Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F16126g5.431ON55453825790.0
Kwal_55.214375.431ON55453819430.0
SAKL0G02464g5.431ON56356315000.0
Smik_15.2965.431ON56654812041e-159
Suva_8.1715.431ON56754912031e-159
YOR118W (RTC5)5.431ON56755011931e-158
KLLA0E21143g5.431ON57255011581e-152
Skud_15.2815.431ON56753711061e-145
TDEL0E019405.431ON56755211051e-144
Ecym_47645.431ON56655210941e-143
NCAS0H020505.431ON57355210841e-141
ZYRO0F09966g5.431ON55454810431e-135
NDAI0C016105.431ON58456010451e-135
TPHA0H017905.431ON56554510171e-131
Kpol_1016.75.431ON5625489841e-126
KNAG0B042305.431ON5775509631e-123
AER258C5.431ON5575478871e-112
CAGL0L11616g5.431ON5555478091e-100
TBLA0A065305.431ON4925195331e-60
SAKL0B10516g7.57ON132580742.2
TPHA0L020202.649ON58343733.1
KLTH0D07106g2.541ON104294723.5
NCAS0E023007.57ON134177715.3
SAKL0D12210g1.493ON64996698.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F16126g
         (554 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   998   0.0  
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   753   0.0  
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   582   0.0  
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   468   e-159
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   468   e-159
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   464   e-158
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   450   e-152
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   430   e-145
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   430   e-144
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   426   e-143
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   422   e-141
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   406   e-135
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   407   e-135
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   396   e-131
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   383   e-126
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   375   e-123
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   346   e-112
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   316   e-100
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   209   1e-60
SAKL0B10516g Chr2 (906415..910392) [3978 bp, 1325 aa] {ON} simil...    33   2.2  
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    33   3.1  
KLTH0D07106g Chr4 complement(621467..624595) [3129 bp, 1042 aa] ...    32   3.5  
NCAS0E02300 Chr5 (448033..452058) [4026 bp, 1341 aa] {ON} Anc_7....    32   5.3  
SAKL0D12210g Chr4 complement(1009364..1011313) [1950 bp, 649 aa]...    31   8.4  

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/538 (92%), Positives = 495/538 (92%)

Query: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76
           HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE
Sbjct: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76

Query: 77  GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA 136
           GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA
Sbjct: 77  GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA 136

Query: 137 LNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVIKN 196
           LNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPA             SKATVIKN
Sbjct: 137 LNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATVIKN 196

Query: 197 SRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPL 256
           SRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPL
Sbjct: 197 SRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPL 256

Query: 257 ECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDS 316
           ECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDS
Sbjct: 257 ECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDS 316

Query: 317 GFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHILP 376
           GFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHILP
Sbjct: 317 GFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHILP 376

Query: 377 ALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLXXXX 436
           ALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTL    
Sbjct: 377 ALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLGGGI 436

Query: 437 XXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTSEHKFLIQDI 496
                        VKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTSEHKFLIQDI
Sbjct: 437 GIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTSEHKFLIQDI 496

Query: 497 ETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGLVGQNQSGGSV 554
           ETWGCGGEKELEEQMKN             INLKSVNDDRALLELAGLVGQNQSGGSV
Sbjct: 497 ETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELAGLVGQNQSGGSV 554

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/538 (67%), Positives = 433/538 (80%)

Query: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76
            F SE D++ W+DKKA+K +++PELVS+K NI+GK L   +   EL++VLRL   NE V 
Sbjct: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76

Query: 77  GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA 136
            L+FNCVQTL+NFP I+DCYEN+TY G+LKSCVLLNK RCL YV++KRY+HTKLVYISLA
Sbjct: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136

Query: 137 LNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVIKN 196
           LNK VKE+SS  NS +SLDAP++IATFN+V  EEL VP+             SK+T+IKN
Sbjct: 137 LNKTVKEVSSSSNSQESLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTIIKN 196

Query: 197 SRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPL 256
           S+LD N+SE W+SF+  ALSILRTMNT+I T  D LK  I+++QFQ+ IS+VCPNLL+P 
Sbjct: 197 SKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLLPF 256

Query: 257 ECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDS 316
           E LMEHVLFL RDLVD++AS+P + +SKLV+EPLLAQLATVWPRELVFSRLQKLYVGRDS
Sbjct: 257 ESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVGRDS 316

Query: 317 GFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHILP 376
           GFSMRSFQAKAFKWMAPSILL+ G RIP+D++YAK+KN RYK FL+EYPRLK+EDQ +LP
Sbjct: 317 GFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQVLLP 376

