RQACKIKDSKKRFNAIWTL---CKTK---MICESDVPSEEDPTKLISRGGCGNAQPTVRK 176

Query: 186 VGKKSAPEKDKWVGDWKTVL-AHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCELLGI 244
            G K        VG WK      +PE        M+++     LN+FK ++ ED   LG 
Sbjct: 177 DGLK-------LVGSWKKEKNTGDPEEPEQRILTMEEI-----LNIFKHISKEDSNRLGF 224

Query: 245 DSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLE 304
           +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++    
Sbjct: 225 NE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEH 281

Query: 305 KGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQGR 362
            G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+GR
Sbjct: 282 NGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGR 335

Query: 363 FRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVING 422
            RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L  LV NG
Sbjct: 336 IRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVRNG 395

Query: 423 PNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLHRL 482
           PNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH++
Sbjct: 396 PNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKM 453

Query: 483 SILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLT 542
           S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++
Sbjct: 454 SMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS 513

Query: 543 PKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPYYM 602
           P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P+I+KP  +
Sbjct: 514 PQSNKPCMGIVQDTLCGIRKLTLRDNFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPL 571

Query: 603 WTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660
           WTGKQ+ S+ I      P  I+L    +    + PKD    N M I DG       KI+ 
Sbjct: 572 WTGKQILSIAI------PKGIHLQRFDEGTTLLSPKD----NGMLIIDG-------KIIF 614

Query: 661 GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720
           GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI D     
Sbjct: 615 GVVDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGIGDTIADG 673

Query: 721 ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780
           +   +    + DA  K + +        L  + G    ++ E  +   L++ R++ G + 
Sbjct: 674 QTMREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 781 IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840
              L +LN+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734 EVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYS 793

Query: 841 PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
           P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794 PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 901 NTIRTSSNGIVQFTYGGDGLDPIDMEGNA 929
           +T R S   ++QF YG DG+D   +E  A
Sbjct: 854 STTRNSLGNVIQFVYGEDGMDASHIEKQA 882

 Score =  153 bits (387), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 126/402 (31%), Positives = 196/402 (48%), Gaps = 44/402 (10%)

Query: 1057 QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASM 1116
            +L K + + VL  +EI   ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLTKQAFEWVLNNIEI---QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLVN---------NNDERAARVVKG----RIEKT 1163
             VT GVPR+      +K I + I +  L +         + D R+  + +     ++  +
Sbjct: 1093 KVTSGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIAEDEEIIQLHFS 1152

Query: 1164 LLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELTVEDIAVAITRAAK---LKIAASD 1220
            LL D      +   D  S   ++++L        +LT+  +   I    K     I + D
Sbjct: 1153 LLDDET----EKSLDQQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSED 1208

Query: 1221 VSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQHLRRALPGIVVKGLPDIARA 1280
                  +K+ I       K   I T A+E   + +  ++++    L  I ++G+ +I R 
Sbjct: 1209 ----NAEKLIIRCRVVRPKSMDIETEAEE---DHMLKKIENT--MLENITLRGVENIERV 1259

Query: 1281 VINIKD----DGSRE--------LLVEGYGLREVMTTDGVIGMKTKTNHILEVFSVLGIE 1328
            V+   D      + E        L  +G  L EVMT  GV   +  TN  +++  VLGIE
Sbjct: 1260 VMMKYDRKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDIMEVLGIE 1319

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            A R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   SF
Sbjct: 1320 AGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATGALMRCSF 1379

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1380 EETVEILFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVM 1421

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
           YDL140C (REAL)
          Length = 1726

 Score =  558 bits (1438), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 359/929 (38%), Positives = 505/929 (54%), Gaps = 69/929 (7%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R +K ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
            TC   +  C GHFGHI L+ PVFHVG+     ++ + +C  C  LLL E +      EL
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------EL 121

Query: 128 RRPGI---DNLRRMGILKKVVDQCKKQRRC-LRCGSLNXXXXXXXXXX-XXXXLKILHDT 182
            R  +   D+ +R   +  +   CK +  C     S N                 +  D 
Sbjct: 122 MRQALAIKDSKKRFAAIWTL---CKTKMVCETDVPSENDPTQLVSRGGCGNTQPTVRKDG 178

Query: 183 FRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCELL 242
            + VG   + +KD+  GD     A  PEL          L+  + LN+FK ++ ED   L
Sbjct: 179 LKLVG---SWKKDRASGD-----ADEPELRV--------LSTEEILNIFKHISVEDFTSL 222

Query: 243 GIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
           G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303 LEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQRLKGKQ 360
              G   + + E    LQ  VA Y+++D      A+   G      +P++    RLKGK+
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 361 GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420
           GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L QLV 
Sbjct: 334 GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 421 NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480
           NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH
Sbjct: 394 NGPNEHPGAKYVIR-DSGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 481 RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
           ++S+++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452 KMSMMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 541 LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600
           ++P+S +P +   QD + G   ++ +D+F    + + +L  + D +    IP P+I+KP 
Sbjct: 512 VSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPK 569

Query: 601 YMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGYVVIRGSKI 658
            +W+GKQV S  I      P  I+L    +    + PKD    N M I DG +V      
Sbjct: 570 PLWSGKQVLSAAI------PSGIHLQRFDEGTTLLSPKD----NGMLIIDGQIVF----- 614

Query: 659 LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGIND-VT 717
             GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D + 
Sbjct: 615 --GVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIA 671

Query: 718 PGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG 777
            G  ++   E + E A  K   +        L  + G    ++ E  +   L++ R++ G
Sbjct: 672 DGPTMREITETIAE-AKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAG 730

Query: 778 EVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKN 837
            +    L +LN+   M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731 RLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKD 790

Query: 838 SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 897
             +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791 DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 898 QYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
            YDNT R S   ++QF YG DG+D   +E
Sbjct: 851 HYDNTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  171 bits (433), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 130/414 (31%), Positives = 207/414 (50%), Gaps = 45/414 (10%)

Query: 1057 QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASM 1116
            +L K + + VL  +E    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 RLTKQAFEWVLSNIEA---QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSDVA----- 1169
             VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V      
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEI 1152

Query: 1170 FYIQD----VYKDNMSFLQVKVDLGTIEK-----------LQLEL-----TVEDIAVAIT 1209
            +Y  D    V  ++   +Q+   L   E            L+LEL       +D+ +   
Sbjct: 1153 YYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQV 1212

Query: 1210 RAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAK-EPVENELFYRMQHLRRALPG 1268
                 +   +D+ ++  +  +  +      ++  S  A+ E  E+ +  ++++    L  
Sbjct: 1213 GERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT--MLEN 1270

Query: 1269 IVVKGLPDIARAVINIKD------------DGSRELLVEGYGLREVMTTDGVIGMKTKTN 1316
            I ++G+ +I R V+   D            +    L  +G  L EVMT  G+   +  TN
Sbjct: 1271 ITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTN 1330

Query: 1317 HILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLS 1376
              +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G +
Sbjct: 1331 SFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFN 1390

Query: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V+
Sbjct: 1391 RSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
           YDL140C
          Length = 1726

 Score =  558 bits (1437), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 353/933 (37%), Positives = 507/933 (54%), Gaps = 77/933 (8%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R IK ++F   S  +I A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APLRTIKEVQFGLFSPEEIRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSEL 127
            TC   +  C GHFGHI L+ PVFH+G+     +V + IC  C  LLL E ++ Q    L
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNE-QMRQIL 126

Query: 128 RRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNXXXXXXXXXXXXXXLKILHDTFRWVG 187
           +    D+ +R   +  +   CK +  C                     +   HD  + V 
Sbjct: 127 KIK--DSKKRFNAIWSL---CKTKMIC------------------DTDVPSEHDPTQLVS 163

Query: 188 K------KSAPEKD--KWVGDWKTV--LAHNPELERYVKKCMDDLNPLKTLNLFKQVAPE 237
           +      +    KD  K VG WK     +   E E+ +      L+  + LN+FK ++PE
Sbjct: 164 RGGCGNAQPTVRKDGLKLVGSWKKEKNTSDGDEPEQRI------LSTEEILNIFKHISPE 217

Query: 238 DCELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSS 297
           D   +G +      RPE      LP PP  +RPS+   +S    EDDLT KL +I+  + 
Sbjct: 218 DSIAMGFNEEFS--RPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANI 274

Query: 298 LIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP--AMMPGGSTGGKTKPIRGFCQR 355
            ++     G   + + E    LQ  VA Y+++D      A+   G      +P++    R
Sbjct: 275 SLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRAR 328

Query: 356 LKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKL 415
           LKGK+GR RGNL GKRVDFS RTV+S DPNL +D+V VP  +AK LTYPE+VT YN  +L
Sbjct: 329 LKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRL 388

Query: 416 QQLVINGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNR 475
             LV NGPNEHPGA Y+++ D   R +LRY  R    + LQYG  VERH+ D D VLFNR
Sbjct: 389 THLVRNGPNEHPGAKYVIR-DNGDRIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNR 446

Query: 476 QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 535
           QPSLH++S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447 QPSLHKMSMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 536 VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPS 595
           V   +++ +S +P +   QD + G   ++ +D+F    + + LL  + D +    IP P+
Sbjct: 507 VPLQIVSAQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPDWDGV--IPTPA 564

Query: 596 IMKPYYMWTGKQVFSLLIRPNKESPVVINLDA--KNKVYIPPKDKSLPNEMSINDGYVVI 653
           I+KP  +W+GKQ+ S+ I      P  I+L    +   ++ PKD    N M I DG    
Sbjct: 565 ILKPKPLWSGKQILSIAI------PKGIHLQRFDEGTTFLSPKD----NGMLIIDG---- 610

Query: 654 RGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGI 713
              +I+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI
Sbjct: 611 ---QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGI 666

Query: 714 NDVTPGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVR 773
            D     E   +    + +A  K + +        L  + G    ++ E  +   L++ R
Sbjct: 667 GDTIADGETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 774 EEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 833
           ++ G +    L++ N+   M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727 DKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPH 786

Query: 834 FLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 893
           F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787 FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 894 DLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
           D+   YD+T R S   ++QF YG DG+D   +E
Sbjct: 847 DIMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIE 879

 Score =  175 bits (443), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 133/415 (32%), Positives = 205/415 (49%), Gaps = 47/415 (11%)

Query: 1057 QLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASM 1116
            +L K S + VL  +E    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS 
Sbjct: 1036 KLNKQSFQWVLNNVEA---QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVL--VNNNDERAARVVKGRIEKTLLSDVAFYIQD 1174
             VT GVPR+KEI+N +K + TP + A L      D+  A++++  IE T L  V     +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTLKSVTV-ASE 1151

