Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F16148g5.430ON64664626630.0
Kwal_55.214445.430ON64464618690.0
SAKL0G02442g5.430ON62363515480.0
NDAI0B056405.430ON66966314450.0
KAFR0E039105.430ON62564714360.0
Smik_4.6325.430ON62764614350.0
NCAS0F033505.430ON63963014350.0
Ecym_47905.430ON63064214060.0
YDR365C (ESF1)5.430ON62863913940.0
Suva_2.5385.430ON62963613880.0
Skud_4.6355.430ON62962013461e-178
ZYRO0F09944g5.430ON61160113411e-178
CAGL0L11638g5.430ON60861113351e-177
KNAG0C049405.430ON64264413301e-176
TPHA0H017805.430ON62261413171e-174
TDEL0E019505.430ON61764212741e-168
KLLA0E21165g5.430ON62743911621e-151
Kpol_1016.85.430ON63745011161e-144
AER259W5.430ON61944011141e-144
TBLA0A065405.430ON65943710601e-135
CAGL0L11572g5.407ON81368742.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F16148g
         (646 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...  1030   0.0  
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   724   0.0  
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   600   0.0  
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   561   0.0  
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   557   0.0  
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   557   0.0  
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   557   0.0  
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   546   0.0  
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   541   0.0  
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   539   0.0  
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   523   e-178
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   521   e-178
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   518   e-177
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   516   e-176
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   511   e-174
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   495   e-168
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   452   e-151
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   434   e-144
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   433   e-144
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   412   e-135
CAGL0L11572g Chr12 (1236335..1238776) [2442 bp, 813 aa] {ON} sim...    33   2.8  

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/646 (81%), Positives = 527/646 (81%)

Query: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60
           MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR
Sbjct: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60

Query: 61  RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDR 120
           RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKP                  KTVSLDR
Sbjct: 61  RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDR 120

Query: 121 ARGEVHSDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDW 180
           ARGEVHSDYV                                  KSGDSSKTLAVVNLDW
Sbjct: 121 ARGEVHSDYVSSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDW 180

Query: 181 DHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSH 240
           DHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSH
Sbjct: 181 DHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSH 240

Query: 241 GDDSDEELTVKDLYEEGDADDFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGT 300
           GDDSDEELTVKDLYEEGDADDFDAKS             AVVYCNNKQTAESIYKNCDGT
Sbjct: 241 GDDSDEELTVKDLYEEGDADDFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDGT 300

Query: 301 EYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPAD 360
           EYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPAD
Sbjct: 301 EYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPAD 360

Query: 361 RTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQ 420
           RTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQ
Sbjct: 361 RTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQ 420

Query: 421 DPKDGESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
           DPKDGESDVDMQITFAPAL                                         
Sbjct: 421 DPKDGESDVDMQITFAPALAEGGSGDADDGEKTEETTLEKVRRKEKERKKMRKERIKELK 480

Query: 481 XQAEDDKKQKLKEARRKPEPSATDSKSQAXXXXXXXXXXXXANSKLNKKAHFNMNEIVRS 540
            QAEDDKKQKLKEARRKPEPSATDSKSQA            ANSKLNKKAHFNMNEIVRS
Sbjct: 481 KQAEDDKKQKLKEARRKPEPSATDSKSQAELELLMMDDSEEANSKLNKKAHFNMNEIVRS 540

Query: 541 EKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQE 600
           EKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQE
Sbjct: 541 EKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQE 600

Query: 601 RNKRSQKGKNKKREANGDIAEPSGNNDLKGLVNKLKHSSKNKRQRR 646
           RNKRSQKGKNKKREANGDIAEPSGNNDLKGLVNKLKHSSKNKRQRR
Sbjct: 601 RNKRSQKGKNKKREANGDIAEPSGNNDLKGLVNKLKHSSKNKRQRR 646

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/646 (63%), Positives = 468/646 (72%), Gaps = 5/646 (0%)

Query: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60
           MS+E    +  SSDPRFA V +DPKFRET+AKKFKIKLDDRFSKKDL+FKRKARVDKYGR
Sbjct: 1   MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR 60

Query: 61  RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXX--XXXXKTVSL 118
            LKGQE+KDK+DFDKYYEK+   K         +                     K VSL
Sbjct: 61  SLKGQENKDKKDFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSL 120

Query: 119 DRARGEVHSDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNL 178
           DRARGEV SDYV                                  +SGDSSKTLAVVNL
Sbjct: 121 DRARGEVPSDYVSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNL 180

Query: 179 DWDHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKK 238
           DWDHVKSTDLM+TFSSFVP GGKI ++A+YPSEFGKERL +EE EGPPREIFKSK   KK
Sbjct: 181 DWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKK 240

Query: 239 SHGDDSDEELTVKDLYEEGDADDFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCD 298
           SH DDSD ++ V+DLYEEGDA+D+DAKS             AVVYCNN  TAE+IYKNCD
Sbjct: 241 SHDDDSDSDVDVRDLYEEGDAEDYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCD 300

Query: 299 GTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETP 358
           GTE+ESTANMFDLRYVPDGM FDDEARDEC S+PKNY+PS+FSTDALQHSKVK TWDETP
Sbjct: 301 GTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETP 360

Query: 359 ADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIF 418
           ADR AM+KRAFTQ+EIEDMDFKAYLASDSE+SEPENNQ+LK KLKSLV+QSV+VG+KSIF
Sbjct: 361 ADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIF 420

Query: 419 DQDPKDGESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 478
           DQ P++GESDVDMQITFAP L                                       
Sbjct: 421 DQAPEEGESDVDMQITFAPGL--AEGAEDDKQENAEETTLEKLKRKEKERKKMRKERIKE 478

Query: 479 XXXQAEDDKKQKLKEARRKPEPSATDSKSQAXXXXXXX-XXXXXANSKLNKKAHFNMNEI 537
              QAE++KKQK KE+R KPE +  D+KS+A             ++SKLNKKAHFNMNEI
Sbjct: 479 LKKQAEEEKKQKRKESRYKPESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFNMNEI 538

Query: 538 VRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQI 597
           VRSEKEKGKK+++Q+K++IVEDEFKPDLNDPRF+EVFED DFAIDPSQPEFKGTAAMKQI
Sbjct: 539 VRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQI 598

Query: 598 LQERNKRSQKGKNKKREANGDIAEPSGNNDLKGLVNKLKHSSKNKR 643
           LQER KRS KG+NKKR+A+G++A  +G +DLKGLV KLKHSSK K+
Sbjct: 599 LQERTKRSHKGQNKKRKADGNLANQNGQSDLKGLVKKLKHSSKAKK 644

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/635 (51%), Positives = 415/635 (65%), Gaps = 24/635 (3%)

Query: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQESKDKR 71
           ++DPRF+G+ +DPKF++ + K  KIKLDDRFSKKDLE K+KA+VDKYGRRLK  ++K+ +
Sbjct: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETK 70

Query: 72  DFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDRARGEVHSDYVX 131
           DF++Y+EKE+   +                            K  SLDRARGEV SDY+ 
Sbjct: 71  DFERYFEKEEESSSP-------------------SDEEGESTKVTSLDRARGEVPSDYLS 111

Query: 132 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDWDHVKSTDLMVT 191
                                             +GD+++ LAVVNLDWDHVKSTDLMVT
Sbjct: 112 SSEEESSSESEEESENSELESEESDLEIEESKPPTGDATRMLAVVNLDWDHVKSTDLMVT 171

Query: 192 FSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEK-GKKSHGDDSDEELTV 250
           FSSFVPKGGKI ++AIYPSEFGKER+ +EE EGPPRE+F+ K+K  ++  GDDSD  + +
Sbjct: 172 FSSFVPKGGKILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKDGDDSD--VDI 229