Query: 377 ALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLXXXX 436
             SGK+KLLFA+ +N PWKVTNSELFGD+KTTI+QLSPIQEVYKAS+PGN+YFNTL    
Sbjct: 377 PFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLGGGI 436

Query: 437 XXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTSEHKFLIQDI 496
                         K++PGNVSLTIDPNLEFA FR+ GFGGSI PS+T  +EHKFLIQDI
Sbjct: 437 GVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVNEHKFLIQDI 496

Query: 497 ETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGLVGQNQSGGSV 554
           E WGCGGEKELEEQMKN             INLKS+NDDRALLE+AGLVGQNQSGGS+
Sbjct: 497 EAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEMAGLVGQNQSGGSI 554

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/563 (50%), Positives = 393/563 (69%), Gaps = 9/563 (1%)

Query: 1   MGXXXXXXXXXXXXXXHFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRK 60
           MG               FES++DLL ++  +A K  +TPELV++K N+ GK  +  ++ +
Sbjct: 1   MGQTASSGTGTTGNVLQFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVE 60

Query: 61  ELMRVLRLQNANEAVEGLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYV 120
           E++++L++   NE +  LL NC++TL+NFPLI++ Y+++T  G+LKSC+LL+ +RC++YV
Sbjct: 61  EMLQLLKIPLGNELLADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYV 120

Query: 121 QDKRYNHTKLVYISLALNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAXXXXX 180
             K Y+  KL+YI+LAL K VKE+ S P+     DA  +I  +N+V  ++L VPA     
Sbjct: 121 GFKNYDQLKLIYIALALRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADSMLQ 180

Query: 181 XXXXXXXXSKATVIKNSRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQ 240
                   S+   + N+++  ++ + WD +K  A+++LRTMN DI+ +QD ++ VIS+ Q
Sbjct: 181 LLTLSLVLSRHCTVNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQ 240

Query: 241 FQNVISSVCPNLLVPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPR 300
           F N I++V P +L PLE L+EH+L+L+RDL D   S  +   SKLVTEPLLAQL+T+ P+
Sbjct: 241 FSNAIAAVFPQVLKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPK 300

Query: 301 ELVFSRLQKLYVGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKF 360
           ELV+S+L+KLYVGR+SGFSMRSFQ+KAFKWMAPSILL+ G RI DDQ+YA  KN RYKKF
Sbjct: 301 ELVYSKLRKLYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKF 360

Query: 361 LDEYPRLKDEDQHIL-PALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVY 419
           L+EYPRLKD+DQHI+ P    +RKLLFA+ +NEPWKVTN ELFGD+KTT+VQLSP QE++
Sbjct: 361 LEEYPRLKDKDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELF 420

Query: 420 KASKPGNVYFNTLXXXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSI 479
           KA + GNVYFNTL                  K+ PGNVSLTID +LEFA+FR+VG+GG+I
Sbjct: 421 KAVRTGNVYFNTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAI 480

Query: 480 APSN--------TPTSEHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKS 531
           +P            T E+KF++QD+E WGCGGEKEL+EQ+K              INL+S
Sbjct: 481 SPGTLMTKLEEEKTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQS 540

Query: 532 VNDDRALLELAGLVGQNQSGGSV 554
           + +DRALLE+AGLVGQ+QSGGS+
Sbjct: 541 IGEDRALLEMAGLVGQHQSGGSM 563

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  468 bits (1204), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 243/548 (44%), Positives = 343/548 (62%), Gaps = 13/548 (2%)

Query: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEG 77
           F ++ D+L++++ KA + ++ PELVS KGN+  + L+  ++ K L   L     +  + G
Sbjct: 21  FANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIVG 80

Query: 78  LLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLAL 137
           ++ N ++ L+NFPL+   YE +T  G+LK  VLLNK+RC ++++ K Y+  KL++ISL+L
Sbjct: 81  IVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLSL 140

Query: 138 NKAVKEMSSLPNSNDSL---DAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVI 194
            K  KE  S  N N+ +   +  ++I  F++V  E L +PA             S     
Sbjct: 141 QKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECPT 200

Query: 195 KNSRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLV 254
            NS ++   + +WD FK  A+++LRTMN D++ + ++  + I+Y QF   I +V PNLL 
Sbjct: 201 TNSTINNETNVQWDKFKIPAMNLLRTMNPDVVNNIES--HFITYQQFSTAIRTVMPNLLK 258

Query: 255 PLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGR 314
           PLE LMEH L+L  DLVD + +   I  SK++T  LLAQL+T  P+EL   +LQ LY+GR
Sbjct: 259 PLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIGR 318