Query: 1175 VYKDNMSFLQVKVDLGTIEKLQLELTVEDIAVAITRAAK--LKIAASDVSIMGKD----- 1227
            +Y D      V  +   I +L   L  E+   ++ + +   L++     ++  KD     
Sbjct: 1152 IYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1228 ---KVNINVYPEMAKLKSISTSAK-----------------EPVENELFYRMQHLRRALP 1267
               K+      ++  + S   + K                 E  E+ +  ++++    L 
Sbjct: 1212 VGEKIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLKKIENT--MLE 1269

Query: 1268 GIVVKGLPDIARAVINIKD------DGSRE------LLVEGYGLREVMTTDGVIGMKTKT 1315
             I ++G+ +I R V+   D       G+ E      L  +G  L EVMT  GV   +  T
Sbjct: 1270 NITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLEVMTVPGVDASRIYT 1329

Query: 1316 NHILEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGL 1375
            N  +++  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT  G +  +TR G 
Sbjct: 1330 NSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTNGSLTSVTRHGF 1389

Query: 1376 SKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1390 NRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGSFDVM 1444

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  444 bits (1142), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 318/984 (32%), Positives = 497/984 (50%), Gaps = 129/984 (13%)

Query: 249  KSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------A 301
            KS  P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI+      +
Sbjct: 349  KSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMS 405

Query: 302  GLEKG--------ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFC 353
             L+K         +  + +M  +  +Q  V  +I+S          GSTGGK  PI G  
Sbjct: 406  NLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ------GSTGGKV-PIPGVK 458

Query: 354  QRLKGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQ 413
            Q L+ K+G FR ++ GKRV+ + R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  
Sbjct: 459  QALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIA 518

Query: 414  KLQQLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNL----------QYGDVV 461
            +L+Q VINGP++ PGA  +  +D    +   +    R  LA  L               V
Sbjct: 519  ELRQAVINGPDKWPGATQIQNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLNKKV 578

Query: 462  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 520
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 579  FRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 638

Query: 521  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLS 580
            PQ E AR+EA NL    +  LTP SG P+    QD I+    +++KDSFF+R ++ Q + 
Sbjct: 639  PQNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQYIY 698

Query: 581  MM---SDGNL---QFDIPPPSIMKPYYMWTGKQVFSLLIRPNKESPVV-INLDAKNKVYI 633
                  DG+    +    PP++MKP  +WTGKQ+ + +I     + +  INL +KNK+  
Sbjct: 699  GCIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIMNVTPADMPGINLLSKNKI-- 756

Query: 634  PPKDKSLPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAM 693
              K++      + N+  V+ +   +L G++DKS  G   K+ + +++   +GP+ AA  +
Sbjct: 757  --KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVL 811

Query: 694  NRMAKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGKLETQ 752
            + + +L   F+ N  FS G++D+    E  K++K+++         A  ++ N   L T 
Sbjct: 812  SVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTN---LPTD 868

Query: 753  PGCNEEQTL---------EAKIGGLLSKVREEVGEVCIKELDNL-----------NSCLI 792
               N+ + L         + K G L +    +V  V  K +  +           NS   
Sbjct: 869  TPSNDPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSMQA 928

Query: 793  MANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFF 852
            MA  G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+
Sbjct: 929  MALSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFY 988

Query: 853  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQ 912
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNT+R     +VQ
Sbjct: 989  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTLVQ 1048

Query: 913  FTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEK 972
            F YGGD +D             +    H     F                          
Sbjct: 1049 FLYGGDAVD-------------TTKESHMTQFDFC------------------------- 1070

Query: 973  LVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDY-MYEKASHLAN------IRAHK 1025
            L  YD L  + +PS    VE++D + A +   K+L+     +K  H  N      + +  
Sbjct: 1071 LENYDALLRKYNPSA--LVEHLDVESALKYSKKALKSRKKIDKEPHYKNSDKYDPVLSKY 1128

Query: 1026 GLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEPG 1085
               ++L   + + Q  D  EG   S    +     I+ K   KF  +   KY ++ V PG
Sbjct: 1129 NPAKYLGSVSEKFQ--DKLEGFLDSHSKQLKLHSGINEK---KFRALMQLKYMRSLVNPG 1183

Query: 1086 TAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVL 1144
             AVG + A S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP ++  +
Sbjct: 1184 EAVGIIAAQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPV 1243

Query: 1145 VNNNDERAARVVKGRIEKTLLSDV 1168
             N+  +  A +    I K +LS+V
Sbjct: 1244 WNHVSDDQASIFCKSITKVVLSEV 1267

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 84/162 (51%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMK-TKTNHILEVFSVLGIE 1328
            V++ +P I+R +        R L  EG   + +   +  I +   ++N +  V    G+E
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGIRSNDVAAVLRTYGVE 1559

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1560 AARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFMKM-SY 1618

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A     ++ ++  S  I+LG+  ++GTGAF V+
Sbjct: 1619 ETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F+  SA +I   S  +I+   + D  N   P SGG  D  +G       C+TC  
Sbjct: 11  ISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   + ++F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  437 bits (1125), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 317/996 (31%), Positives = 496/996 (49%), Gaps = 159/996 (15%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    L  PP   R PS +  +   ++++ L   L++I+ TS LI           
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDELSTLQ 393

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + I  + +M  +  +Q  V  +I+S          G+TGGK  PI G  Q L
Sbjct: 394  KDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTKAQ------GNTGGKV-PIPGVKQAL 446

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 447  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 506

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNLQ----------YGDVVERH 464
            Q +INGP++ PGA+ +  +D    +   +    R  LA  L               V RH
Sbjct: 507  QAIINGPDKWPGASQIQNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKVYRH 566

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 567  IKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 626

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM- 582
            E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF+R ++ Q +    
Sbjct: 627  ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCI 686

Query: 583  --SDGNL---QFDIPPPSIMKPYYMWTGKQVFSLLIRPNKESPVV--INLDAKNKVYIPP 635
               DG+    +    PP+I KP  +WTGKQ+ + ++  N   P +  INL + NK+    
Sbjct: 687  RPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLL-NVTPPDMPGINLKSSNKI---- 741

Query: 636  KDKSLPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNR 695
            K++        ND  V+ +  ++L G++DKS  G   K+ + +++   +GP+ AA  ++ 
Sbjct: 742  KNEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVLSV 798

Query: 696  MAKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGKLETQPG 754
            + +L   ++ N  F+ G++D+    +  K + +I+ E       A  ++ N   L+    
Sbjct: 799  LGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTN---LDKDTP 855

Query: 755  CNEEQTLE--------------------AKIGGLLSKVREE-VGEVCIKELDNLNSCLIM 793
             N+ + L+                    AK+  + SKV  + V    +K+    NS   M
Sbjct: 856  SNDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPE-NSMQAM 914

Query: 794  ANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFS 853
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+S
Sbjct: 915  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYS 974

Query: 854  GLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQF 913
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF
Sbjct: 975  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQF 1034

Query: 914  TYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKL 973
             YGGD +D I  E +    NF                                      L
Sbjct: 1035 LYGGDAVDVIK-ESHMTEFNFC-------------------------------------L 1056

Query: 974  VRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLANIRAHKGLKEFLD- 1032
              YD L  + +PS    VE++D + A +   K+L+           N + HK  K +   
Sbjct: 1057 DNYDALLKKYNPSA--LVEHVDVETALKYSKKTLK-----------NRKKHKDEKHYKQT 1103

Query: 1033 ---EPAAELQAMDLDEGAPASALASVDQLCKISSKLVL----------------KFLEIA 1073
               +P        L +  PA  L +V +  +   +L L                KF  + 
Sbjct: 1104 LKYDPV-------LSKYNPAKYLGAVSENFQDKLELFLDKSSKTFKEYESINEKKFRALM 1156

Query: 1074 IFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NAS 1132
              KY ++ + PG AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS
Sbjct: 1157 QLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTAS 1216

Query: 1133 KVISTPIINAVLVNNNDERAARVVKGRIEKTLLSDV 1168
              I TP +   + N+  +  A      I K +LS+V
Sbjct: 1217 AAIKTPQMTLPIWNDVSDETADTFCKSISKVILSEV 1252

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            +++ +P I R +    ++G R L+ EG   + +   +  I +   T N I  V    G+E
Sbjct: 1478 IIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVLQTYGVE 1537

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1538 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1596

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ +E  S  I+LG+  ++GTGAF ++
Sbjct: 1597 ETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 56.6 bits (135), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L+++DI   S   I+   + D  N   P SGG  D  +G       C TC  
Sbjct: 11  ISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CGTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   D H++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  437 bits (1123), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 319/978 (32%), Positives = 501/978 (51%), Gaps = 123/978 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    L  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G T GK  PI G  Q L
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PIPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNL----------QYGDVVERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L               V RH
Sbjct: 521  QAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKVYRH 580

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 581  IKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQN 640

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM- 582
            E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF+R ++ Q +    
Sbjct: 641  ENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCI 700

Query: 583  --SDGNL---QFDIPPPSIMKPYYMWTGKQVFSLLIRPNKESPVV--INLDAKNKVYIPP 635
               DG+    +    PP+I KPY +WTGKQ+ + ++  N   P +  INL +KNK+    
Sbjct: 701  RPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIKNEY 759

Query: 636  KDK-SLPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMN 694
              K SL NE+   DG        +L G++DKS  G   K+ + +++   +GP+ AA  ++
Sbjct: 760  WGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 811

Query: 695  RMAKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGK----- 748
             + +L   ++    F+ G++D+    E  K + +I+        +A  ++ N  K     
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPAD 871

Query: 749  --------LETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELD----NLNSCLIMANC 796
                     E     N+   L+A     ++ +  +V   C+ +        NS   MA  
Sbjct: 872  DPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALS 931

Query: 797  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLS 856
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ 
Sbjct: 932  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIK 991

Query: 857  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYG 916
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+IR +   +VQF YG
Sbjct: 992  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYG 1051

Query: 917  GDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTN--GVLKPLEEKLV 974
            GD +D I  E +     F     +A    +N       P  +++  +    LK   +K +
Sbjct: 1052 GDAID-ITKESHMTQFEFCLDNYYALLKKYN-------PSALIEHLDVESALK-YSKKTL 1102

Query: 975  RYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLANIRAH--KGLKEFLD 1032
            +Y    ++ +P  +  V+Y D   A+           Y  A +L ++  +    L+ FLD
Sbjct: 1103 KYRKKHSK-EPHYKQSVKY-DPVLAK-----------YNPAKYLGSVSENFQDKLESFLD 1149