Query: 251 KDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGTEYESTANMF 309
           KDLYEEGDA+ D+D+K+             AVV+CNN +TAE+IY+NCDGTEYESTANMF
Sbjct: 230 KDLYEEGDAEKDYDSKALRRYQLDRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMF 289

Query: 310 DLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAMAKRAF 369
           DLRYVP+GMDF DE +DEC+ VPKNY+P++FSTDALQHS VK TWDETPA+R  M+KRAF
Sbjct: 290 DLRYVPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAF 349

Query: 370 TQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDPKDGESDV 429
           TQ+EIEDMDFKAYLASDSE SE E N++ +NKLKSLV++S+++G+KS+FD+   +G  DV
Sbjct: 350 TQKEIEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEG-GDV 408

Query: 430 DMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAEDDKKQ 489
           DM+ITF P L                                          + + +K  
Sbjct: 409 DMEITFTPGLDEAKKDDEDGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLN 468

Query: 490 KLKEARRKPEPSATDSKSQAXXXXXXXXXXXXANSKLNKKAHFNMNEIVRSEKEKGKKAK 549
           K     +  +    + KS+A              SKLNKKAHFNM EI+RSEKEKGK+ K
Sbjct: 469 KSDSQSKTADEVEKEKKSKAELELLMMDDDNDTESKLNKKAHFNMTEILRSEKEKGKRTK 528

Query: 550 FQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQERNKRSQKGK 609
           +Q++ +IVEDEFKPDLNDPRF EVFEDHDFAIDPSQPEFKGT AMK+IL+ERN+R  K K
Sbjct: 529 YQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRVSKKK 588

Query: 610 NKKREANGDIAEPSGNNDLKGLVNKLKHSSKNKRQ 644
             K+       + + +N+L GLV KLK  +K  R+
Sbjct: 589 GNKKRKLEQPRKNNNSNELNGLVAKLKRRNKKSRK 623

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/663 (48%), Positives = 404/663 (60%), Gaps = 61/663 (9%)

Query: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRL---KGQESK 68
           S+DPRFA + NDPKFR+T+ K  KIKLDDRFSKKDLE +RK++VDKYGR+L   KG E K
Sbjct: 11  STDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNE-K 69

Query: 69  DKRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDRARGEVHSD 128
           +  DFDKY+EK+   K + +                            ++DRARG+V +D
Sbjct: 70  EMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNIDRARGDVPAD 129

Query: 129 YVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDWDHVKSTDL 188
           YV                                  +SG+ SKTLAVVNLDWDHVKS+DL
Sbjct: 130 YVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNLDWDHVKSSDL 189

Query: 189 MVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDE-- 246
           M+TFSSF+P+GG+I  +AIYPSEFGKER+ +E+ EGPP+E+F+ ++K        SDE  
Sbjct: 190 MITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSKSKKISDEAN 249

Query: 247 -----ELTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGT 300
                ++ +KDLYEEGDAD D D K+             AVVYCNN +TA +IY+NCDGT
Sbjct: 250 DSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETATAIYQNCDGT 309

Query: 301 EYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPAD 360
           EYESTANMFDLRYVPDGMDF DE RD+CDS+PKNY+P +FSTDALQHS VK TWDETP +
Sbjct: 310 EYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETPVE 369

Query: 361 RTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIF-D 419
           R  +AKRAFTQ+EI+DMDFKAYLASDS+ SE E N++ KNKLK+LV      G + IF  
Sbjct: 370 RQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGG-GFGSREIFGG 428

Query: 420 QDPKDG--ESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 477
           +  K G  E +VDM+ITF PAL                                      
Sbjct: 429 KGAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIEKVARKEKERRKA--------- 479

Query: 478 XXXXQAEDDKKQKLKEARRKPEP----------------------SATDSKSQAXXXXXX 515
                    +KQKLKE + K +                       +  + KS+A      
Sbjct: 480 ---------RKQKLKELKTKAQQEKKDKLKLSKNKKNHTKEDDAEAKKNQKSRAELELLM 530

Query: 516 XXXXXXANSKLNKKAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFE 575
                   S +N KAHFNMNEI+RSEKEKGK+ K+Q+K++IVEDEFKPDLNDPRF EVFE
Sbjct: 531 MDDDEETGSTINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFE 590

Query: 576 DHDFAIDPSQPEFKGTAAMKQILQERNKR-SQKGKNKKREANGDIAEPSG--NNDLKGLV 632
           DHDFAIDPS+PEFK T AMK+IL+ER+KR  +KG NKKR  +  I E +G  ++D+  +V
Sbjct: 591 DHDFAIDPSRPEFKETKAMKEILKERSKRIHKKGSNKKRRLS--ITENAGAESSDITNIV 648

Query: 633 NKL 635
           NKL
Sbjct: 649 NKL 651

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/647 (51%), Positives = 410/647 (63%), Gaps = 46/647 (7%)

Query: 9   QGG--SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQE 66
           +GG  S DPRF+ + NDPKF+  + K  KI+LD RFSK+DLE + KA+VDKYGR+ K + 
Sbjct: 3   EGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEG 62

Query: 67  SKDKRD-FDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDRARGEV 125
           SK + D F+KY+EKE   +     E   KP                      +DRARGEV
Sbjct: 63  SKKELDDFEKYFEKEDEEEKKDTEETEEKPK---------------------VDRARGEV 101

Query: 126 HSDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDWDHVKS 185
            SDYV                                  ++GD+SKTLAVVNLDWDHVKS
Sbjct: 102 PSDYVSSSDEYTSSESEDSEEEELDSDVESEVEIENTKPETGDASKTLAVVNLDWDHVKS 161

Query: 186 TDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDD-- 243
            DLMVTFSSFVPKGGKI+R+ IYPSEFGKERL +EE EGPP+E+F+ K K K SH +D  
Sbjct: 162 ADLMVTFSSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEDFD 221

Query: 244 SDEELTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGTEY 302
           SD ++ +KDLYEEGDA+ D D+K+             AVVYCNN  TA +IY+NCDGTEY
Sbjct: 222 SDSDVDIKDLYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEY 281

Query: 303 ESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRT 362
           ESTANMFDLRYVPDGM FDDE RDEC+S+PKNY+P +FSTDALQHS VK TWDETPADR 
Sbjct: 282 ESTANMFDLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRV 341

Query: 363 AMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDP 422
            +AKRAF+Q+EIEDMDFKAYLASDS++SE E N+  KNKLK+LV +S+  G         
Sbjct: 342 EVAKRAFSQKEIEDMDFKAYLASDSDESEEEVNENSKNKLKALVGESLDFGTNG-----A 396

Query: 423 KDGESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQ 482
            DGES+VDM+ITF P L                                           
Sbjct: 397 SDGESEVDMEITFTPGL----DEAKESEEEKEESTIEKVRRKEKERRKARKDKLKQLKKD 452

Query: 483 AEDDKKQKL-----KEARRKPEPSATDSKSQAXXXXXXXXXXXXANSKLNKKAHFNMNEI 537
           AE++KK+K+     K++R+    +   +K++A                LNKKAHFN+NEI
Sbjct: 453 AENEKKEKMRSLHDKKSRKAETENEEAAKAKAELELLMIEDEDDTEQSLNKKAHFNLNEI 512

Query: 538 VRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQI 597
           +RSEKEKGKK K+Q K +IVED+FKPDL+DPRF EVFEDHDFAIDPSQPEFK T AMKQI
Sbjct: 513 IRSEKEKGKKGKYQRKEKIVEDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQI 572

Query: 598 LQERNKRSQK----GKNKKREANGDIAEPSGNNDLKGLVNKLKHSSK 640
           L ER+KRS++    GKNKKR+ +   ++ +G N +  +VNKLK + K
Sbjct: 573 LNERSKRSKERSKGGKNKKRKLDTSTSK-NGKNAISNIVNKLKKNGK 618