Query: 315 DSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHI 374
            SGFSMRS QAK FKWMAPSIL+V G RI + ++YA NKN RY+ FL+E+P LKD DQ +
Sbjct: 319 KSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQKM 378

Query: 375 LPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLXX 434
             +L  K+K  FA+ I++PWKVTN + FGD+ T I+Q+SP Q++YK +K G VYFNT+  
Sbjct: 379 DASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTIGG 438

Query: 435 XXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS--------NTPT 486
                           ++VPGNVSLT D  LEFA FRN G+GGS+ P            +
Sbjct: 439 GIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENSS 498

Query: 487 SEHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGLVG 546
            E   LIQD+E WGCGGEKELEEQ+K              INL+S+ +DRALLE+AGLVG
Sbjct: 499 FELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGLVG 558

Query: 547 QNQSGGSV 554
           Q+Q GGS+
Sbjct: 559 QHQGGGSM 566

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  468 bits (1203), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 241/549 (43%), Positives = 345/549 (62%), Gaps = 14/549 (2%)

Query: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEG 77
           F +  D+L++++ KA + V+ PELVS KGN+  + ++  ++ K L  VL     +  + G
Sbjct: 21  FTNNGDVLAYFNHKAQQQVTVPELVSLKGNLQIEDMNTPISHKSLCSVLHFPQKHTLLSG 80

Query: 78  LLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLAL 137
           ++ N ++ L+NFPL+   YE +T  G+LK  +LLNK RC +Y++ K Y+  KL++ISL+L
Sbjct: 81  IVTNMLRVLSNFPLMNSSYEPITGYGLLKCILLLNKGRCGKYLKFKSYDQLKLLFISLSL 140

Query: 138 NKAVKEMSSLPNS---NDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVI 194
            K  KE  S  N        +  ++IA F++V  E L VPA             S     
Sbjct: 141 QKTDKEELSEENENNVKKERNIKQIIANFDDVDSEVLYVPADFMLQFLSWLLILSVECPT 200

Query: 195 KNSRL-DVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLL 253
            NS++ +  I ++WDSFK  A+++LRTMN D++++ ++  ++I++ QF   I +V PNLL
Sbjct: 201 SNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVVSNTES--HLITFDQFSTSIRTVMPNLL 258

Query: 254 VPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVG 313
            PLE LMEH  +L  DLV+ + S   +  S+++T  LL QL+TV PREL   +LQ LY+G
Sbjct: 259 KPLENLMEHFFYLENDLVNYDTSLSSVRDSRIMTPALLTQLSTVLPRELFIQKLQSLYIG 318

Query: 314 RDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQH 373
           R SGFSMRS QAK FKWMAPSIL+V G+RI +  +YA  KN RY+ FL+E+P+LKD DQ 
Sbjct: 319 RKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDEYAAQKNPRYRHFLEEFPKLKDSDQK 378

Query: 374 ILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLX 433
           +  + + K+K  FA+ I++PWKVTN + FGD+ T I+Q+SP Q++YK ++ G +YFNT+ 
Sbjct: 379 MDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRIIQISPRQDIYKVNRKGTIYFNTIG 438

Query: 434 XXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTS------ 487
                            +F+PGNVSLT D  LEFA FR+ G+GGS+ P +          
Sbjct: 439 GGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLEFAVFRHTGYGGSLEPGSLSVERKEEDS 498

Query: 488 --EHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGLV 545
             E  FLIQD+E WGCGGEKELEEQMK              INL+S+ +DRALLE+AGLV
Sbjct: 499 FFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESKRRQQINLRSLGEDRALLEMAGLV 558

Query: 546 GQNQSGGSV 554
           GQN+ GGS+
Sbjct: 559 GQNRGGGSM 567

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  464 bits (1193), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 241/550 (43%), Positives = 342/550 (62%), Gaps = 16/550 (2%)

Query: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEG 77
           F +  D+L++++ KA + V+ PELVS+KGN+  + L+  ++ K L   L     +  + G
Sbjct: 21  FTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIVG 80

Query: 78  LLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLAL 137
           ++ N ++ L+NFPL+K  YE +T  G+LK  +LLN+ RC ++++ K Y+  KL++ISL+L
Sbjct: 81  IVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLSL 140

Query: 138 NKAVKEMSSLPNSNDS---LDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVI 194
            K  KE  S  + ND    L   ++I  F++V  E L +PA             +     
Sbjct: 141 QKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCPT 200

Query: 195 KNSRLD-VNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLL 253
            NS+LD     ++W +FK  AL++LRTMN D++   D   + I++ QF   I +V PNLL
Sbjct: 201 TNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVG--DIESHSITFQQFSTAIRTVMPNLL 258