Query: 1033 EPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVG 1092
            + +   ++ D                  ++ K   KF  +   KY ++ + PG AVG + 
Sbjct: 1150 KNSKLFKSSD-----------------GVNEK---KFRALMQLKYMRSLINPGEAVGIIA 1189

Query: 1093 AHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNN-NDE 1150
            + S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + N+ +DE
Sbjct: 1190 SQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDE 1249

Query: 1151 RAARVVKGRIEKTLLSDV 1168
            +A    K  I K LLS+V
Sbjct: 1250 QADTFCKS-ISKVLLSEV 1266

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            +++ +P I R V    ++G R L+ EG   + +   +  I +   T N +  V    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ ++  S  I++G+  ++GTG+F V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L+A +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C    L   + H++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  434 bits (1116), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 311/980 (31%), Positives = 502/980 (51%), Gaps = 127/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 301  ----AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
                +  +K +  N +M  +  +Q  V  +I+S          GS GGK  PI G  Q L
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTKAQ------GSAGGKV-PIPGVKQAL 454

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 455  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 514

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNL----------QYGDVVERH 464
            Q VINGP++ PGA+ +  +D    +   +    R  LA  L               V RH
Sbjct: 515  QAVINGPDKWPGASQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKVYRH 574

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 575  IKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 634

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM- 582
            E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF+R E+ Q +    
Sbjct: 635  ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCI 694

Query: 583  --SDGNL---QFDIPPPSIMKPYYMWTGKQVF-SLLIRPNKESPVVINLDAKNKVYIPPK 636
               DG+    +    PP++MKP  +WTGKQ+  ++L+         INL +KNK+    K
Sbjct: 695  RPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI----K 750

Query: 637  DKSLPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRM 696
            +       + ND  V+ +  ++L G++DKS  G   K+ + +++   +GP  +A  ++ +
Sbjct: 751  NDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVLSVL 807

Query: 697  AKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGC 755
             +L   ++    F+ G++D+    +  K + +I+         A  ++ N   L+     
Sbjct: 808  GRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTN---LDPDVSA 864

Query: 756  NEEQTL---------EAKIGGL-------LSKVREEVGEVCI-----KELDNLNSCLIMA 794
            N+ + L         + K+G L       ++ +  +V   C+     K+  N NS   MA
Sbjct: 865  NDTELLKRLEEILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAMA 923

Query: 795  NCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSG 854
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 924  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYSG 983

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF 
Sbjct: 984  IRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1043

Query: 915  YGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKLV 974
            YGGD +D +  E +     F      A+N                               
Sbjct: 1044 YGGDAVD-VTQESHMTEFKFC-----ADN------------------------------- 1066

Query: 975  RYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMY-EKASHLAN-IRAHKGLKEFLD 1032
             YD L  + +PS    +E++D + A +   K+L++    E+  H A  ++    + +F  
Sbjct: 1067 -YDALLKKYNPSA--LIEHLDVESALKYSKKALKNRKKNERVPHFAQKVKYDPVVSKF-- 1121

Query: 1033 EPAAELQAMDLD-EGAPASALASVDQLCKISSKL-VLKFLEIAIFKYHKAKVEPGTAVGA 1090
             P+  L ++  + +    S + S ++L K    +   KF  +   KY ++ + PG AVG 
Sbjct: 1122 NPSKYLGSVSENFQDKLESFIDSNNELFKSRDSVNEKKFRALMQLKYMRSLINPGEAVGI 1181

Query: 1091 VGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNNN 1148
            + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +L +  
Sbjct: 1182 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVT 1241

Query: 1149 DERAARVVKGRIEKTLLSDV 1168
            D +A    K  I K +LS+V
Sbjct: 1242 DSQADTFCKS-ITKVMLSEV 1260

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            V++ + +I R V    ++G R L+ EG   +E+   D  + +   T N +  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    + + ++  S  ++LG+  ++GTGAF V+
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVL 1647

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 71/149 (47%), Gaps = 14/149 (9%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  ++A DI   S ++I+   + D  N   P SGG  D  +G       C+TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELRRPGI 132
           +   C GH GHI+L +P ++  +F      L+S C  C    L   + H++  +L+    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLK---- 123

Query: 133 DNLRRMGILKKVVDQCKKQRRCLRCGSLN 161
             L + G+    +D+C +    LR GSL+
Sbjct: 124 --LLQYGL----IDECHRLDE-LRVGSLD 145

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  434 bits (1116), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 310/976 (31%), Positives = 497/976 (50%), Gaps = 119/976 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G T GK  P+ G  Q L
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PVPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNL----------QYGDVVERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L               V RH
Sbjct: 521  QAVINGPDKWPGATQIQNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKVYRH 580

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 581  IKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQN 640

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM- 582
            E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF+R ++ Q +    
Sbjct: 641  ENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCI 700

Query: 583  --SDGNL---QFDIPPPSIMKPYYMWTGKQVFSLLIRPNKESPVV--INLDAKNKVYIPP 635
               DG+    +    PP+I KPY +WTGKQ+ + ++  N   P +  INL +KNK+    
Sbjct: 701  RPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLLSKNKIKNEY 759

Query: 636  KDK-SLPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMN 694
              K SL NE+   DG        +L G++DKS  G   K+ + +++   +GP+ AA  ++
Sbjct: 760  WGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 811

Query: 695  RMAKLCARFLGNRGFSIGINDVTPGFELKNKKEIMVE---DAYAKCDALIDLFNKGKLET 751
             + +L   ++    F+ G++D+    E    +  +++   D   +  A +   +K     
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKDTPAD 871

Query: 752  QPGC-----------NEEQTLEAKIGGLLSKVREEVGEVCIKELD----NLNSCLIMANC 796
             P             N+   L+A     ++ +  +V   C+ +        NS   MA  
Sbjct: 872  DPELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALS 931

Query: 797  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLS 856
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ 
Sbjct: 932  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIK 991

Query: 857  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYG 916
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+IR +   +VQF YG
Sbjct: 992  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYG 1051

Query: 917  GDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKLVRY 976
            GD +D I  E +     F     +A    +N       P  +++  +       E  ++Y
Sbjct: 1052 GDAID-ITKESHMTQFEFCLDNYYALLKKYN-------PSALIEHLD------VESALKY 1097

Query: 977  DNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLANIRAH--KGLKEFLDEP 1034
                     +L+ R ++I +   +++         Y  A +L ++  +    L+ FLD+ 
Sbjct: 1098 SK------KTLKYRKKHIKEPHYKQSIKYDPVLAKYNPAKYLGSVSENFQDKLESFLDKG 1151

Query: 1035 AAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAH 1094
            +   ++ D                  ++ K   KF  +   KY ++ + PG AVG + + 
Sbjct: 1152 SKLFKSAD-----------------GVNEK---KFRALMQLKYMRSLINPGEAVGIIASQ 1191

Query: 1095 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNN-NDERA 1152
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ++ +DE+A
Sbjct: 1192 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVSDEQA 1251

Query: 1153 ARVVKGRIEKTLLSDV 1168
                K  I K LLS+V
Sbjct: 1252 DTFCKS-ISKVLLSEV 1266

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            +++ +P I R V    ++G R L+ EG   + +   +  I +   T N +  V    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ ++  S  I++G+  ++GTG+F V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L+A +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C    L   + H++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  434 bits (1116), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 335/1089 (30%), Positives = 531/1089 (48%), Gaps = 163/1089 (14%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG--------IS 308
            PP   R PS +  +   ++++ L   L++I+ TS LI+      + L+K         I 
Sbjct: 357  PPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDEISKLQKDKVALDDRRII 413

Query: 309  INNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQGRFRGNLS 368
             + +M  +  +Q  V  +I+S          G+  GK  P+ G  Q L+ K+G FR ++ 
Sbjct: 414  FSRLMNAFVTIQNDVNSFIDSSKAQ------GNNSGKL-PVPGVKQALEKKEGLFRKHMM 466

Query: 369  GKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVINGPNEHPG 428
            GKRV+++ R+V+SPDPN+  DE+ VP   A  LTYPE VT YN  +L+Q VINGP++ PG
Sbjct: 467  GKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPG 526

Query: 429  ANYLLKKDEE--ARRNLRYGDRMKLARNLQ----------YGDVVERHLEDGDVVLFNRQ 476
            A  +  +D    +   +    R  LA  L               V RH+++ DVV+ NRQ
Sbjct: 527  ATQIQNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLNKKVYRHIKNRDVVIMNRQ 586

Query: 477  PSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 535
            P+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL  
Sbjct: 587  PTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLAN 646

Query: 536  VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM---SDG---NLQF 589
              +  LTP SG P+    QD I+    ++ KDS+F+R ++ Q +       DG   N + 
Sbjct: 647  TDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQYIYGCIRPEDGHSANNKL 706

Query: 590  DIPPPSIMKPYYMWTGKQVFSLLIRPNKESPVV---INLDAKNKVYIPPKDKSLPNEMSI 646
               PP+I+KP  +WTGKQ+ + ++     SPV    INL +KNK+    KD+        
Sbjct: 707  LTIPPAIIKPVPLWTGKQIITTVLL--NVSPVDMPGINLKSKNKI----KDEYWGQHSEE 760

Query: 647  NDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGN 706
            N+  V+ +   +L G++DKS  G   K+ + + +   +GP+ AA  ++ + +L   ++ N
Sbjct: 761  NE--VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAAKVLSVLGRLFTNYITN 817

Query: 707  RGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGC---------- 755
              F+ G++D+    E  K + +I+         A +++ N  K  +              
Sbjct: 818  TAFTCGMDDLRLTDEGNKWRTDILKTSVDRGRQAAVEVTNLEKDTSADDSELLKRLEEIL 877

Query: 756  ---NEEQTLEAKIGGLLSKVREEVGEVCI-----KELDNLNSCLIMANCGSKGSTLNVSQ 807
               N+   L+A     ++ +  +V   C+     K     NS   MA  G+KGS +NVSQ
Sbjct: 878  RDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPE-NSMQSMALSGAKGSNVNVSQ 936

Query: 808  MVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISG 867
            ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ FH ++G
Sbjct: 937  IMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIKPQEYYFHCMAG 996

Query: 868  REGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEG 927
            REGL+DTAVKT+ +GY+ R L K LE +   YDNT+R     +++F YGGD +D +  E 
Sbjct: 997  REGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLIEFLYGGDAVD-VTKES 1055

Query: 928  NAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKLVRYDNLGNELDPSL 987
                 +F                                      L  YD+L    +P+ 
Sbjct: 1056 YMNQFDFC-------------------------------------LDNYDSLLKRYNPAA 1078