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/646 (49%), Positives = 398/646 (61%), Gaps = 46/646 (7%)

Query: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60
           M++E   ++G  +D RFAG+ +DPKF+ TR K  KIKLD RFSKKDLE + K++VDKYGR
Sbjct: 1   MAEEKPQKEG--ADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGR 58

Query: 61  RLKG-QESKDKRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLD 119
           ++K  Q +K+  DFDKY++KE   +   D+E                       KTV +D
Sbjct: 59  KIKNTQNNKELEDFDKYFQKE--AENDEDTE--------------------ASVKTV-VD 95

Query: 120 RARGEVHSDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLD 179
           RARGE+  DYV                                  + GD SKTLAVVNLD
Sbjct: 96  RARGEISGDYVSSSDEFTSSDSESSEQSEVESEVESEVEIEDPKPECGDVSKTLAVVNLD 155

Query: 180 WDHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGK-- 237
           WDHVKS DLM+TFSSFVPKGGK+ RVAIYPSEFGKER+ +EE EGPP+E+F+ K K K  
Sbjct: 156 WDHVKSEDLMITFSSFVPKGGKLERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKVS 215

Query: 238 ---KSHGDDSDEELTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESI 293
              KS   DSD ++ + DLYEEGDAD D D+++             A+VYC++  T+++I
Sbjct: 216 RKKKSDESDSDIDIGINDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDITTSKAI 275

Query: 294 YKNCDGTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFT 353
           Y NCDGTEYESTANMFDLRYVPDGM FDD  RDEC  +PKNYRP +FSTDALQHS VK T
Sbjct: 276 YDNCDGTEYESTANMFDLRYVPDGMTFDDAVRDECTLLPKNYRPHQFSTDALQHSNVKLT 335

Query: 354 WDETPADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVG 413
           WDETPADR  +AKRAFTQ+EI+DMDFKAYLASDS++S+ + +++ KNKLKSLV   +   
Sbjct: 336 WDETPADRLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQIDEDAKNKLKSLVG-GINFN 394

Query: 414 EKSIFDQDPKDGESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 473
            K    ++ KD + +VDM+ITF PAL                                  
Sbjct: 395 SKK---ENVKDSDEEVDMEITFTPAL---EGGNEQPSEEQEETTIEKIRRKEKERRKARK 448

Query: 474 XXXXXXXXQAEDDKKQKLKEARRK----PEPSATDSKSQAXXXXXXXXXXXXANSKLNKK 529
                   Q+E DKK KLK   +K     E    ++K++A            A   +N K
Sbjct: 449 QKVKELKQQSEKDKKTKLKSINKKYAEGEEDIKNNAKAKAELELLMDDDDAEAQGTINNK 508

Query: 530 AHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFK 589
           AHFNMNEI+RSEKEK KK+++Q+K RIVED F PDLNDPRF EVFEDHDFAIDP+QPE+K
Sbjct: 509 AHFNMNEILRSEKEKNKKSRYQNKERIVEDNFTPDLNDPRFKEVFEDHDFAIDPTQPEYK 568

Query: 590 GTAAMKQILQERNKRSQKGKNKKREANGDIAEPSGNNDLKGLVNKL 635
            T AM +IL+ER KR    K+KKR+ +G   +   N D KG +  L
Sbjct: 569 STQAMNKILKERGKRV---KDKKRKHDGSENDIIKNGDSKGNIGNL 611

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/630 (50%), Positives = 403/630 (63%), Gaps = 40/630 (6%)

Query: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60
           MS++N T+  G+ D RF+G+ NDPKFR+T+ K  KIKLD+RFSKKDLE +RKA+VDKYGR
Sbjct: 1   MSEDNSTK--GTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGR 58

Query: 61  RLK---GQESKDKRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVS 117
           ++       +K+ +DFDKY+EKE  G++A                           +TV+
Sbjct: 59  KIHEDNDMNNKELKDFDKYFEKE--GESA------------------DEKKEEEEIETVT 98

Query: 118 LDRARGEVHSDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVN 177
           +DRARGEV +DYV                                  ++GD++KTLAVVN
Sbjct: 99  VDRARGEVPADYVSSSDEYTSSESEDSGESDLESEGESEIEVDEATPETGDATKTLAVVN 158

Query: 178 LDWDHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGK 237
           LDWDHV+S+DLM+TFS F+PKGGKI ++ + PSEFGKER+ +EETEGPPRE+F+ K+K  
Sbjct: 159 LDWDHVRSSDLMITFSGFLPKGGKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKG 218

Query: 238 K---SHGDDSDEELTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESI 293
           K      D  D ++ +KDLYEEGDAD D D ++             AVVYCN+ + A +I
Sbjct: 219 KRASVESDSDDSDVDIKDLYEEGDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAARAI 278

Query: 294 YKNCDGTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFT 353
           Y+NCDGTEYESTANMFDLRYVPDGMDFDDE RD+C S+PKNY+P +FSTDALQHS VK T
Sbjct: 279 YENCDGTEYESTANMFDLRYVPDGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLT 338

Query: 354 WDETPADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVG 413
           WDETPA+R  +AKRAFTQ+EIEDMDFKAYLASDS+ SE E NQ+ KNKLKSLV  S+++G
Sbjct: 339 WDETPAERVEVAKRAFTQKEIEDMDFKAYLASDSDGSEDEVNQDAKNKLKSLVGDSLRIG 398

Query: 414 EKSIF-DQDPKDGE-SDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 471
            + IF  +D  +GE  +VDM+ITF P L                                
Sbjct: 399 NQPIFGSKDTLEGEDEEVDMEITFDPGL----SEGVEKTEEHEETTIEKVARKEKERRKA 454

Query: 472 XXXXXXXXXXQAEDDKKQKLKEARRK-----PEPSATDSKSQAXXXXXXXXXXXXANSKL 526
                      A+ +KK KLK  + K      E  A+ +KS+A              + +
Sbjct: 455 RKQKLKELKNNAQKEKKDKLKSLKGKKHNDSTEGDASTAKSKAELELLMMDDEDDTETGI 514

Query: 527 NKKAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQP 586
           NKKAHFNM EI+RSEKEK KK K+QDK RIVED FKPDLNDPRF EVFEDHDFAIDPS+P
Sbjct: 515 NKKAHFNMKEILRSEKEKSKKGKYQDKRRIVEDNFKPDLNDPRFKEVFEDHDFAIDPSRP 574

Query: 587 EFKGTAAMKQILQERNKRSQKGKNKKREAN 616
           EFK T AMK+IL+ER+KRS K   KK+ ++
Sbjct: 575 EFKETPAMKEILKERSKRSSKNAQKKKRSH 604

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/642 (47%), Positives = 390/642 (60%), Gaps = 35/642 (5%)

Query: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60
           MS + E R   ++D RFAG+ NDPKFR+ +  K KI LDDRFSKKDLEFKRKA+VDKYGR
Sbjct: 1   MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR 60

Query: 61  RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDR 120
           R+   + K+ +DFD+Y+ K +S +     +  G+                      +LDR
Sbjct: 61  RIGSYDEKEAKDFDRYFSKNESVEKIQSDDEEGE---------------TEDIAVSALDR 105

Query: 121 ARGEVHSDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDW 180
           ARGEV  DY                                   ++GD +K  AVVNLDW
Sbjct: 106 ARGEVPLDY-ESSSDENSSSESEEESEDSALDPDSELEIEESKPETGDPTKVFAVVNLDW 164

Query: 181 DHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSH 240
           DHV+S DL+ TF+SFVP GG I +VAIYPSEFGKER+ +EE EGPPRE+FK K+  K+  
Sbjct: 165 DHVRSVDLLATFNSFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQSKKEKD 224