Query: 254 VPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVG 313
            PLE LMEH  +L  DLVD + +   I  SK++T  LLAQL+T  P+EL   +LQ LY+G
Sbjct: 259 KPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYIG 318

Query: 314 RDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQH 373
           R SGFSMRS QAK FKWMAPSIL+V G RI + ++YA  KN RY+ FL+E+P+LK+ DQ 
Sbjct: 319 RKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQM 378

Query: 374 ILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLX 433
           +  +   KRK  FA+ I++PWKVTN + FGD+ T I+++SP Q++YK ++ G +YFNT+ 
Sbjct: 379 MDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNTIG 438

Query: 434 XXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS---------NT 484
                            +++PGNVSLT D  LEFA FRN G+GGS+ P          N+
Sbjct: 439 GGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENS 498

Query: 485 PTSEHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGL 544
           P   H FLIQD+E WGCGGEKELEEQ+K              INL+S+ +DRALLE+AGL
Sbjct: 499 PYELH-FLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRRQQINLRSLGEDRALLEMAGL 557

Query: 545 VGQNQSGGSV 554
           VGQ+Q GGS+
Sbjct: 558 VGQHQGGGSM 567

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  450 bits (1158), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 246/550 (44%), Positives = 349/550 (63%), Gaps = 20/550 (3%)

Query: 24  LLSWYDKKALKLVSTPELVSYKGNI-DGKPLDAALNRKELMRVLRLQNANEAVEGLLFNC 82
           L+ +++ + LK ++T EL+S+K NI +GK L+  +   ++ R+  +   +  +  +  N 
Sbjct: 24  LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEVSDISRMYYIPKDSAVMLSVFMNM 83

Query: 83  VQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLALNKAVK 142
             TLANFPL++D YE VT+  +LK+ +LL K R ++Y   K+YN  K+++I+L+L K +K
Sbjct: 84  FHTLANFPLLQDSYEKVTFKTLLKATLLLVKERAIKYTDWKKYNDLKMLFITLSLEKNIK 143

Query: 143 EMSSLPNS--NDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVIKNSRLD 200
               + +S  +D  D   VI ++N    +EL V A             S+  ++ N ++D
Sbjct: 144 AEPLMDSSALSDCKDWKGVIRSYNGTDFDELKVNANNLLHFLALILALSRCCILNNCKID 203

Query: 201 VNI-SEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPLECL 259
            ++ ++  + FK  AL+I+RTMN +I++  D L + I+YTQF   ++ V PNLL PL+ L
Sbjct: 204 NDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLKML 263

Query: 260 MEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDSGFS 319
           MEHVL+++RDLVD +  +P+   +K+V E  L+QLAT  P+E+VFSR QKLYVGR+SGFS
Sbjct: 264 MEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESGFS 323

Query: 320 MRSFQAKAFKWMAPSILLVQGSRIPDDQD-----YAKNKNQRYKKFLDEYPRLKDEDQHI 374
           MRSFQ+K FKWMAP+IL V+G RI D+ D     YA  KN RY+ FL EY +LK EDQH+
Sbjct: 324 MRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAV-KNPRYRNFLQEYGKLKSEDQHL 382

Query: 375 LPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKAS--KPGNVYFNTL 432
                 KRKLLFA+ I +PWKV+N +LFGD  T I+QL P QE++ A   K GNVYFNT+
Sbjct: 383 DTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFNTV 442

Query: 433 XXXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTS----- 487
                             K+ PGNVSLTID +LEF  FR++G GGS  P    +      
Sbjct: 443 GGGIGIGSSQPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGEER 502

Query: 488 ---EHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGL 544
              E++F+IQD+E WGCGGEKELEEQ+K              INL+S+ +DRALLE+AGL
Sbjct: 503 NSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMAGL 562

Query: 545 VGQNQSGGSV 554
           VGQ+QSGGS+
Sbjct: 563 VGQHQSGGSI 572

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  430 bits (1106), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 228/537 (42%), Positives = 328/537 (61%), Gaps = 14/537 (2%)

Query: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEG 77
           F +  D+LS+++ KA + V+ PELVS+KGN+  + L+  ++ K L  VL     +  V G
Sbjct: 21  FTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVVG 80

Query: 78  LLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLAL 137
           ++ N ++ L+NFPLI   YE +T  G+LK  +LLN+ RC ++++ K Y+  KL++ISL+L
Sbjct: 81  IVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLSL 140

Query: 138 NKAVKEMSSLPNSNDSL---DAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVI 194
            K  KE  S  N  +        ++I  F++V  E L +PA             S     
Sbjct: 141 QKTDKEELSEENEENINRERHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKFPT 200