Query: 988  QDRVEYIDQDDAERNFYKSLRDYMYEK--ASHLANIRAHKGLKEFLDEPAAELQAMDLD- 1044
               ++++D D A +   K+L+     K    +L NI+    L ++   PA  L ++    
Sbjct: 1079 --LIDFLDVDSALKYSKKTLKHRKKNKNVPHYLQNIKYDPVLAKY--NPAKYLGSVSEKF 1134

Query: 1045 EGAPASALASVDQLCKISSKLV--LKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQ 1102
            +    + L S  QL K S K V   KF  +   KY ++ + PG AVG + + S+GEP TQ
Sbjct: 1135 QDKLENFLDSNSQLFK-SHKSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQ 1193

Query: 1103 MTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNNNDERAARVVKGRIE 1161
            MTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++++  +  A +    I 
Sbjct: 1194 MTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVTDDQADIFAKSIS 1253

Query: 1162 KTLLSDV---------------------AFYIQDVYKDNMSFLQVKVD-------LGTIE 1193
            K +LS+V                      FY QD Y +     + ++        L ++E
Sbjct: 1254 KVILSEVIDSVSVTETTTSQSRSYVISMKFYEQDEYNEEYDISKEELQNVVANNFLTSLE 1313

Query: 1194 -------KLQLELTVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTS 1246
                   K Q + T  D+ +AI +A   ++A + V  +    +  N   +  K    + S
Sbjct: 1314 IAIHKEIKKQKKTTASDVGIAIPKA---QLALAAVEGLSSKVMEDNDEEQSRKKTKQAVS 1370

Query: 1247 AKEPVENEL 1255
              EP E+E+
Sbjct: 1371 YDEPDEDEI 1379

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            VV+ +P+I R V    ++G R L+ EG   + +   +  + +   T N +  V    G+E
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGITSNDVSSVLKTYGVE 1540

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1541 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLMKM-SY 1599

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ +   S  I+LG+  ++GTGAF V+
Sbjct: 1600 ETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 65/143 (45%), Gaps = 12/143 (8%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS LSA +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR---- 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   + H++  +L+    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLKLLQY 127

Query: 129 -----RPGIDNLRRMGILKKVVD 146
                   IDNL   G+ + + D
Sbjct: 128 GLIEESYQIDNLTIGGLDESITD 150

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  434 bits (1115), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 303/975 (31%), Positives = 495/975 (50%), Gaps = 117/975 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+      + ++
Sbjct: 350  KADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMSTIQ 406

Query: 305  KG-ISINN-------MMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
            K  +S+++       +M  +  +Q  V  +I+S          GS   K  P+ G  Q L
Sbjct: 407  KDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GSASSKI-PVPGVKQAL 459

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 460  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELR 519

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNLQ----------YGDVVERH 464
            Q VINGP++ PGA+ +  +D    +   +    R  LA  L               V RH
Sbjct: 520  QAVINGPDKWPGASQIQNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKKVYRH 579

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 580  IKNRDVVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 639

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLL---- 579
            E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF+R E+ Q +    
Sbjct: 640  ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCI 699

Query: 580  ----SMMSDGNLQFDIPPPSIMKPYYMWTGKQVFS-LLIRPNKESPVVINLDAKNKVYIP 634
                   S G +     PP+++KP  +WTGKQ+ S +L+         INL++ NK+   
Sbjct: 700  RPEHGHASRGKIV--TMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNKI--- 754

Query: 635  PKDKSLPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMN 694
             K++      + ND  V+ +  +++ G++DKS  G   K+ + +++   +GP+ AA  ++
Sbjct: 755  -KNEYWGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 810

Query: 695  RMAKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGK----- 748
             + +L   ++    F+ G++D+    E  K++ EI+         A  ++ N  K     
Sbjct: 811  VLGRLFTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKDTPSD 870

Query: 749  --------LETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELD----NLNSCLIMANC 796
                     E     N+   L+A     ++ V  +V   C+ +        NS   MA  
Sbjct: 871  DVELLKRLEEILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQAMALS 930

Query: 797  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLS 856
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ 
Sbjct: 931  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGIK 990

Query: 857  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYG 916
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R     ++QF YG
Sbjct: 991  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQFLYG 1050

Query: 917  GDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKLVRY 976
            GD +D +  E +    +F R         ++ + K   P  + +  +        K V  
Sbjct: 1051 GDAVD-VTKESHMTQFDFCRE-------NYDALLKKYNPVALAEHLDVETALQYSKKVSK 1102

Query: 977  DNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLANI--RAHKGLKEFLDEP 1034
            +   N      + +V+Y D   A+           Y  A +L ++  + H  L+ +L++ 
Sbjct: 1103 NRKKNSKTAHYEQKVKY-DPVLAK-----------YNPAKYLGSVSEKFHDKLESYLEDK 1150

Query: 1035 AAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAH 1094
            A E ++ +                  +S+K   +F  +   KY ++ + PG AVG + + 
Sbjct: 1151 AKEFKSRE-----------------SVSAK---RFRALMQLKYMRSLINPGEAVGIIASQ 1190

Query: 1095 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNNNDERAA 1153
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ++  +  A
Sbjct: 1191 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDDVSDEQA 1250

Query: 1154 RVVKGRIEKTLLSDV 1168
             +    I K +LS+V
Sbjct: 1251 DLFCKSISKVVLSEV 1265

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            V++ +P I R V +   +  R L+ EG   + +   +  I +   T N +  V    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ +E  S  I+LG+  ++GTG+F ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 56.6 bits (135), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  L+F+ L+  DI   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L + + H++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  433 bits (1114), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 312/980 (31%), Positives = 498/980 (50%), Gaps = 127/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G T GK  PI G  Q L
Sbjct: 408  KDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PIPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNL----------QYGDVVERH 464
            Q VINGP++ PGA  +  +D    +   + +  R  LA  L               V RH
Sbjct: 521  QAVINGPDKWPGATQIQNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHTLNKKVYRH 580

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 581  IKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQN 640

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM- 582
            E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF+R ++ Q +    
Sbjct: 641  ENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCI 700

Query: 583  --SDGNL---QFDIPPPSIMKPYYMWTGKQVFSLLIRPNKESPVV--INLDAKNKVYIPP 635
               DG+    +    PP+I KPY +WTGKQ+ + ++  N   P +  INL +KNK+    
Sbjct: 701  RPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIKNEY 759

Query: 636  KDK-SLPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMN 694
              K SL +E+   DG        +L G++DKS  G   K+ + +++   +GP+ AA  ++
Sbjct: 760  WGKGSLESEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 811

Query: 695  RMAKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGK----- 748
             + +L   ++    F+ G++D+    E  K + +I+         A  ++ N  K     
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKETPSD 871

Query: 749  --------LETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELD----NLNSCLIMANC 796
                     E     N+   L+A     ++ +  +V   C+ +        NS   MA  
Sbjct: 872  DPELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMALS 931

Query: 797  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLS 856
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ 
Sbjct: 932  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIK 991

Query: 857  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYG 916
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+IR +   ++QF YG
Sbjct: 992  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQFMYG 1051

Query: 917  GDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKLVRY 976
            GD +D I  E +     F     +A    +N       P  +++  +       E  ++Y
Sbjct: 1052 GDAVD-ITKESHMTQFEFCLDNYYALLKKYN-------PSALIEHLD------VESALKY 1097

Query: 977  DNLGNELDPSLQDRVEYIDQDDAERNFYKSLRD----YMYEKASHLANIRAH--KGLKEF 1030
                       +  ++Y  +   E ++ +S++       Y  A +L ++  +    L+ F
Sbjct: 1098 S----------KKTLKYRKKHSKEPHYKQSMKYDPVLAKYSPAKYLGSVSENFQDKLESF 1147

Query: 1031 LDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGA 1090
            LDE +   ++ D                  ++ K   KF  +   KY ++ + PG AVG 
Sbjct: 1148 LDENSKLFKSTD-----------------GVNEK---KFRALMQLKYMRSLINPGEAVGI 1187

Query: 1091 VGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNN-N 1148
            + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ++ +
Sbjct: 1188 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVS 1247

Query: 1149 DERAARVVKGRIEKTLLSDV 1168
            DE+A    K  I K LLS+V
Sbjct: 1248 DEQADTFCKS-ISKVLLSEV 1266

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            +++ +P I R V    ++G R L+ EG   + +   +  I +   T N +  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ ++  S  I++G+  ++GTG+F V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L+A +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C    L   + H++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  433 bits (1113), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 312/988 (31%), Positives = 502/988 (50%), Gaps = 143/988 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 402

Query: 305  KG--------ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
            K         +  + +M  +  +Q  V  +I+S          G+TGGK  PI G  Q L
Sbjct: 403  KDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GNTGGKV-PIPGVKQAL 455

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 456  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 515

Query: 417  QLVINGPNEHPGANYLLKKDE----------EARRNLRYGDRMKLARNLQYGDV---VER 463
            Q VINGP++ PGA+ +  +D           E R+ L     M  + N+    +   V R
Sbjct: 516  QAVINGPDKWPGASQIQNEDGSLVSLIGMTLEQRKALA-NQLMTPSSNIATHTLNKKVYR 574

Query: 464  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 522
            H+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 575  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 634

Query: 523  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLL--- 579
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF+R ++ Q +   
Sbjct: 635  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 694

Query: 580  ---SMMSDGNLQFDIPPPSIMKPYYMWTGKQVFS-LLIRPNKESPVVINLDAKNKVYIPP 635
                       +    PP++ KP  +WTGKQ+ + +L+         INL++ NK+    
Sbjct: 695  IRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI---- 750

Query: 636  KDKSLPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNR 695
            K++   N  + ND  V+ +  ++L G++DKS  G   K+ + +++   +GP  AA  ++ 
Sbjct: 751  KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKVLSV 807

Query: 696  MAKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGKLETQPG 754
            + +L   ++    F+ G++D+    E  K +K+I+         A  ++ N   LE +  
Sbjct: 808  LGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAACEVTN---LEKETA 864

Query: 755  CNEEQTLE--------------------AKIGGLLSKVREE-VGEVCIKELDNLNSCLIM 793
             ++ + L+                    +K+  + SKV  + V +  +K+    NS   M
Sbjct: 865  SDDSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNSMQAM 923

Query: 794  ANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFS 853
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+S
Sbjct: 924  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYIKGRFYS 983

Query: 854  GLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQF 913
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R     ++QF
Sbjct: 984  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQF 1043