Query: 241 GDDSDEELTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDG 299
            DD + ++ + DLYE  DA+ D+D+K+             AVVYC++  TA++IY+NCDG
Sbjct: 225 SDDENSDIDINDLYEVDDAEKDYDSKALRRYQLDRLRYYYAVVYCSDVLTAKAIYQNCDG 284

Query: 300 TEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPA 359
           TE+ESTANMFDLRYVPD M F+D+ RD+C SVPK+Y+P++FST ALQHS+VK TWDETPA
Sbjct: 285 TEFESTANMFDLRYVPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPA 344

Query: 360 DRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFD 419
           DR  ++KRAF Q+EIE+MDFKAYLASDS+ SE E N++ KN L+SLVN S+QV  KS+FD
Sbjct: 345 DRVEISKRAFNQKEIEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFD 404

Query: 420 QDPKDGESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 479
           +   + E+DV  +ITF P L                                        
Sbjct: 405 KHGSEEEADV--EITFTPGL---ENGDAPKEENEEETALDKIKRKEKERRKKRKERVKEL 459

Query: 480 XXQAEDDKKQKLKEARRKPEPSATDS-------KSQAXXXXXXXXXXXXANSKLNKKAHF 532
             QA D+KK +    RRK +  A          K QA              S LN  AHF
Sbjct: 460 KMQAIDEKKAR----RRKGDDGAVTEAEKELRKKKQAELELLMLEDETGKKSTLNNNAHF 515

Query: 533 NMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTA 592
           NMNEI++S+KEK KK+++Q+KN IV+D FKPDLNDPRF EVFEDHDFAIDPSQPEFK T 
Sbjct: 516 NMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTP 575

Query: 593 AMKQILQERNKRSQKGKN--KKREANGDIAEPSGNNDLKGLV 632
           AMK+IL+ER +RS K K    KR+A+ D  +    + L  LV
Sbjct: 576 AMKEILEERTRRSSKMKKAFNKRKASYDHPQSGQTDSLNSLV 617

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/639 (49%), Positives = 391/639 (61%), Gaps = 47/639 (7%)

Query: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60
           M+ EN  ++G   D RFAG+ +DPKF+ T+ K  KIKLD RFSKKDLE + K++VDKYGR
Sbjct: 1   MAGENPKKEG--VDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGR 58

Query: 61  RLK-GQESKDKRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLD 119
           ++K  Q +++  DFDKY+EKE   +   DSE+                      KTV +D
Sbjct: 59  KIKNAQNNRELEDFDKYFEKE--AENDEDSEV--------------------NAKTV-VD 95

Query: 120 RARGEVHSDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLD 179
           RARGEV  DYV                                  +SGD SK LAVVNLD
Sbjct: 96  RARGEVPDDYVSSSDEFTSSDSESSGESEVESEEENEVEIENAKPESGDISKNLAVVNLD 155

Query: 180 WDHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKS 239
           WDHVKS DLM+TFSSFVPKGGKI RVAIYPSEFGKER+ +EE EGPP+E+F+ K K K S
Sbjct: 156 WDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKTS 215

Query: 240 HGDDSDE-----ELTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESI 293
               +D+     ++ +KDLYEEGDAD D D+++             A+VYC++  T+++I
Sbjct: 216 KKKKTDDSDSDMDIGIKDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDTTTSKAI 275

Query: 294 YKNCDGTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFT 353
           Y NCDGTEYESTANMFDLRYVPDGM FDD+ RDEC  +PKNYRP +FSTDALQHS VK T
Sbjct: 276 YDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLT 335

Query: 354 WDETPADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVG 413
           WDETPADR  +AKRAFTQ+EI+DMDFKAYLASDS++S+ + ++E KNKLKSLV       
Sbjct: 336 WDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNS 395

Query: 414 EKSIFDQDPKDGESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 473
           +K    + P D + +VDM+ITF PAL                                  
Sbjct: 396 KK----ETPNDEDEEVDMEITFTPAL---EGGNEKSSEDKEETTIEKIRRKEKERRKARK 448

Query: 474 XXXXXXXXQAEDDKKQKLKEARRK----PEPSATDSKSQA-XXXXXXXXXXXXANSKLNK 528
                   Q+E DKK KLK   +K     E    ++KS+A                 +N 
Sbjct: 449 QKVKELKQQSEKDKKSKLKSVNKKHTNDEEEIEKNAKSKAELELLMDDDDDTETQGTINN 508

Query: 529 KAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEF 588
           KAHFNMNEI+RSEKEK KK ++Q K RIVED F PDL DPRF EVFEDHDFAIDP+QPEF
Sbjct: 509 KAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEF 568

Query: 589 KGTAAMKQILQERNKRSQKGKNKKREANGDIAEPSGNND 627
           KGT AM +IL+ER+KR    KNKKR+  G     + N D
Sbjct: 569 KGTQAMSKILKERSKRV---KNKKRKLGGSENNMTNNAD 604

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/636 (48%), Positives = 391/636 (61%), Gaps = 44/636 (6%)

Query: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLK-GQESKDK 70
           S D RFAG+ NDPKF+ TR +  KIKLD RFSKKDLE + K++VDKYGR++K    +K+ 
Sbjct: 10  SVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDAHNTKEL 69

Query: 71  RDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDRARGEVHSDYV 130
            DFDKY+EKE   +   ++++                         ++DRARGEV +DYV
Sbjct: 70  EDFDKYFEKEAENEEDTEADV-----------------------KATVDRARGEVPNDYV 106

Query: 131 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDWDHVKSTDLMV 190
                                             +SGD+SKTLAVVNLDWDHVKS DLM+
Sbjct: 107 SSGDEFTSSDSESSGESEIESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMI 166

Query: 191 TFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDEELT- 249
           TFS FVPKGGKI R+++YPSEFGKER+ +EE EGPP+E+F+ K++ K S  +++D+  + 
Sbjct: 167 TFSGFVPKGGKIERISVYPSEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSD 226

Query: 250 ----VKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGTEYES 304
               +KDLYEEGDAD D D+++             A+V C++  TA +IY+NCDGTEYES
Sbjct: 227 IDIGIKDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYES 286

Query: 305 TANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAM 364
           TANMFDLRYVPDGM FDD ARD C ++PKNYRP +FSTDALQHS VK TWDETPADR  +
Sbjct: 287 TANMFDLRYVPDGMTFDDTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEV 346

Query: 365 AKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDPKD 424
           AKRAFTQ+EI+DMDFKAYLASDS++S+ E N++ K+KLKSLV   +    K    ++  D
Sbjct: 347 AKRAFTQKEIDDMDFKAYLASDSDESDEEVNEDAKSKLKSLVG-GLGFNSKK---ENAND 402

Query: 425 G-ESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQA 483
           G E +VDM+ITF PAL                                          Q+
Sbjct: 403 GDEEEVDMEITFTPAL---EGGDEKPIEGQEETSIEKIRRKEKERRKARKQKVKELKQQS 459

Query: 484 EDDKKQKLKEARRK----PEPSATDSKSQAXXXXXXXXX-XXXANSKLNKKAHFNMNEIV 538
           E +K+ K K A +K     E    ++KS+A             A S +N KAHFNMNEI+
Sbjct: 460 EKEKRGKFKSANKKHVADEEEIKNNAKSKAELELLMDDDGDAEAESSINSKAHFNMNEIL 519

Query: 539 RSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQIL 598
           RSEKEK KK+++Q K RIVED F PDL DPRF EVFEDHDFAIDP+QPE+KGT AM +IL
Sbjct: 520 RSEKEKHKKSRYQKKERIVEDNFTPDLEDPRFKEVFEDHDFAIDPTQPEYKGTQAMNKIL 579

Query: 599 QERNKRSQKGKNKKREANGDIAEPSGNN-DLKGLVN 633
           +ER KR    K K  +   D+ E   +N ++  LVN
Sbjct: 580 KERGKRVHDRKRKHGKNENDVTEDGNDNKNIGNLVN 615