Query: 195 KNSRLDVNIS-EKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLL 253
            NS+ D + + E+WD+FK  A+++LRTMN D++++ ++  + I++ QF   I +V PNL 
Sbjct: 201 TNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVES--HFITFEQFSTAIRTVMPNLF 258

Query: 254 VPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVG 313
            PLE LMEH  +L+ DLV  +A+   I  S+++T  LLAQL+T  P+EL   +LQ LY+G
Sbjct: 259 KPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSLYIG 318

Query: 314 RDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQH 373
           R SGFSMRS QAK FKWMAPSIL+V G RI +  +YA  KN RY+ FLDE+P+LKD DQ 
Sbjct: 319 RKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQK 378

Query: 374 ILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLX 433
           +  +   K+K  FA+ I++PWKVTN + FGD+ T I+Q+SP Q++YK ++ G +YFNT+ 
Sbjct: 379 MDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNTIG 438

Query: 434 XXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS--------NTP 485
                            +++PGNVSLT D  LEFA FR+ G+GG + P            
Sbjct: 439 GGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEENS 498

Query: 486 TSEHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELA 542
             E  FLIQD+E WGCGGEKELEEQ+K              IN +S+ +DRALLE+A
Sbjct: 499 FFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMA 555

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  430 bits (1105), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 232/552 (42%), Positives = 338/552 (61%), Gaps = 18/552 (3%)

Query: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76
            F S ++L+ ++DK+A+ + +  EL ++K  ++GK L   +  +EL R LR+   N  + 
Sbjct: 20  QFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPVRSEELTRWLRIPCENVLLC 79

Query: 77  GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA 136
             ++  V+ L+NFPL+KD +++VT +G+LKS +L N ++C +YV  K Y+H KL++I+L+
Sbjct: 80  EAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCHKYVGVKNYDHMKLLFIALS 139

Query: 137 LNKAVKEMSSLPNSN---DSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATV 193
           + K+VKE  S  +S    D   +  ++ T+NN+  ++L +PA             +    
Sbjct: 140 MRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCP 199

Query: 194 IKNSRL--DVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPN 251
             N +   DV  +E W SFK  A ++LRTMN +I+T+ ++    + + QF   IS+V PN
Sbjct: 200 TSNCQFPEDVVYAE-WGSFKLAATNLLRTMNNNIVTNLESYS--VKFEQFSKAISTVMPN 256

Query: 252 LLVPLECLMEHVLFLNRDLVDLEA-SKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKL 310
           +   L+ +MEH+L+ + DLV   + S   I  SK  T+ +LAQL T    E+ F++ Q L
Sbjct: 257 IFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQLITALSNEMTFAKFQNL 316

Query: 311 YVGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDE 370
           YVGR+SGFSMRS QAK FKWMAP+++L+ G  + DD+D++K KN RY+ FL +YP+LKD 
Sbjct: 317 YVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFSK-KNSRYRDFLSKYPKLKDR 375

Query: 371 DQHILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFN 430
           DQH+      K K++FA+ I EPWK TN + FG   TTIVQLSP Q+V+KA+    +YFN
Sbjct: 376 DQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKAASNEVMYFN 435

Query: 431 TLXXXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTS--- 487
           TL                   + PGNVSLTID  LEFAAFR+VG+GG+  P    T    
Sbjct: 436 TLGGGIGIGNNQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNR 495

Query: 488 -----EHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELA 542
                E KFLIQD+E WGCGG++ELEEQ K              INL+S  +DRALLE+A
Sbjct: 496 EDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMA 555

Query: 543 GLVGQNQSGGSV 554
           GLVG +Q+GGS+
Sbjct: 556 GLVGHSQNGGSM 567

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  426 bits (1094), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 228/552 (41%), Positives = 332/552 (60%), Gaps = 19/552 (3%)

Query: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNR----KELMRVLRLQNANE 73
           F  E ++L ++D +A++ +   ELV+++ NI    LDA L      + L+++ +L     
Sbjct: 19  FRDEKEILEFFDNQAVRQLHGLELVAFQNNIG---LDADLKDYLSCEFLVQLCKLPRHKY 75

Query: 74  AVEGLLFNCVQTLANFPLIKD-CYENV-TYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLV 131
               + +  +   + FPL+     E+V T++G++K+C+L +  + L+Y Q K Y+   L+
Sbjct: 76  GFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLI 135

Query: 132 YISLALNKAVK-EMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSK 190
           +I LAL    K     L     S DA K++ +FN++  E + V A             +K
Sbjct: 136 FILLALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIEVSADDLLQFMTFLLVITK 195

Query: 191 ATVIKNSRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCP 250
             + +N  ++ +I E W  +++ AL+ILRTMN  I++  DA KNV++  QF++ I++VCP
Sbjct: 196 YCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAVCP 255

Query: 251 NLLVPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKL 310
           NLL PL   M+HVL+ +  LV    +      S ++T+PLLAQL T+WP+ +++  L+KL
Sbjct: 256 NLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLKKL 315

Query: 311 YVGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDE 370
           ++ + SGFS+RSFQAK   WMAPSILLV G +I DD      KNQRYK FL EYP+LKDE
Sbjct: 316 FIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLA-KNQRYKSFLQEYPKLKDE 374

Query: 371 DQHILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFN 430
           DQ     + GKRK+ FA+ ++E WKVTN E FG++KT I+QLSP QEV++ASK GN+YFN
Sbjct: 375 DQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGNIYFN 434

Query: 431 TLXXXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSN------- 483
           T+                  K+ PGNVSLTIDP+ EF  FRNVG GGSI+P         
Sbjct: 435 TVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFLERPD 494

Query: 484 -TPTSEHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELA 542
              + E +F+IQD+E WGCGG+KE E Q+K              INL S+ +D+ALLE+ 
Sbjct: 495 VEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALLEMV 554

Query: 543 GLVGQNQSGGSV 554
           GLVG +QSGGS+
Sbjct: 555 GLVGHHQSGGSL 566

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  422 bits (1084), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 229/552 (41%), Positives = 334/552 (60%), Gaps = 20/552 (3%)

Query: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAA-----LNRKELMRVLRLQNAN 72
           F SE +L   + ++ L   +  ELV++K  I  +  D+      +++ EL  +L L   N
Sbjct: 27  FNSEEELRESFKRRILCHFTPLELVAFKKKIGHEQTDSEAGVEYISKNELTNLLHLPREN 86

Query: 73  EAVEGLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVY 132
             +  L +  +  L+NFPL+++    VT +G+L   +LL+K RC  ++    Y+   L++
Sbjct: 87  VLLVDLTYKLIAILSNFPLLREPQTEVTEIGLLMCIILLSKERCHRFIGSNTYDQLGLIF 146

Query: 133 ISLALNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKAT 192
           I+++L+ A K +     +   L+  +++ TF+N+  +EL +PA                 
Sbjct: 147 IAMSLDYADK-LLPYARTPKKLNVEELLRTFDNIPIDELEIPAPVLLQFLSWGLLLLIKC 205

Query: 193 VIKNSRLD-VN-ISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCP 250
              N +L  +N   + W S++  A +I+R+M+  I+ +   ++  I+YTQF +V  +V P
Sbjct: 206 PTSNCQLKPINEFYQNWSSYEKAAKNIIRSMDQSIIRNLTDVR--INYTQFSDVFKAVLP 263

Query: 251 NLLVPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKL 310
           N   PLE LM H+L+++ DL+D E     +  SKL++EPLLAQLATV P+EL  S+LQKL
Sbjct: 264 NFTTPLESLMGHLLYMDSDLIDHETMP--MNNSKLMSEPLLAQLATVLPKELFLSKLQKL 321

Query: 311 YVGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDE 370
           YVGR+SGFSMRS Q+K F W APSILLV G  I DD  YAK KN RY KFL++YP+LK+E
Sbjct: 322 YVGRESGFSMRSLQSKCFNWEAPSILLVSGMLISDDLQYAKEKNPRYGKFLEQYPKLKEE 381

Query: 371 DQHILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFN 430
            QH+    S ++K  FA+ I++PW+VTN E FG + + I+QL+P Q+V+ ASKP  +YFN
Sbjct: 382 QQHLDACHSQRKKATFAVYIDDPWRVTNKEFFGSMNSMIIQLAPRQDVFHASKPNMIYFN 441

Query: 431 TLXXXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTS--- 487
           T+                  K++PGNVSLTID  LEFA FR++G+GG+  PS   T    
Sbjct: 442 TVGGGIGFGNKQPLISNAHKKYIPGNVSLTIDSTLEFAVFRHIGYGGAFKPSALLTKRGK 501

Query: 488 -----EHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELA 542
                E KF+IQD+E WGCGGEKEL+EQ+K              INLKS+ +DRALLE+A
Sbjct: 502 EDESFEIKFIIQDVEVWGCGGEKELQEQIKKLEWEEAEAKRRQHINLKSLGEDRALLEMA 561

Query: 543 GLVGQNQSGGSV 554
           GLVGQ+QSGGS+
Sbjct: 562 GLVGQSQSGGSM 573

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  406 bits (1043), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/548 (42%), Positives = 329/548 (60%), Gaps = 18/548 (3%)