Query: 914  TYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKL 973
             YGGD +D                                    + ++++  L   E  L
Sbjct: 1044 LYGGDSVD------------------------------------VTKESH--LTQFEFCL 1065

Query: 974  VRYDNLGNELDPSLQDRVEYIDQDDA-ERNFYKSLRDYMYEKASHL-ANIRAHKGLKEFL 1031
              YD+L  + +PS    +E++D + A + +   S       K  H   NI+    L +F 
Sbjct: 1066 ENYDSLLKKYNPSA--LIEHLDVETALKYSKKASKSRKKNRKVPHYEQNIKYDPALAKF- 1122

Query: 1032 DEPAAELQAMD----------LDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAK 1081
              PA  L A+           LD  A   +L   D+   ++ K   KF  +   KY ++ 
Sbjct: 1123 -NPAKYLGAVSEKFQDKLELFLDSNA---SLFESDK--SVNEK---KFRALMQLKYMRSL 1173

Query: 1082 VEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPII 1140
            + PG +VG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +
Sbjct: 1174 INPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQM 1233

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDV 1168
               ++++  +  A V    I K LLS+V
Sbjct: 1234 TLPILDDVSDDQADVFSKSISKVLLSEV 1261

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            V++ +P I R V    ++G R L+ EG   + +   +  IG+   T N +  V    G+E
Sbjct: 1489 VIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGVE 1548

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1549 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1607

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    + + ++  S  I+LG+  ++GTGAF V+
Sbjct: 1608 ETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 56.2 bits (134), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS L+A +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   + H++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  432 bits (1112), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 314/978 (32%), Positives = 492/978 (50%), Gaps = 146/978 (14%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG--------IS 308
            PP   R PS + ++   ++++ L   L++I+ TS LI+      + L+K         I 
Sbjct: 362  PPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKDKVSVDDRRII 418

Query: 309  INNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQGRFRGNLS 368
             + +M  +  +Q  V  +I+S          G+T GK  P+ G  Q L+ K+G FR ++ 
Sbjct: 419  FSRLMNAFVTIQNDVNAFIDSTKAQ------GNTSGKV-PVPGVKQALEKKEGLFRKHMM 471

Query: 369  GKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVINGPNEHPG 428
            GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT +N  +L+Q VINGP++ PG
Sbjct: 472  GKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQAVINGPDKWPG 531

Query: 429  ANYLLKKDEE--ARRNLRYGDRMKLARNLQ-----------YGDVVERHLEDGDVVLFNR 475
            A  +  +D    +   +    R  LA  L                V RH+++ D+V+ NR
Sbjct: 532  ATQIQNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVYRHIKNRDIVIMNR 591

Query: 476  QPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 534
            QP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL 
Sbjct: 592  QPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLA 651

Query: 535  GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM---SDGNL---Q 588
               +  LTP SG P+    QD I+    +++KDSFF+R ++ Q +       DG+    +
Sbjct: 652  NTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIRPEDGHATRAK 711

Query: 589  FDIPPPSIMKPYYMWTGKQVFSLLIRPNKESPVV--INLDAKNKVYIPPKDKSLPNEMSI 646
                PP++MKP  +WTGKQ+ + ++  N   P +  INL + NK+      K+       
Sbjct: 712  LATVPPAVMKPVPLWTGKQIITTVLL-NITPPDMPGINLKSSNKI------KNDYWGKGS 764

Query: 647  NDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGN 706
            N+  V+ +  ++L G++DKS  G   K+ + + +   +GP  +A A++ + +L   ++  
Sbjct: 765  NENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALSVLGRLFTNYITA 823

Query: 707  RGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFN--KGKLETQPGC-------- 755
              F+ G++D+    E  K +KEI+        +A  ++ N  K      P          
Sbjct: 824  TAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSNDPELLKRLEEII 883

Query: 756  ---NEEQTLEAKIGGLLSKVREEVGEVCI-----KELDNLNSCLIMANCGSKGSTLNVSQ 807
               N+   L+A     ++ +  +V   C+     K+    NS   MA  G+KGS +NVSQ
Sbjct: 884  RDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPE-NSMQSMALSGAKGSNVNVSQ 942

Query: 808  MVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISG 867
            ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P E+ FH ++G
Sbjct: 943  IMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFYSGIRPQEYYFHCMAG 1002

Query: 868  REGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDMEG 927
            REGL+DTAVKTA +GY+ R L K LE +   YDN+IR +   ++Q  YGGD +D +  E 
Sbjct: 1003 REGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQMLYGGDAID-VTKES 1061

Query: 928  NAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKLVRYDNLGNELDPSL 987
            +    NF                                      L  YD L  + +PS 
Sbjct: 1062 HLTKFNFC-------------------------------------LENYDALLKKYNPSA 1084

Query: 988  QDRVEYIDQDDAERNFYKSLRDYMYEKASHLANIRAHKGLKEFLDEPAAELQAMDLDEGA 1047
               +E++D + A +   KSL+   Y K          K  KE   +   +   + L +  
Sbjct: 1085 --LIEHLDVETALKYSKKSLK---YRK----------KHAKEAHYQQTVKYDPI-LSKYN 1128

Query: 1048 PASALASV-----DQLCKI---SSKLV--------LKFLEIAIFKYHKAKVEPGTAVGAV 1091
            PA  L SV     DQL      +SKL+         KF  +   KY ++ + PG AVG +
Sbjct: 1129 PAKYLGSVSENFQDQLENFLHDNSKLLKSHEDVNEKKFRALMQLKYMRSLINPGEAVGII 1188

Query: 1092 GAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNNNDE 1150
             + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++++  +
Sbjct: 1189 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIIMTASAAIKTPQMTLPILDDVTD 1248

Query: 1151 RAARVVKGRIEKTLLSDV 1168
              A      I K +LS+V
Sbjct: 1249 EQADTFAKSISKVVLSEV 1266

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMK-TKTNHILEVFSVLGIE 1328
            V++ +P I R V    ++G R L+ EG     +   +  I +   ++N +  V    G+E
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGIRSNDVSAVLKTYGVE 1554

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR ++V EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S++++ S+
Sbjct: 1555 AARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1613

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ +   S  I+LG+  ++GTG+F V+
Sbjct: 1614 ETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 59.7 bits (143), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS L++ DI + S  +I    + D  N   P SGG  D  +G       C+TC  
Sbjct: 11  ITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +PV++  +F      L+S C  C    L   + H+F  +L+
Sbjct: 68  DEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  431 bits (1107), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 313/1003 (31%), Positives = 494/1003 (49%), Gaps = 173/1003 (17%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI           
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  +E K +  N +M  +  +Q  V  +I+S          G+TGGK  PI G  Q L
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQ------GNTGGKV-PIPGVKQAL 455

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 456  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 515

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNL----------QYGDVVERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L               V RH
Sbjct: 516  QAVINGPDKWPGATQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKVYRH 575

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 576  IKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 635

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM- 582
            E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF+R E+ Q +    
Sbjct: 636  ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIYGCI 695

Query: 583  --SDGNLQFD---IPPPSIMKPYYMWTGKQVF-SLLIRPNKESPVVINLDAKNKVYIPPK 636
               DG+   +     PP++ KP  +WTGKQ+  ++L+         INL +KNK+    K
Sbjct: 696  RPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI----K 751

Query: 637  DKSLPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRM 696
            ++      + ND  VV +  ++L G++DKS  G   K+ + +++   +GP  +A  ++ +
Sbjct: 752  NEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVLSVL 808

Query: 697  AKLCARFLGNRGFSIGINDVTPGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCN 756
             +L   ++    F+ G++D+           +  E    + D L    + G++      N
Sbjct: 809  GRLFTNYITATAFTCGMDDL----------RLTEEGNKWRSDILKTSTDVGRVAAAEVTN 858

Query: 757  EEQTLEAKIGGLLSKVRE------------------------EVGEVCI-----KELDNL 787
             ++ + A    LL ++ E                        +V   C+     K+  N 
Sbjct: 859  LDKDVSANDSELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN- 917

Query: 788  NSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFV 847
            NS   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G++
Sbjct: 918  NSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYI 977

Query: 848  RNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSS 907
            +  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R + 
Sbjct: 978  KGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDAD 1037

Query: 908  NGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFN------HVD-KPLLPY--QI 958
              ++QF YGGD +D +  E +     F      A    +N      H+D +  L Y  + 
Sbjct: 1038 GTLIQFLYGGDAVD-VTQESHMTQFKFCADNYDALLKKYNPAALIEHLDVESALKYSKKA 1096

Query: 959  MQQTNGVLK-PLEEKLVRYDNLGNELDPS---------LQDRVE-YIDQDDAERNFYKSL 1007
            ++      K P   + V+YD + ++ +PS          QD++E +ID ++   + +KS 
Sbjct: 1097 LKHRKKTEKVPHYSQKVKYDPVVSKFNPSKYLGSVSENFQDKLESFIDSNN---DLFKS- 1152

Query: 1008 RDYMYEKASHLANIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVL 1067
            RD + EK                                                     
Sbjct: 1153 RDTVSEK----------------------------------------------------- 1159

Query: 1068 KFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1127
            KF  +   KY ++ + PG AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++E
Sbjct: 1160 KFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMRE 1219

Query: 1128 II-NASKVISTPIIN-AVLVNNNDERAARVVKGRIEKTLLSDV 1168
            II  AS  I TP +   +L +  D +A    K  + K +LS+V
Sbjct: 1220 IIMTASAAIKTPQMTLPILADVTDPQADTFCKS-VTKVMLSEV 1261

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            V++ + +I R V    ++G R L+ EG   +E+   D  I +   T N +  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    + + ++  S  I+LG+  ++GTGAF V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 70/148 (47%), Gaps = 14/148 (9%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  ++A DI   S ++I+   + D  N   P SGG  D  +G       C+TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELRRPGI 132
           +   C GH GHI+L +P ++  +F      L+S C  C    L   + H++  +L+    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLK---- 123

Query: 133 DNLRRMGILKKVVDQCKKQRRCLRCGSL 160
             L + G+    +D+C K    LR G+L
Sbjct: 124 --LLQYGL----IDECYKLDE-LRVGTL 144

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  429 bits (1103), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 315/978 (32%), Positives = 498/978 (50%), Gaps = 123/978 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ T+ LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G T GK  PI G  Q L
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PIPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNL----------QYGDVVERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L               V RH
Sbjct: 521  QAVINGPDKWPGATQIQNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKVYRH 580

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 581  IKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQN 640

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM- 582
            E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF+R ++ Q +    
Sbjct: 641  ENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCI 700