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  523 bits (1346), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 307/620 (49%), Positives = 379/620 (61%), Gaps = 39/620 (6%)

Query: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLK-GQESKDK 70
           S D RFAG+ +DPKF+ TR +  KIKLD RFSKKDLE + K++VDKYGR++K  + +K+ 
Sbjct: 10  SIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNKEL 69

Query: 71  RDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDRARGEVHSDYV 130
            DFDKY+EKE   +   DSE+  K                     + +DRARGEV SDYV
Sbjct: 70  EDFDKYFEKE--AEHDEDSEVAAK---------------------IVVDRARGEVPSDYV 106

Query: 131 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDWDHVKSTDLMV 190
                                             +SGD SKTLAVVNLDWDHVKS DLM+
Sbjct: 107 SSSDEFTSSDSESSGESEVESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLMI 166

Query: 191 TFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKK-----SHGDDSD 245
           TFSSFVP+GGKI R+AI+PSEFG+ER+ +EE EGPP+E+F+ K K K      S G DSD
Sbjct: 167 TFSSFVPRGGKIERIAIFPSEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSD 226

Query: 246 EELTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGTEYES 304
            ++ + DLYEEGDAD D D+++             AVV C++  +A++IY NCDGTEYES
Sbjct: 227 GDIGINDLYEEGDADKDVDSRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYES 286

Query: 305 TANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAM 364
           TANMFDLRYVPDGM FDD ARDEC S+PKNYRP +FSTDALQHS VK TWDETPADR  +
Sbjct: 287 TANMFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEV 346

Query: 365 AKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDPKD 424
           AKRAFTQ+EI+DMDFKAYLASDS++S+ + +++ KNKLKSLV   +    K     D K+
Sbjct: 347 AKRAFTQKEIDDMDFKAYLASDSDESDEQVDEDAKNKLKSLVG-GLDFNMKKKGANDGKE 405

Query: 425 GESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAE 484
            E +VDM+ITF PAL                                          Q+E
Sbjct: 406 -EGEVDMEITFTPAL---EGENEKPIEGQDETTIEKIRRKEKERRKARKQKVKELKQQSE 461

Query: 485 DDKKQKLKEARRK----PEPSATDSKSQAXXXXXXXXXXXXANSKLNKKAHFNMNEIVRS 540
            DKK KLK   +K     E    ++KS+A                +N KAHF+M EI+RS
Sbjct: 462 KDKKSKLKSVNKKHVADEEEIKNNAKSKAELELLMDEDDAETEGSMNSKAHFSMKEILRS 521

Query: 541 EKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQE 600
           EKEK K+ ++Q K RIVED F PDL DPRF EVFEDHDFAIDP+QPE+K T AM  IL+E
Sbjct: 522 EKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKE 581

Query: 601 RNKRSQKGKNKKREANGDIA 620
           R KR +  K K  +   D+A
Sbjct: 582 RGKRVKDKKRKHSDNGNDVA 601

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  521 bits (1341), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 309/601 (51%), Positives = 375/601 (62%), Gaps = 38/601 (6%)

Query: 11  GSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQESKDK 70
           GSSDPRFAG++NDPKFR  + K  K+KLDDRFSKKDL+ +RKA+VDKYGRR+ G ESKD 
Sbjct: 9   GSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITG-ESKDL 67

Query: 71  RDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDRARGEVHSDYV 130
           +DFDKY+EKE            GK                     V +DRARGE+   Y 
Sbjct: 68  KDFDKYFEKE------------GKEGKEDESSSSSEDEEEETESKV-VDRARGELPEAYT 114

Query: 131 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDWDHVKSTDLMV 190
                                             +SGD SKTLAVVNLDWDHV++ DLM+
Sbjct: 115 SSESEDSESDLSEEESEADVAEAVEEAKP-----ESGDPSKTLAVVNLDWDHVRAADLMI 169

Query: 191 TFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDEELTV 250
           TFSSF+P GGKI ++ IYPSEFGKER+ +EE EGPPREIF  K   KK H +DSD ++ +
Sbjct: 170 TFSSFLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNKK---KKHHDEDSDSDVDI 226

Query: 251 KDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGTEYESTANMF 309
           +DLYEEGDAD + D  +             A+VYCNN +T ESIY NCDGTEYESTAN+F
Sbjct: 227 RDLYEEGDADKEVDNAALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTANIF 286

Query: 310 DLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAMAKRAF 369
           DLRYVP+GM+FDDE +DEC  +PKNY+P EFSTDALQHS VK TWDETP DR  ++KRAF
Sbjct: 287 DLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAF 346

Query: 370 TQREIEDMDFKAYLAS--DSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDPKDGES 427
           +Q+E+EDMDF+AYLAS  D  D E  NN+E KNKLKSLV QS+  G         K  E 
Sbjct: 347 SQKELEDMDFQAYLASGTDESDGEENNNEEAKNKLKSLVGQSLAYG---------KQQEE 397

Query: 428 DVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAEDDK 487
           + DM+ITF P L                                          QAE +K
Sbjct: 398 EPDMEITFTPGL---DDSKPQADEDHEETTIEKVKRKEQERRKARKQRLKELKQQAEQEK 454

Query: 488 KQKLKEARRKPEPS-ATDSKSQAXXXXXXXXXXXXANSKLNKKAHFNMNEIVRSEKEKGK 546
           K+KL+  + K +    +D+KS+A                LNKKAHFNMNEI++SEKEK K
Sbjct: 455 KEKLRSGKNKKQVEDESDAKSKAELELLMMEDEDDTEKSLNKKAHFNMNEILKSEKEKKK 514

Query: 547 KAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQERNKRSQ 606
           K K+QDK +I+EDEFKPDLNDPRF+EVFE+ DFAIDPSQPE+K T AMK+IL+ER+KR+ 
Sbjct: 515 KGKYQDKGKIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAH 574

Query: 607 K 607
           K
Sbjct: 575 K 575

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  518 bits (1335), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 310/611 (50%), Positives = 390/611 (63%), Gaps = 37/611 (6%)

Query: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQESKDKR 71
           S+DPRF+ + NDPKF+++ +K+ KIKLDDRF KKDLE  R+A+VDKYGR++K   SKD  
Sbjct: 6   SNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKEGSSKDIE 65

Query: 72  DFDKYYEK-EKSGKT-APDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDRARGEVHSDY 129
           DFDKY+EK EKS +  + D   V K                       +DRARGEV SDY
Sbjct: 66  DFDKYFEKDEKSAEEESADEGDVAKSKKI-------------------VDRARGEVPSDY 106

Query: 130 VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK--SGDSSKTLAVVNLDWDHVKSTD 187
           V                                  K  +GD++KTLA VNLDWDHV+S D
Sbjct: 107 VSSEDEFTSSDSDTSGDSDYDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVD 166

Query: 188 LMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDEE 247
           +MVTFSSF+PKGGKI ++ IYPSEFGKER+ +EE EGPPRE+F+  +K KK +  + +EE
Sbjct: 167 MMVTFSSFLPKGGKIEKICIYPSEFGKERMKREEVEGPPRELFQKNKKKKKKNSSEDEEE 226

Query: 248 --LTVKDLYEEGDADD-FDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGTEYES 304
             + +KDLYEEG+ADD  D ++             AV+YCNN ++A++IY+NCDGTEYES
Sbjct: 227 SDVDIKDLYEEGNADDQVDKRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYES 286

Query: 305 TANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAM 364
           TAN+ DLRYVPDGMDFDDE +D+C+ +PKNY+P +FSTDALQHS VK TWDETP DR  +
Sbjct: 287 TANIIDLRYVPDGMDFDDEPKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEV 346