Query: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76
           HF S +D+L  ++ +ALK  +  ELVS+K  + GK L+  L  +EL + L +      + 
Sbjct: 15  HFTSNSDILKSFNDRALKQFTVTELVSFKNKL-GKDLNERLTNEELTKWLSVPQDEILLR 73

Query: 77  GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA 136
            LL+N VQ L NFPL+K+ YENVT +GVLK+ +L N  RC +YV+ + Y+  KL +I+L+
Sbjct: 74  ELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALS 133

Query: 137 LNKAVKE---MSSLPNSNDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATV 193
           + K VKE   +SS  +S +S D  +++ TF+ +   EL VP              +    
Sbjct: 134 IRKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCP 193

Query: 194 IKNSRLD-VNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNL 252
           I N +L+ V + + W+S+   A +ILR+M     +S       I Y  F + + S+ P++
Sbjct: 194 INNCKLENVAMFDNWNSYIKSAHTILRSMRPMDESSW------IEYEPFAHTMRSIAPHI 247

Query: 253 LVPLECLMEHVLFLNRDLVD-LEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLY 311
             PL  +MEH+LF + +LVD L  ++  I  SKL+   LLAQ+++   ++L    LQ+LY
Sbjct: 248 FDPLTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQISSALSKQLPIYHLQRLY 307

Query: 312 VGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLK--D 369
           +GRD GFSMRSFQAK FKW AP+I+L++G RI DD++Y+  KN R++KFL EYP+LK  D
Sbjct: 308 LGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KNTRFRKFLHEYPKLKPSD 366

Query: 370 EDQHILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYF 429
            D  +      K K++ A+ +++PWK+TN E FG   TTIVQLSP QEV+ +S+   +YF
Sbjct: 367 MDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYF 426

Query: 430 NTLXXXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS---NTPT 486
           NT+                   + PGNVSLT+D  LEFA  R+ G GG + P        
Sbjct: 427 NTIGGGIGIGNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDKD 486

Query: 487 SEHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGLVG 546
            E K L+QD+E WGCGGEKELEEQ+K              INL+S+ +DRALLE+AGLVG
Sbjct: 487 FEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRRQQINLRSIGEDRALLEMAGLVG 546

Query: 547 QNQSGGSV 554
           Q QSGGSV
Sbjct: 547 QAQSGGSV 554

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  407 bits (1045), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 218/560 (38%), Positives = 336/560 (60%), Gaps = 39/560 (6%)

Query: 27  WYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEGLLFNCVQTL 86
           ++ K+ +   +  EL+SYK  ++   LD  + ++E++++L L + N  +  ++FN V +L
Sbjct: 32  YFQKRTIGHFTPLELISYKNKLNHDHLDDMITKEEIIQLLHLPDDNVILSNMIFNMVHSL 91

Query: 87  ANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLALNKAVKEMSS 146
            NFP + +   ++T   +L   +LL+ +RC  ++  K Y+  KL++I L L+        
Sbjct: 92  CNFPFLGERIWDITAGNLLTCIILLDNDRCQRFIGSKSYDQIKLLFILLCLSTNNSSGKP 151

Query: 147 LPNSNDSL-------------------DAPKVIATFNNVAEEELVVPAXXXXXXXXXXXX 187
           L  SN  L                   +   ++ ++N ++ ++L VPA            
Sbjct: 152 LSASNSKLREKSENISTTSIYSQEIGYNLTDILQSYNGISIDDLSVPALSLSECFTWTLI 211

Query: 188 XSKATVIKNSRLDVN--ISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVI 245
            S      N ++  N  I   W+ ++  +L+ILR+M++ I+++ D  +  IS+TQF+NV 
Sbjct: 212 MSIKCPTANCKILPNETIYNSWNEYQKASLNILRSMDSSIVSNLDDYR--ISFTQFENVF 269

Query: 246 SSVCPNLLVPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFS 305
           +SV PN   PLE +M H+L++++DL++    +  IP+SKL++E LLAQL+T  P+EL  S
Sbjct: 270 TSVVPNFTHPLENIMNHLLYMDKDLINHPVME--IPKSKLMSESLLAQLSTTLPKELFIS 327

Query: 306 RLQKLYVGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYP 365
           +LQKLY+GR SGFSMRS Q+K FKW+AP+ILLV G  IP+D++Y    N R+K+FL E+P
Sbjct: 328 KLQKLYIGRQSGFSMRSLQSKCFKWLAPTILLVSGLIIPNDEEY---NNPRFKRFLQEFP 384