Query: 583  --SDGNLQFD---IPPPSIMKPYYMWTGKQVFSLLIRPNKESPVV--INLDAKNKVYIPP 635
               DG+   +     PP+I KPY +WTGKQ+ + ++  N   P +  INL + NK+    
Sbjct: 701  RPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISTNKIKNEY 759

Query: 636  KDK-SLPNEMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMN 694
              K SL NE+   DG        +L G++DKS  G   K+ + +++   +GP+ AA  ++
Sbjct: 760  WGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 811

Query: 695  RMAKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGK----- 748
             + +L   ++    F+ G++D+    E  K + +I+         A  ++ N  K     
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLNKDTPAD 871

Query: 749  --------LETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELD----NLNSCLIMANC 796
                     E     N+   L+A     ++ +  +V   C+ +        NS   MA  
Sbjct: 872  DAELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMALS 931

Query: 797  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLS 856
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ 
Sbjct: 932  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIK 991

Query: 857  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYG 916
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+IR +   +VQF YG
Sbjct: 992  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYG 1051

Query: 917  GDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTN--GVLKPLEEKLV 974
            GD +D I  E +     F     +A    +N       P  +++  +    LK   +K +
Sbjct: 1052 GDAVD-ITKESHMTQFEFCLDNYYALLKKYN-------PSALIEHLDVESALK-YSKKTL 1102

Query: 975  RYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLANIRAH--KGLKEFLD 1032
            +Y    ++ +P  +  V+Y D   A+           Y  A +L ++  +    L+ FLD
Sbjct: 1103 KYRKKHSK-EPHYKQAVKY-DPVLAK-----------YNPAKYLGSVSENFQDKLESFLD 1149

Query: 1033 EPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVG 1092
            + +   ++ D                  ++ K   KF  +   KY ++ + PG AVG + 
Sbjct: 1150 KNSKLFKSAD-----------------GVNEK---KFRALMQLKYMRSLINPGEAVGIIA 1189

Query: 1093 AHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNN-NDE 1150
            + S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ++ +DE
Sbjct: 1190 SQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTPQMTLPIWDDVSDE 1249

Query: 1151 RAARVVKGRIEKTLLSDV 1168
            +A    K  I K LLS+V
Sbjct: 1250 QADTFCKS-ISKVLLSEV 1266

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            +++ +P I R V    ++G R L+ EG   + +   +  I +   T N +  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR ++V EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ ++  S  I++G+  ++GTG+F V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L+A +I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C    L   + H++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  428 bits (1100), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 314/971 (32%), Positives = 496/971 (51%), Gaps = 133/971 (13%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG-ISINN---- 311
            PP   R PS +  +   ++++ L   L++I+ T+ LI+      + L+K  +S+++    
Sbjct: 366  PPTRFRLPSKLGDEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRVI 422

Query: 312  ---MMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQGRFRGNLS 368
               +M  +  +Q  V  +I+S          G+TGGK  PI G  Q L+ K+G FR ++ 
Sbjct: 423  FSRLMNAFVTIQNDVNAFIDSTKAQ------GTTGGKV-PIPGVKQALEKKEGLFRKHMM 475

Query: 369  GKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVINGPNEHPG 428
            GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q VINGP++ PG
Sbjct: 476  GKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPG 535

Query: 429  ANYLLKKD----------EEARRNLRYGDRMKLARNLQYGDV---VERHLEDGDVVLFNR 475
            A  +  +D           E R+ L     M  + N+    +   V RH+++ D+V+ NR
Sbjct: 536  AAQIQNEDGSLVSLVGMSAEQRKALA-NQLMTPSSNVGTHTLNKKVYRHIKNRDIVIMNR 594

Query: 476  QPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 534
            QP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL 
Sbjct: 595  QPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLA 654

Query: 535  GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM---SDGNL---Q 588
               +  LTP SG P+    QD I+    ++ KDSFF+R ++ Q +       DG+    +
Sbjct: 655  NTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRPK 714

Query: 589  FDIPPPSIMKPYYMWTGKQVFS-LLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEM--- 644
                PP+I KP  +WTGKQ+ S +L+         INL + NK+          NE    
Sbjct: 715  LITLPPTIYKPVPLWTGKQIISTVLLNVTPADMPGINLTSSNKI---------KNEYWGK 765

Query: 645  SINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFL 704
            S N+  V+ +  ++L G++DKS  G   K  + +++   +GP  AA  ++ + +L   ++
Sbjct: 766  SSNENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSIAAKVLSVLGRLFTNYI 824

Query: 705  GNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGK-------------LE 750
             +  F+ G++D+    E  K + +I+        +A  ++ N  K              E
Sbjct: 825  MSTAFTCGMDDLRLSEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTAADDAELLKRLEE 884

Query: 751  TQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELDN----LNSCLIMANCGSKGSTLNVS 806
                 N+   L+A     ++ +  +V   C+ +        NS   MA  G+KGS +NVS
Sbjct: 885  ILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKGSNVNVS 944

Query: 807  QMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAIS 866
            Q++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ FH ++
Sbjct: 945  QIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKPQEYYFHCMA 1004

Query: 867  GREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
            GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R     ++QF YGGD +D +  E
Sbjct: 1005 GREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD-VTKE 1063

Query: 927  GNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKLVRYDNLGNELDPS 986
             +    +F                                      L  YD L N+ +PS
Sbjct: 1064 SHMTEFDFC-------------------------------------LDNYDALLNKYNPS 1086

Query: 987  LQDRVEYIDQDDAERNFYKSLRDY-MYEKASHLANIRAHKG-LKEFLDEPAAELQAMDLD 1044
                +E++D + A +   K+L++   + K +H  N   +   L +F   PA  L ++   
Sbjct: 1087 A--LIEHLDVETALKYSKKTLKNRKKHAKEAHHKNATKYDPVLSKF--NPAKYLGSVSEK 1142

Query: 1045 -EGAPASALASVDQLCK----ISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEP 1099
             +    S L    +L K    +S K   KF  +   KY ++ + PG AVG + + S+GEP
Sbjct: 1143 FQDKLESYLDKNSKLFKSHDNVSEK---KFRALMQLKYMRSLINPGEAVGIIASQSVGEP 1199

Query: 1100 GTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNNNDERAARVVK 1157
             TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +  + +DE+A    K
Sbjct: 1200 STQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWQDVSDEQADTFCK 1259

Query: 1158 GRIEKTLLSDV 1168
              I K +LS+V
Sbjct: 1260 S-ISKVVLSEV 1269

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            +++ +P I R V    ++G R L+ EG     +   +  I +   T N +  V    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ +E  S  I++G+  ++GTG+F ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 55.8 bits (133), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L++ +I   S  +I+   + D  N   P SGG  D  +G       CS+C  
Sbjct: 11  ITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSSCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C  L L + + H+F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  428 bits (1100), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 299/912 (32%), Positives = 468/912 (51%), Gaps = 107/912 (11%)

Query: 304  EKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQGRF 363
            ++ I  + +M  +  +Q  V  +I+S          G+ GGK  PI G  Q L+ K+G F
Sbjct: 423  DRRIIFSRLMNAFVTIQNDVNAFIDSTKAQ------GTAGGKL-PIPGVKQALEKKEGLF 475

Query: 364  RGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVINGP 423
            R ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q VINGP
Sbjct: 476  RKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGP 535

Query: 424  NEHPGANYLLKKD----------EEARRNLRYGDRMKLARNLQYGDV---VERHLEDGDV 470
            ++ PGA  +  +D           E R+ L     M  + N+    +   V RH+++ D+
Sbjct: 536  DKWPGATQIQNEDGSLVSLIGMSTEQRKALA-NQLMTPSSNITTHTLNKKVYRHIKNRDI 594

Query: 471  VLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAE 529
            V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAE
Sbjct: 595  VIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAE 654

Query: 530  AINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM---SDGN 586
            A NL    +  LTP SG P+    QD I+    ++ KDSFF+R ++ Q +       DG+
Sbjct: 655  ASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGH 714

Query: 587  L---QFDIPPPSIMKPYYMWTGKQVFS-LLIRPNKESPVVINLDAKNKVYIPPKDKSLPN 642
                +    PP+I KP  +WTGKQ+ S +L+     +   INL + NK+    K++    
Sbjct: 715  ATRSKLITMPPTIHKPVPLWTGKQIISTVLLNITPANMPGINLKSSNKI----KNEYWGT 770

Query: 643  EMSINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCAR 702
                N+  V+ +  ++L G++DKS  G   K  + +++   +GP  AA  ++ + +L   
Sbjct: 771  GSQENE--VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSVAAKVLSVLGRLFTN 827

Query: 703  FLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGK------------- 748
            ++ +  F+ G++D+    E  K + +I+        +A  ++ N  K             
Sbjct: 828  YIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTPANDPELLKRL 887

Query: 749  LETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELDN----LNSCLIMANCGSKGSTLN 804
             E     N+   L+A     ++ +  +V   C+ +        NS   MA  G+KGS +N
Sbjct: 888  QEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKGSNVN 947

Query: 805  VSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHA 864
            VSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH 
Sbjct: 948  VSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHC 1007

Query: 865  ISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPID 924
            ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF YGGD +D + 
Sbjct: 1008 MAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGTLIQFLYGGDAVD-VT 1066

Query: 925  MEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKLVRYDNLGNELD 984
             E +    +F                                      L  YD L N+ +
Sbjct: 1067 KESHMTEFDFC-------------------------------------LDNYDALLNKYN 1089

Query: 985  PSLQDRVEYIDQDDAERNFYKSL--RDYMYEKASHLANIRAHKGLKEFLDEPAAELQAMD 1042
            PS    +E++D + A +   KSL  R    ++  +  NI+    L +F   PA  L +  
Sbjct: 1090 PSA--LIEHLDVESALKYSKKSLKNRKKHIKEPHYKQNIKYDPVLSKF--NPAKYLGS-- 1143

Query: 1043 LDEGAPASALASVDQLCKI----SSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGE 1098
            + E         +D+  K+     S    KF  +   KY ++ + PG AVG + + S+GE
Sbjct: 1144 VSEKFQDKLEGYLDKNSKLFKSHDSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGE 1203

Query: 1099 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNN-NDERAARVV 1156
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + N+ +DE+A    
Sbjct: 1204 PSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDEQADTFC 1263

Query: 1157 KGRIEKTLLSDV 1168
            K  I K +LS+V
Sbjct: 1264 KS-ISKVVLSEV 1274

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            +++ +P I R +    ++G R L+ EG     +   +  I +   T N +  V    G+E
Sbjct: 1505 IIREVPHIDRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1564