Query: 365 AKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDPKD 424
           AKRAFTQ+EIEDMDFKAYLASDS++SE E N+E KNKLKSLV +S+++  K     D  D
Sbjct: 347 AKRAFTQKEIEDMDFKAYLASDSDESEEEVNEEAKNKLKSLVGESLKIDGK-----DGSD 401

Query: 425 GESDVDMQITFAPALXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQA 483
            +  +DM+ITF P L                                           ++
Sbjct: 402 EDEGMDMEITFTPGLDEANAEGEDKDGEDNEETTIEKVRRKEKERRKARKQKLKELKQKS 461

Query: 484 EDDKKQKLKEARRKPEPSATDSKSQAXXXXXXXXXXXXANSKLNKKAHFNMNEIVRSEKE 543
           E++KKQKLK   +  EP +   K++             +NS +N KAHFNMNEI+RSEKE
Sbjct: 462 EEEKKQKLK--SKHDEPLSDKKKAEL---ELLMMDENESNSGINSKAHFNMNEILRSEKE 516

Query: 544 KGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQERNK 603
           K KK KFQ K RIVED+FKP+L+D RF EVFEDHDFAIDPSQPEFK T AMK+IL+ER K
Sbjct: 517 KSKKGKFQKKQRIVEDDFKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEILKERRK 576

Query: 604 RSQKGKNKKRE 614
           RS+  K+ K E
Sbjct: 577 RSRDSKHGKEE 587

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  516 bits (1330), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 314/644 (48%), Positives = 394/644 (61%), Gaps = 41/644 (6%)

Query: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQES--KD 69
           SSDPRF+GV NDPKFR T+ KK K+KLD RFSKKDLE K+KA+VDKYGR++K  ++  K+
Sbjct: 6   SSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGDANKKE 65

Query: 70  KRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDRARGEVHSDY 129
             DFDKY+EKE   K + D+E    P                    V +DRARGEV  DY
Sbjct: 66  LEDFDKYFEKEDEAKESEDAEAPEAPVK------------------VVVDRARGEVPDDY 107

Query: 130 VXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDWDHVK 184
           V                                       +SGD SKTLAVVNLDWDHVK
Sbjct: 108 VSSADEFTSSDSESSGSSESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVK 167

Query: 185 STDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDS 244
           S DLM+TF+ F+PKGGKI R+ IYPSEFGKERL +EE EGPP+E+F  K+  K S     
Sbjct: 168 SVDLMITFTGFIPKGGKIERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSK 227

Query: 245 DEE----------LTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESI 293
             E          + +KDLYEEGDA+ D D+K+             AVVYCNN +TA++I
Sbjct: 228 GAESGKSDDDVSDVDIKDLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAI 287

Query: 294 YKNCDGTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFT 353
           Y NCD TEYESTANMFDLRYVP+GM FDD+ RDEC+++PKNY+P  F+TDALQHS VK T
Sbjct: 288 YDNCDATEYESTANMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLT 347

Query: 354 WDETPADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVG 413
           WDETPADR  +AKRAF+Q+EI+DMDFKAYLASDSEDS+ + ++ +KN+LK+LV  +++  
Sbjct: 348 WDETPADRVEIAKRAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKAS 407

Query: 414 EKSIFDQDPKDGESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 473
                 ++ +D E  +DM+ITF P L                                  
Sbjct: 408 RPKGGAEEDEDDEEGMDMEITFTPGLDEAQVAEQEAAAEEESTIDKIRRKEKERRKNRKQ 467

Query: 474 XXXXXXXXQAED--DKKQKLKEARRKPEPSATDSKSQAXXXXXXXXXXXXANSK--LNKK 529
                     ++  DK + LK+ R+  E    D K++A             +SK  LNKK
Sbjct: 468 KLKELKKNAEKEKRDKLKSLKKGRKNGEEEPVDDKAKAELELLMMDEDEERDSKSTLNKK 527

Query: 530 AHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFK 589
            HFNMNEI+RSEKEK KK+KFQDKNRIVEDEFKPDL+D RF EVFEDHDFAIDPS+PEFK
Sbjct: 528 MHFNMNEIMRSEKEKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFK 587

Query: 590 GTAAMKQILQERNKRSQKGKNKKREANGDIAEPSGNNDLKGLVN 633
            T AM++ILQER+ R+ + K KKR++     + S   D+  +V+
Sbjct: 588 ETPAMQKILQERSNRA-RSKGKKRKSAEQSTDTSDKTDISQIVS 630

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  511 bits (1317), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 310/614 (50%), Positives = 385/614 (62%), Gaps = 40/614 (6%)

Query: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQESKDKR 71
           ++D RF+GV NDPKF+  R K  KIKLD RFSK DLE  RKARVDKYGR++    +++ +
Sbjct: 8   NTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNLNNQEAK 67

Query: 72  DFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDRARGEVHSDYVX 131
           DFDKY+EKE+ GK     E+  KP                      +DRARGEV SDY  
Sbjct: 68  DFDKYFEKEEDGKG---EEIAVKPL---------------------IDRARGEVPSDYQS 103

Query: 132 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDWDHVKSTDLMVT 191
                                            +SGDSSKT+AVVNLDWDHVK+TDL+VT
Sbjct: 104 SLDDYTSSESEDSEDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVT 163

Query: 192 FSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKS-----HGDDSDE 246
           FSSFVPKGGKI R+AI+PSEFGK+R+ +EE EGPP+E+F+ K+K           DDSD 
Sbjct: 164 FSSFVPKGGKIERIAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKSNAEFNDDSD- 222

Query: 247 ELTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGTEYEST 305
            + + DLYEEGD D + D+KS             AVV+CNN  TAE+IY NCDGTEYEST
Sbjct: 223 -VDINDLYEEGDVDKEVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYEST 281

Query: 306 ANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAMA 365
           AN+FDLRYVPDGMDF+D+  DEC  +PKNY P  F+TDALQHS VK TWDETPADR  +A
Sbjct: 282 ANVFDLRYVPDGMDFEDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIA 341

Query: 366 KRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDPKDG 425
           KRAFTQ+EI++MDFKAYLASDSE+SE   N+E+KNKLKSLV  S+++G+KSI D    + 
Sbjct: 342 KRAFTQKEIDEMDFKAYLASDSEESE-GENEEVKNKLKSLVGLSMKIGDKSIMDNKSDNE 400

Query: 426 ESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAED 485
           + +VDM+ITF P L                                           +E 
Sbjct: 401 DGEVDMEITFTPGL--AENDNNDKEEENEETTIEKVRRKEKERRKARKQKLKEIKQNSEQ 458

Query: 486 DKKQKLK----EARRKPEPSATDSKSQAXXXXXXX-XXXXXANSKLNKKAHFNMNEIVRS 540
           +K++KLK    E  +K E + +D  ++A               S +NKKAHFNM EI+RS
Sbjct: 459 EKREKLKSLKTERSKKSEDTESDKNAKAELELLMMDEDEINGTSTINKKAHFNMKEILRS 518

Query: 541 EKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQE 600
           EKEK KK+KFQ+K +IVED FK DLNDPRF+E+FEDHDFAIDP+Q E+K TAAMK+IL+E
Sbjct: 519 EKEKTKKSKFQNKEKIVEDNFKADLNDPRFNEMFEDHDFAIDPTQSEYKETAAMKEILKE 578

Query: 601 RNKRSQKGKNKKRE 614
           R+KRS   K  + E
Sbjct: 579 RSKRSTMKKANRSE 592

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  495 bits (1274), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 315/642 (49%), Positives = 396/642 (61%), Gaps = 45/642 (7%)

Query: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQE-SKDK 70
           S DPRF+ + +DPKF   + K FK+KLDDRFSKKDLE KRK +VDKYGRR++  E SK+ 
Sbjct: 6   SKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSKES 65