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1565 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1623

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ +E  S  I++G+  ++GTG+F ++
Sbjct: 1624 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 55.8 bits (133), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  L++ +I   S  +I+   + D  N   P +GG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L++ C  C    L   + H+F S+LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  427 bits (1099), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 306/991 (30%), Positives = 489/991 (49%), Gaps = 143/991 (14%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    L  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKG 358
              +  ++ +  N +M  +  +Q  V  +I+S           S+ G   PI G  Q L+ 
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTKAQ-------SSSGNKVPIPGLKQALEK 462

Query: 359  KQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQL 418
            K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q 
Sbjct: 463  KEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQA 522

Query: 419  VINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNL---QYGDV-------VERHLE 466
            VINGP++ PGA  +  +D    +   +    R  LA  L      DV       V RH++
Sbjct: 523  VINGPDKWPGATQIQNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYRHIK 582

Query: 467  DGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEE 525
            + DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E 
Sbjct: 583  NRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNEN 642

Query: 526  ARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM--- 582
            A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSFF+R ++ Q +      
Sbjct: 643  AKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRP 702

Query: 583  SDGNL---QFDIPPPSIMKPYYMWTGKQVF-SLLIRPNKESPVVINLDAKNKVYIPPKDK 638
             DG+    +    PP++MKP  +WTGKQ+  ++L+     +   INL++KNK+       
Sbjct: 703  EDGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMPGINLNSKNKI------- 755

Query: 639  SLPNEM---SINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNR 695
               NE    S  +  VV +  ++L G++DKS  G   K  + +++   +GP  AA  ++ 
Sbjct: 756  --KNEYWGKSSEENNVVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLSV 812

Query: 696  MAKLCARFLGNRGFSIGINDVTPGFELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGC 755
            + +L   ++    F+ G++D+           +  E    + D L    + G++      
Sbjct: 813  LGRLFTNYITATAFTCGMDDL----------RLTAEGNKWRNDILQTSVDIGRVAAAEVT 862

Query: 756  NEEQTLEAKIGGLLSKVRE------------------------EVGEVCIKELD----NL 787
            N ++ +++  G LL ++ E                        +V   C+ +        
Sbjct: 863  NLDKDVKSDDGELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPY 922

Query: 788  NSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFV 847
            NS   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G++
Sbjct: 923  NSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYI 982

Query: 848  RNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSS 907
            +  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R   
Sbjct: 983  KGRFYSGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGD 1042

Query: 908  NGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLK 967
              ++QF YGGD +D I  E +     F              VD                 
Sbjct: 1043 GTLIQFLYGGDAVD-ITKESHMTEFKFC-------------VDN---------------- 1072

Query: 968  PLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMY-EKASHLANIRAHKG 1026
                    YD L  + +PS    V+++D + A +   K+L++     K  H A    +  
Sbjct: 1073 --------YDALLKKYNPSA--LVDHLDVESALKYSKKTLKNRKKNSKLPHYAQTSKYDP 1122

Query: 1027 -LKEFLDEPAAELQAMDLD-EGAPASALASVDQLCKISSKL-VLKFLEIAIFKYHKAKVE 1083
             L +F   P+  L A+  + +      +++ D   K    +   KF  +   KY ++ + 
Sbjct: 1123 VLSKF--NPSKYLGAVSENFQDKLEKFISTNDDFFKKDENVNEKKFRALMQLKYMRSLIN 1180

Query: 1084 PGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINA 1142
            PG AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +  
Sbjct: 1181 PGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQLTM 1240

Query: 1143 VLVNNNDERAARVVKGRIEKTLLSDVAFYIQ 1173
             + ++  +  A      I K +LS+V   +Q
Sbjct: 1241 PIRDDVSDELADTFCKNITKVMLSEVIDKVQ 1271

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMK-TKTNHILEVFSVLGIE 1328
            +++ +P I R V    ++G R L+ EG   + +   D  I +   ++N +  V    G+E
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVLKTYGVE 1547

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1548 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM-SY 1606

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    + + ++  S  I++G+   +GTG+F ++
Sbjct: 1607 ETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 56.2 bits (134), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 12/133 (9%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS L++ +I   S  +++   + D  N   P  GG  D  +G       C+TC  
Sbjct: 11  ITSIDFSVLTSDEIRKLSAKQVTNPTVLD--NLGHPIQGGLYDLALGAFLKNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR---- 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   + H +  +LR    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQY 127

Query: 129 -----RPGIDNLR 136
                R  IDN+R
Sbjct: 128 ALIDERYQIDNIR 140

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  427 bits (1098), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 304/970 (31%), Positives = 487/970 (50%), Gaps = 130/970 (13%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG--------IS 308
            PP   R PS M ++   ++++ L   L++I+ T+ LI+      + L+K         I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 309  INNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQGRFRGNLS 368
             + +M  +  +Q  V  +I+S          GSTGG   P+ G  Q L+ K+G FR ++ 
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ------GSTGGNV-PVPGVKQALEKKEGLFRKHMM 476

Query: 369  GKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVINGPNEHPG 428
            GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q VINGP++ PG
Sbjct: 477  GKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPG 536

Query: 429  ANYLLKKDEE--ARRNLRYGDRMKLARNLQ-----------YGDVVERHLEDGDVVLFNR 475
            A  +  +D    +   +    R  LA  L                V RH+++ D+V+ NR
Sbjct: 537  ALQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVIMNR 596

Query: 476  QPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 534
            QP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL 
Sbjct: 597  QPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLA 656

Query: 535  GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM---SDGNL---Q 588
               +  LTP SG P+    QD I+    ++ KDSFF+R ++ Q +       DG+    +
Sbjct: 657  NTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRPK 716

Query: 589  FDIPPPSIMKPYYMWTGKQVFS-LLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEM--- 644
                PP++ KP  +WTGKQ+ + +L+         INL + NK+          NE    
Sbjct: 717  LVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI---------KNEYWGK 767

Query: 645  SINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFL 704
            S  +  V+ +  ++L G++DK+  G   K+ + +++   +GP  AA  ++ + +L   ++
Sbjct: 768  SSEENEVLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTNYI 826

Query: 705  GNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGK-------------LE 750
                F+ G++D+    E  K +K+I+        +A  ++ N  K              E
Sbjct: 827  MATAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRLQE 886

Query: 751  TQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELD----NLNSCLIMANCGSKGSTLNVS 806
                 N+   L+A     ++ +  +V   C+ +        NS   MA  G+KGS +NVS
Sbjct: 887  VLRDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVNVS 946

Query: 807  QMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSGLSPPEFLFHAIS 866
            Q++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH ++
Sbjct: 947  QIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMA 1006

Query: 867  GREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFTYGGDGLDPIDME 926
            GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R     ++QF YGGD +D +  E
Sbjct: 1007 GREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD-VTKE 1065

Query: 927  GNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKLVRYDNLGNELDPS 986
             +    +F           ++ + K   P  +++  +       E  ++Y         S
Sbjct: 1066 SHMTKFDFCLE-------NYDALLKKYNPSALIEHLD------VESALKYSK------KS 1106

Query: 987  LQDRVEYIDQDDAERNFYKSLRDY-----MYEKASHLANI--RAHKGLKEFLDEPAAELQ 1039
            L+ R ++     A+   YK    Y      Y  A +L ++  +    L+ F+D+ +   +
Sbjct: 1107 LKYRKKH-----AKEAHYKQSPKYDPVLAKYNPAKYLGSVSEKFQDKLETFIDKNSKLFK 1161

Query: 1040 AMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEPGTAVGAVGAHSIGEP 1099
              D                  IS K   KF  +   KY ++ + PG AVG + + S+GEP
Sbjct: 1162 HND-----------------DISEK---KFRALMQLKYMRSLINPGEAVGIIASQSVGEP 1201

Query: 1100 GTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNNNDERAARVVKG 1158
             TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++++  ++ A     
Sbjct: 1202 STQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADTFSK 1261

Query: 1159 RIEKTLLSDV 1168
             I K LLS+V
Sbjct: 1262 SISKVLLSEV 1271

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            ++  +P I R V    ++G R L+ EG   + +   +  I +   T N +  V  V G+E
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGITSNDVSAVLKVYGVE 1560

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI      + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1561 AARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1619

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ ++  S  I++G+  ++GTG+F ++
Sbjct: 1620 ETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 57/117 (48%), Gaps = 3/117 (2%)

Query: 12  RIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCH 71
           RI  ++F   SA ++ A S  +I+   + D  N   P SGG  D  +G +  +  C++C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALG-AFLRNMCASCG 66

Query: 72  GNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   + H F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  421 bits (1082), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 306/989 (30%), Positives = 491/989 (49%), Gaps = 143/989 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            +P+ +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 409

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G+TGG    I G  Q L
Sbjct: 410  KDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNTGG-NDVIPGVKQAL 462

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 463  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAELR 522

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNLQ----------YGDVVERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L               V RH
Sbjct: 523  QAVINGPDKWPGAIQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKVYRH 582

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 583  IKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 642

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM- 582
            E ARAE++ L    +  LTP SG P+    QD I+    +++KDSFF+R ++ Q +    
Sbjct: 643  ENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCI 702

Query: 583  --SDGNL---QFDIPPPSIMKPYYMWTGKQVFS-LLIRPNKESPVVINLDAKNKVYIPPK 636
               DG+    +    PP+I KP  +WTGKQ+ + +L+         INL +KNK+     
Sbjct: 703  RPEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSKNKI----- 757

Query: 637  DKSLPNEM---SINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAM 693
                 NE      N+  V+ +   +L G++DK+  G  K + + +++   +GP  AA  +
Sbjct: 758  ----KNEYWGKGSNENEVIFKDGALLCGILDKNQYGSSK-YGIVHSLHELYGPDVAAKVL 812

Query: 694  NRMAKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGK---- 748
            + + +L   ++    F+ G++D+    E  K +++I+         A  ++ N  K    
Sbjct: 813  SVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLSKDTPA 872

Query: 749  ---------LETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI-----KELDNLNSCLIMA 794
                      E     N+   L+A     ++ +  +V   C+     K+    NS   MA
Sbjct: 873  DDPELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFP-YNSMQAMA 931

Query: 795  NCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSG 854
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 932  LSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFYSG 991

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNT+R     +++F 
Sbjct: 992  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIEFL 1051

Query: 915  YGGDGLDPI-------------DMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQ 961
            YGGD +D               + +G  +  N S   EH N  +     K  L Y+  ++
Sbjct: 1052 YGGDAVDVTKESYMTQFKFCLENYDGLVKKYNPSALIEHLNVESALKYSKKALKYR--KK 1109

Query: 962  TNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLANI 1021
             + V   L+    +YD +  + +PS                +  S+ +   +K       
Sbjct: 1110 HSSVPHYLQNS--KYDPVLAKYNPS---------------KYLGSVSEKFQDK------- 1145

Query: 1022 RAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAK 1081
                 L+EFL+E +  +++    EG              ++ K   KF  +   KY ++ 
Sbjct: 1146 -----LEEFLNENSKLVKST---EG--------------VNEK---KFRALMQLKYMRSL 1180

Query: 1082 VEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPII 1140
            ++PG +VG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +
Sbjct: 1181 IDPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQM 1240

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVA 1169
            N  ++N+   + A      I K LLS V 
Sbjct: 1241 NLPILNDVSNQQAETFCKSITKVLLSQVT 1269

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGM-KTKTNHILEVFSVLGIE 1328
            V++ +P+I R V    ++G R L+ EG   + +   D  I + K  +N +  V    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EID   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    + + +   S  I+LG+  ++GTG+F ++
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++F  LS+  I   S  +I+   + D  N   P SGG  D  +G       CSTC  
Sbjct: 11  ITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGQ 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   D H +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  410 bits (1053), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 316/994 (31%), Positives = 495/994 (49%), Gaps = 155/994 (15%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 305  KG--------ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
            K         +  N +M  +  +Q  V  +I+           G+TGGK  PI G  Q L
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFIDVTKAQ------GNTGGKV-PIPGVKQAL 449

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 450  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELR 509

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNLQYGDV----------VERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L               V RH
Sbjct: 510  QAVINGPDKWPGATQIQNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKVYRH 569

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 570  IKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 629

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM- 582
            E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF+R ++ Q +    
Sbjct: 630  ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCI 689

Query: 583  --SDGNL---QFDIPPPSIMKPYYMWTGKQVFSLLIRPNKESPVV--INLDAKNKVYIPP 635
               DG+    +    PP+++KP  +WTGKQ+ + ++  N   P +  INL +KNK+    
Sbjct: 690  RPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLL-NSTPPEMPGINLISKNKI---- 744

Query: 636  KDKSLPNEM---SINDGYVVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFA 692
                  NE      N+  V+ +  ++L G++DKS  G   K  + +++   +GP  A   
Sbjct: 745  -----KNEYWGEGSNESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKV 798

Query: 693  MNRMAKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIM---VEDAYAKCDALIDLFNKGK 748
            ++ + +L   ++    F+ G++D+    E  K + EI+   V+   A    + +L    K
Sbjct: 799  LSVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEGDVK 858

Query: 749  L----------ETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIKELD----NLNSCLIMA 794
                       E     N+   L+A     ++ +  +V   C+ +        NS   MA
Sbjct: 859  ADDPELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQAMA 918

Query: 795  NCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSG 854
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG
Sbjct: 919  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSG 978

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNT+R     ++QF 
Sbjct: 979  IRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQFL 1038

Query: 915  YGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQQTNGVLKPLEEKLV 974
            YGGD +D +  E +     F              VD                        
Sbjct: 1039 YGGDAVD-VTKESHMTEFKFC-------------VDN----------------------- 1061

Query: 975  RYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMY-EKASHLA-NIRAHKGLKEFLD 1032
             YD L  + +PS    +E++D + A +   K++++    EK  H A NI+    L ++  
Sbjct: 1062 -YDALLKKYNPSA--LIEHLDVESALKYSKKAMKNRKKNEKIPHYAHNIKYDPVLSKY-- 1116

Query: 1033 EPAAELQAMDLDEGAPASALASV-----DQLCKI---SSKLV--------LKFLEIAIFK 1076
                           P+  L SV     D+L K    +SKL+         KF  +   K
Sbjct: 1117 --------------NPSKYLGSVSENFQDKLEKFIDSNSKLLKSKDNVNEKKFRALMQLK 1162

Query: 1077 YHKAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVI 1135
            Y ++ + PG AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I
Sbjct: 1163 YMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAI 1222

Query: 1136 STPIIN-AVLVNNNDERAARVVKGRIEKTLLSDV 1168
             TP +   +L +  D++A    K  I K +LS+V
Sbjct: 1223 KTPQMTLPILPDVTDDQADTFCKS-ITKVMLSEV 1255

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            V+  +P+I R V    ++G R L+ EG   + +   +  I +   T N +  V    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ ++  S  I++G+   +GTG+F ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 56.2 bits (134), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS L+A +I   S  +I+   + D  N   P SGG  D  +G       C+TC  
Sbjct: 11  IISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P ++  +F      L+S C  C    L   + H++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  405 bits (1040), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 311/985 (31%), Positives = 497/985 (50%), Gaps = 137/985 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRL 356
              K  LE + I  N +M  +  +Q  V  +I+S          GSTGGK  PI G  Q L
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ------GSTGGKV-PIPGVKQAL 440

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQ 416
            + K+G FR ++ GKRV+++ R+V+SPDPN+  +E+ VP   A  LTYPE VT YN  +++
Sbjct: 441  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEMR 500

Query: 417  QLVINGPNEHPGANYLLKKDEE--ARRNLRYGDRMKLARNLQ----YGDV------VERH 464
            Q VINGP++ PGA  +  +D    +   +    R  LA  L     +G        V RH
Sbjct: 501  QAVINGPDKWPGATQIQNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKVYRH 560

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 561  IKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 620

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMM- 582
            E AR+EA  L    +  LTP SG P+    QD I+    +++KDSFF+R ++ Q +    
Sbjct: 621  ENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCI 680

Query: 583  --SDGNL---QFDIPPPSIMKPYYMWTGKQVF-SLLIRPNKESPVVINLDAKNKVYIPPK 636
               DG+    +    PP+++KP  +WTGKQ+  ++L+         INL +KNK+     
Sbjct: 681  RPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI----- 735

Query: 637  DKSLPNEMSINDGY---VVIRGSKILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAM 693
                 NE      Y   V+ +   +L G++DKS  G   K+ + +++   +GP  ++  +
Sbjct: 736  ----KNEYWGKSSYENEVIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVL 790

Query: 694  NRMAKLCARFLGNRGFSIGINDVTPGFE-LKNKKEIMVEDAYAKCDALIDLFNKGKLETQ 752
            + + +L   ++ +  F+ G++D+    E  K + +I+ +       A  ++ N G  + +
Sbjct: 791  SILGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGG-DVR 849

Query: 753  PGCNE-----EQTL--EAKIGGL----LSKVREEVGEVCIKELDN-------LNSCLIMA 794
            P   E     E+ L  + K+G L     SKV     EV  K + +        NS   MA
Sbjct: 850  PDDAELLKRLEEILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMA 909

Query: 795  NCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFFSG 854
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG
Sbjct: 910  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSG 969

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNT+R     +VQF 
Sbjct: 970  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFL 1029

Query: 915  YGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFN------HVD-KPLLPY--QIMQQTNGV 965
            YGGD +D +  E +     F      A    +N      H+D +  L Y  + M+     
Sbjct: 1030 YGGDAID-VTKESHMSEFKFCVDNYDALLKRYNPSALIQHLDVESALKYSKKAMKNRKKN 1088

Query: 966  LK-PLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLANIRAH 1024
            L  P   +  +YD + ++ +PS                F  S+ +   +K          
Sbjct: 1089 LNLPHYARHDKYDPVLSKYNPS---------------KFLGSVSENFQDK---------- 1123

Query: 1025 KGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKAKVEP 1084
              L+ F+D  A+  +             A+V++  K  + + LK++        ++ + P
Sbjct: 1124 --LESFIDSNASLFKGQ-----------ATVNEK-KFRALMQLKYM--------RSLINP 1161

Query: 1085 GTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAV 1143
            G AVG + + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   
Sbjct: 1162 GEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLP 1221

Query: 1144 LVNNNDERAARVVKGRIEKTLLSDV 1168
            ++ +  +  A +      K +LS+V
Sbjct: 1222 ILPDVTDETADIFCKNTTKVILSEV 1246

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKT-NHILEVFSVLGIE 1328
            V+K +P+I R V    ++G R L+ EG   + +   +  I +   T N +  V    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1329 AARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1388
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVV 1430
            E T   L  A    +++ ++  S  ++LG+  S+GTGAF ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAECSTCHG 72
           I  ++FS +SA++I A S  +I+   + D  +   P  GG  D  +G       C+TC  
Sbjct: 11  ISSVDFSVMSAAEIRALSVKQITNPTVLD--HLGHPIRGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKHQFLSELR 128
           +   C GH GHI+L +P +   +F      L+S C  C    L   + H++  +L+
Sbjct: 68  DEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYACKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 59/114 (51%), Gaps = 2/114 (1%)

Query: 9   APKR-IKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGVSSSQAEC 67
           AP R IK ++F   S  ++ A S  +I   +  D E   + K GG  D R+G      +C
Sbjct: 9   APVRTIKEVQFGLFSPEEVRAISVAKIRFPETMD-ETQTRAKIGGLNDPRLGSIDRNVKC 67

Query: 68  STCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDKH 121
            TC   +  C GHFGHI L+ PVFH+G+     +V + +C  C  LLL E ++ 
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNEQ 121

>TDEL0F04070 Chr6 complement(753401..754264) [864 bp, 287 aa] {ON}
           Anc_8.280 YDR123C
          Length = 287

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 57/127 (44%), Gaps = 10/127 (7%)

Query: 714 NDVTPGFELKNKKEIMVEDAY---AKCDALIDLFNKGKLETQPGCNEEQTLE--AKIGGL 768
           NDV   F L+N K+I  E AY   +K D  I LFN G    +    E ++LE  A   G 
Sbjct: 7   NDVFDLFGLENDKDIDFETAYKMISKFDEEISLFNDGSALPKLDVAEHKSLEVLAFHHGS 66

Query: 769 LSKVREEVGEVCIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQD 828
             ++  E  +    EL N +S     + G  GS   V+Q+      Q ++   +   ++ 
Sbjct: 67  PKELHTE-EQAKFDELPNWDS----HSRGKNGSEQQVAQLNNFEETQALARAELLSRYES 121

Query: 829 RSLPHFL 835
            ++ HFL
Sbjct: 122 NAIEHFL 128

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 150,321,828
Number of extensions: 6605231
Number of successful extensions: 18088
Number of sequences better than 10.0: 69
Number of HSP's gapped: 18173
Number of HSP's successfully gapped: 186
Length of query: 1460
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1338
Effective length of database: 39,492,147
Effective search space: 52840492686
Effective search space used: 52840492686
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)