Query: 71  RDFDKYYEK-EKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDRARGEVHSDY 129
           +DFDKY+E+ ++  K   D+E++                        ++DRARGEV SDY
Sbjct: 66  KDFDKYFEQSDEEKKKDKDTEIL------------------------TVDRARGEVPSDY 101

Query: 130 VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDWDHVKSTDLM 189
           V                                   SGDSSKTLAVVNLDWD+V+S+DLM
Sbjct: 102 VSSSDEFTSSDSEVSDNEVESESESEVELEKTEPS-SGDSSKTLAVVNLDWDNVRSSDLM 160

Query: 190 VTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKK-SHGDDSDEEL 248
           +TFSSF+P GG+I ++AIYPSEFGKER+ +EE EGPP+E+F+ K+K  K    +DSD ++
Sbjct: 161 ITFSSFLPAGGRIEKIAIYPSEFGKERMQREEVEGPPKELFQKKKKKSKKGQQEDSDSDI 220

Query: 249 TVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGTEYESTAN 307
            VKDLYEEGDAD + D K+             AVVYCNN   AESIY NCDGTEYESTAN
Sbjct: 221 DVKDLYEEGDADKNVDNKALRQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTAN 280

Query: 308 MFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAMAKR 367
           +FD+RYVPDGMDFD + +D C  +PKNY+P +FSTDALQHS VK TWDETPADR  +AKR
Sbjct: 281 IFDIRYVPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKR 340

Query: 368 AFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFD-----QDP 422
           AFTQ+EIEDMDFKAYLASDS+DSE E + + K+KLKSLV  S      S FD      D 
Sbjct: 341 AFTQKEIEDMDFKAYLASDSDDSEDEVDAQSKSKLKSLVTGS------SAFDFTRKNADE 394

Query: 423 KDG-ESDVDMQITFAPALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 481
            DG + +VDM+ITF P L                                          
Sbjct: 395 VDGNDEEVDMEITFTPGL--DEANKDGQEGQEEESTIDKVRRKEKERRKARKAKVKELKH 452

Query: 482 QAEDDKKQKLKEARRKPEPSA-TDSKSQAXXXXXXXXXXXXANSKLNKKAHFNMNEIVRS 540
           QAE DKK KLK+ R K       D KS+A                +NKKAHFNM EI++S
Sbjct: 453 QAEQDKKVKLKKGRGKQTSDIEQDPKSKAELELLMMDDEDDTEKSINKKAHFNMKEILKS 512

Query: 541 EKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQE 600
           EKEK KK K+QDKN+IV D+FKPDL DPRF E+FE HDFAIDP+Q EF+GT AMK++L +
Sbjct: 513 EKEKKKKNKYQDKNKIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNK 572

Query: 601 RNKRSQKGKNKKREANGDIAEPSGNNDLKGLVNKLKHSSKNK 642
           R+K++ +  +K++ A  +  + + N D+  +V KLK   + K
Sbjct: 573 RSKQAHRVNSKRKIATQE-NDTNENGDIANIVAKLKKGGRKK 613

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  452 bits (1162), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 235/439 (53%), Positives = 305/439 (69%), Gaps = 15/439 (3%)

Query: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60
           M+ + E ++  + DPRF+G+ NDPKFR T++K FKIKLDDRFSK+DLE +RKA+VDKYGR
Sbjct: 1   MNSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGR 60

Query: 61  RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDR 120
           ++    +KD +DFD+Y+ KEK     P+     K                      S+DR
Sbjct: 61  KIVDA-NKDVKDFDRYFTKEK-----PED----KEDESNSSESSDDQEAEAAVHAKSVDR 110

Query: 121 ARGEVHSDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDW 180
           ARGE  +DYV                                   SG+++ TLAVVNLDW
Sbjct: 111 ARGEPPADYVSSSDEESSSESEEESGDSDIESEEIELEESKPA--SGNATNTLAVVNLDW 168

Query: 181 DHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSH 240
           DHVKS DL VTF SFVPKGG+I ++AIYPSEFGKER+ +EE EGPP+E+F+SK+  K   
Sbjct: 169 DHVKSADLFVTFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQSKKSKKNDK 228

Query: 241 GDDSDEELTVKDLYEEGDADDFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGT 300
               D+E+ V+ +YEEGDA+D+D+K+             AVVYC++ +TAESIY+NCDGT
Sbjct: 229 ---DDDEINVESIYEEGDAEDYDSKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGT 285

Query: 301 EYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPAD 360
           EYESTAN+FDLRYVPDGM+ DD+ RDEC S+PKNY+P++FSTDALQHSKVK TWDETPAD
Sbjct: 286 EYESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPAD 345

Query: 361 RTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQ 420
           R  ++KRAFTQ+EIE+MDFKAYLASDSE+SE E++ ++KNKLK+LV  SV+VG+KS+FDQ
Sbjct: 346 RVEISKRAFTQKEIEEMDFKAYLASDSEESEVEHDDQVKNKLKALVMDSVKVGQKSLFDQ 405

Query: 421 DPKDGESDVDMQITFAPAL 439
              + +++ DM+ITF P L
Sbjct: 406 KEDEDDNEADMEITFTPGL 424

 Score =  125 bits (315), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 97/126 (76%), Gaps = 6/126 (4%)

Query: 524 SKLNKKAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDP 583
           S +N KAHFNMNEI++SEKEK KKAK+Q+K +IV+DEF PD+NDPRF EVFEDHDFAIDP
Sbjct: 505 STINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFTPDVNDPRFKEVFEDHDFAIDP 564

Query: 584 SQPEFKGTAAMKQILQERNKRSQKGKNKKREANGDIAEPSGNNDLK---GLVNKLKHSSK 640
           +QPEFK T AM++IL+ER  RS K K++ ++ N +IA    + D+    GLV KLK  +K
Sbjct: 565 TQPEFKKTPAMEKILKERTVRSSK-KSRGKKRNHEIANTEHSKDINKIGGLVEKLK--AK 621

Query: 641 NKRQRR 646
           NKR + 
Sbjct: 622 NKRTKH 627

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  434 bits (1116), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 241/450 (53%), Positives = 300/450 (66%), Gaps = 33/450 (7%)

Query: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60
           MS E+  +Q  SSDPRF+G+ +DPKF+ ++ K  KIKLDDRF K DL+ K K++VDKYGR
Sbjct: 1   MSGEDSMKQ--SSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGR 58

Query: 61  RLKG-QESKDKRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLD 119
           +LK  +++K+  DFDKY+EKE         E +G                    K   LD
Sbjct: 59  KLKDVKDNKELEDFDKYFEKEDEEDK---EEEIG-----------------TEAKVKVLD 98

Query: 120 RARGEVHSDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLD 179
           RARGEV SDY                                   +SGDSSKTLAVVNLD
Sbjct: 99  RARGEVPSDYESSSEEFTSSDSESSGESEVDSDEESEDEVETSKPESGDSSKTLAVVNLD 158

Query: 180 WDHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKS 239
           WD+VKS DLM+TFSSF+PKGGKI ++ IYPSEFGKER+A+EE EGPPRE+F  K+  K S
Sbjct: 159 WDYVKSQDLMITFSSFLPKGGKIEKICIYPSEFGKERMAREEVEGPPRELFNKKKNKKSS 218

Query: 240 HGDDSDEE--------LTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTA 290
                D++        + +++LYEEGDA+ D D+K+             AVVYCNN  +A
Sbjct: 219 KKSSKDDDEDDESDSDVDIRELYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIASA 278

Query: 291 ESIYKNCDGTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKV 350
           ESIY+NCDGTEYES+AN+FDLRYVPDG +FDDE RDEC  +PKNY+  +F+TDALQHS V
Sbjct: 279 ESIYENCDGTEYESSANIFDLRYVPDGTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNV 338

Query: 351 KFTWDETPADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSV 410
           K TWDETPADR  +AKRAFTQ+EIE+MDFKAYLASDS++SE E N ++KNKLKSLV+QS 
Sbjct: 339 KLTWDETPADRVEIAKRAFTQKEIEEMDFKAYLASDSDESEEEPNDDVKNKLKSLVSQST 398

Query: 411 QVGEKSIF-DQDPKDGESDVDMQITFAPAL 439
            +G+KSIF D+   + E DVDM+ITF P L
Sbjct: 399 TIGDKSIFDDKGDNNEEDDVDMEITFTPGL 428

 Score =  123 bits (308), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%)

Query: 501 SATDSKSQAXXXXXXXXXXXXANSKLNKKAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDE 560
           +  D+K++A            + S LNKKAHFNMNEIVRSEKEKGKK+K+QDKN+IVED+
Sbjct: 493 TNVDAKAKAELELLMMDDETESTSTLNKKAHFNMNEIVRSEKEKGKKSKYQDKNKIVEDD 552

Query: 561 FKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQE 600
           FKPDLNDPRF E+FEDHDFAIDP+Q EFK T AMK+IL+E
Sbjct: 553 FKPDLNDPRFKEIFEDHDFAIDPTQSEFKETTAMKEILKE 592

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  433 bits (1114), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 241/440 (54%), Positives = 295/440 (67%), Gaps = 26/440 (5%)

Query: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60
           M+K NE     S D RFA +E+DPKFR  + K  KIKLDDRFSK+DLE+KRKA+VDKYGR
Sbjct: 1   MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR 60

Query: 61  RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXXXXXXXKTVSLDR 120
           R+     K+++DF+KY+ KE S   A +S+                           LDR
Sbjct: 61  RIGTAPGKEEKDFEKYFTKESSESAAEESD-------------------KEDSSVAKLDR 101

Query: 121 ARGEVHSDYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDW 180
           ARGEV +DYV                                  +SGD SK LAVVNLDW
Sbjct: 102 ARGEVPADYVSSSDEESSSESEADSDDATAESDEEVEIEEEKP-ESGDPSKVLAVVNLDW 160

Query: 181 DHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSH 240
           DHVK  DL+V F+SFVP+GGKI RVAIYPSEFGKER+ +EE EGPPRE+FKSK+  K   
Sbjct: 161 DHVKCADLLVAFNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPREVFKSKKDKKAKQ 220

Query: 241 GDDSDEELTVKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDG 299
               D+E+ +KDLYE+GDA+ D+D+K+             AVVYCNN  TAE+IY+NCDG
Sbjct: 221 D--DDDEIGLKDLYEQGDAEKDYDSKALRRYQLERLRYYYAVVYCNNVATAEAIYQNCDG 278

Query: 300 TEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPA 359
           TEYESTANMFDLRYVP+G+ FDDE R+EC SVPK+Y+P +FST ALQH +VK TWDETPA
Sbjct: 279 TEYESTANMFDLRYVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPA 338

Query: 360 DRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFD 419
           DR  MAKRAF+Q+EIEDMDFKAYLASDSE+SE ++N E KNKL+SLV+ SV+V +K +F 
Sbjct: 339 DRVEMAKRAFSQKEIEDMDFKAYLASDSEESEADDNSEAKNKLRSLVS-SVKVADKPLFA 397

Query: 420 QDPKDGESDVDMQITFAPAL 439
            +  + E+DV  QITF P L
Sbjct: 398 DESDEEEADV--QITFTPGL 415

 Score =  118 bits (296), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/109 (70%), Positives = 89/109 (81%), Gaps = 3/109 (2%)

Query: 526 LNKKAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQ 585
           +N  AHFNMN+I+RSEKE+GKK+K+Q K++IVED+FKPDLNDPRF EVFED DFAIDPSQ
Sbjct: 500 INSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPSQ 559

Query: 586 PEFKGTAAMKQILQERNKRSQKGKNKKREAN--GDIAEPSGNNDLKGLV 632
           PEFK TAAMKQILQER KRS K  +KKR+ +   D A  S   DLKGLV
Sbjct: 560 PEFKETAAMKQILQERRKRSSKSASKKRKTDEQSDSAMDSA-GDLKGLV 607

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  412 bits (1060), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/437 (52%), Positives = 286/437 (65%), Gaps = 11/437 (2%)

Query: 14  DPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQESKDKRDF 73
           D RFAGV  DPKFR ++    K+KLD+RFSKKDL+   K++VD+YGR++  +  KDK+DF
Sbjct: 9   DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRNEKDKKDF 68

Query: 74  DKYYEKEKSGKTAPDSELVGKPXXXXXXXXXXXXX---XXXXXKTVSLDRARGEVHSDYV 130
           DKYY K++  +   + +                          +   LDRARG+V SDYV
Sbjct: 69  DKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARLDRARGDVPSDYV 128

Query: 131 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGDSSKTLAVVNLDWDHVKSTDLMV 190
                                             ++GD SKT+AVVNLDWDHVKSTDLM+
Sbjct: 129 SSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWDHVKSTDLMI 188

Query: 191 TFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKK-SHGDDSDEELT 249
           TFS F+PKGGKIN++AIYPSEFGKER+ +EE EGPP+E+FK K K  K S  +D++++++
Sbjct: 189 TFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKSTAEDNEDDVS 248

Query: 250 ---VKDLYEEGDAD-DFDAKSXXXXXXXXXXXXXAVVYCNNKQTAESIYKNCDGTEYEST 305
              + DLYEEGDAD + D+KS             AVVYCNN  TAESIYKNCDGTEYEST
Sbjct: 249 DVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYKNCDGTEYEST 308

Query: 306 ANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAMA 365
           AN+FD+RYVPD M FDD  RDECD +PKNY+P +FSTDALQHS VK TWDETPADR  ++
Sbjct: 309 ANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPADRVEIS 368

Query: 366 KRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSV---QVGEKSIFDQDP 422
           KRAF+Q+EI++MDFKAYLASDS++SE E N + KNKLKSLV         G+ + +D D 
Sbjct: 369 KRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLVGGGAFGNVFGKDTEYDLDG 428

Query: 423 KDGESDVDMQITFAPAL 439
            D E  VDM+ITF P L
Sbjct: 429 SDDEDGVDMEITFTPGL 445

 Score =  117 bits (294), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/82 (75%), Positives = 74/82 (90%)

Query: 524 SKLNKKAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDP 583
           S +N KAHFNMNEI+RSEKEKGKK+K+QDKN+IV+DEFKP+LND RF E+FEDH FAIDP
Sbjct: 537 SGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDP 596

Query: 584 SQPEFKGTAAMKQILQERNKRS 605
           +QPEFK T+AMK+IL ER KR+
Sbjct: 597 TQPEFKQTSAMKEILNERTKRA 618

>CAGL0L11572g Chr12 (1236335..1238776) [2442 bp, 813 aa] {ON}
           similar to uniprot|P38814 Saccharomyces cerevisiae
           YHR103w SBE22 or uniprot|P42223 Saccharomyces cerevisiae
           YDR351w SBE2
          Length = 813

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 39/68 (57%), Gaps = 10/68 (14%)

Query: 193 SSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDEELTVKD 252
           S+ +P  G  +++A+ PS+  + RL KE++E   R++ K KEK         DE+  + +
Sbjct: 251 SAIIPNAGTGSKLALTPSQ--RYRLRKEQSEHALRDVIKRKEKLY-------DEQDGIIE 301

Query: 253 LYEEGDAD 260
           L +EGD D
Sbjct: 302 L-QEGDID 308

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.127    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,539,332
Number of extensions: 2785739
Number of successful extensions: 12966
Number of sequences better than 10.0: 105
Number of HSP's gapped: 13292
Number of HSP's successfully gapped: 138
Length of query: 646
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 530
Effective length of database: 40,180,143
Effective search space: 21295475790
Effective search space used: 21295475790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 69 (31.2 bits)