Query: 366 RLKDEDQHILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPG 425
           +L D +Q + P  S K+K+ FA+ I+EPW+VTN E FGD+ + I++LSP Q+++K+ K  
Sbjct: 385 KLNDNEQSLEPCHSYKKKISFAVYIDEPWRVTNKEFFGDLNSRIIELSPRQDIFKSLKSH 444

Query: 426 N-VYFNTL--XXXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS 482
             +YFNT+                    K+ PGNVSLT++  LEFA FR+VG GG+ +PS
Sbjct: 445 ELIYFNTIGCGIGIGDKQPHVSNGANSRKYQPGNVSLTLESTLEFAVFRHVGHGGAFSPS 504

Query: 483 NTPTS--------EHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVND 534
              T         E KF+IQD+E WGCGGEKELEEQMK              +NLKS+++
Sbjct: 505 ELLTKRGTEEESFEIKFIIQDVEVWGCGGEKELEEQMKQLAWEEAEAKRRQQVNLKSISE 564

Query: 535 DRALLELAGLVGQNQSGGSV 554
           DRALLE+ GLVGQ+QSGGS+
Sbjct: 565 DRALLEMVGLVGQHQSGGSM 584

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  396 bits (1017), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 203/545 (37%), Positives = 337/545 (61%), Gaps = 13/545 (2%)

Query: 20  SENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEGLL 79
           SE +++ +++K+ +   S  EL+ +K  ++       ++   + ++L++Q+ ++ +  L+
Sbjct: 24  SELEIVDYFNKRVISQFSNIELLCFKHLLEIDDYSTIIDDAVVYKLLQIQDVSDRLRNLI 83

Query: 80  FNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLALNK 139
            N ++ L NFP I    +NVT  G+LK+ V+L K + ++Y  + + N  K+++I+L    
Sbjct: 84  LNFIKRLTNFPFISTVADNVTAYGLLKTIVILQKQKFIKYTNNNQLNMLKILFIALGDYD 143

Query: 140 AVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVIKNSRL 199
             ++   + + ++ +    ++ T++ +   ++ V +             S      NS +
Sbjct: 144 REEDNKKILDCHN-ISISTILTTYDGIPIHDISVSSSNMISFLTWILALSNVCPTNNSIV 202

Query: 200 DV-NISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPLEC 258
           D  ++ + W+ ++T A+S++R+MN DI+   D  +N++ + QF+  + ++ P++ +PLE 
Sbjct: 203 DTKHMFKYWEKYETSAISLVRSMNPDIIKPDDN-QNIL-FIQFKTALETIMPHVYLPLEH 260

Query: 259 LMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDSGF 318
           L+ H+LF+   L+  +  +    +SKL+T  + +QL+T+   ++V S+L KLY GR+SGF
Sbjct: 261 LLNHLLFMESSLIKSQEIEISFQESKLMTFAVASQLSTLLRNDVVISKLHKLYSGRESGF 320

Query: 319 SMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHILPAL 378
           SMRSFQ+KAFKW AP+ILL+ G R+ DD +YA  KN RYKKF+D+YPRL+D DQ++ P  
Sbjct: 321 SMRSFQSKAFKWNAPTILLISGMRVTDDVEYATKKNPRYKKFIDQYPRLRDLDQNLEPCH 380

Query: 379 SGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLXXXXXX 438
           S  RK+ FA+ ++EPWKV+N   FG +KT IV+LSP Q+ ++A+KPG +YFNT+      
Sbjct: 381 SKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVELSPRQDCFRAAKPGVIYFNTVGGGIGI 440

Query: 439 XXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSN--------TPTSEHK 490
                      + + PGNVSLTID +LEF AFR+ G+GGSI PS+        T T E +
Sbjct: 441 GSSQPVQKKNSLSYTPGNVSLTIDNSLEFGAFRHTGYGGSIEPSSILQKKEDATRTFEIR 500

Query: 491 FLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGLVGQN-Q 549
           FLIQDIE WGCGGEKE++EQ+K              +NLKS+ +DRALLE+AG++G +  
Sbjct: 501 FLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKRQRVNLKSMGEDRALLEMAGIIGNHAH 560

Query: 550 SGGSV 554
           SGGS+
Sbjct: 561 SGGSL 565

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  383 bits (984), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 205/548 (37%), Positives = 320/548 (58%), Gaps = 16/548 (2%)

Query: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76
             +S  D+L +++ ++L ++   E+  +K  +  K L   L + E   +LR+ ++N  ++
Sbjct: 21  ELKSREDILDFFNNRSLSILLPMEIECFKSRLGDKDLSDPLTKDEFNTLLRIADSNSQLQ 80

Query: 77  GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA 136
            LL+N    ++ FP + +  E++T  G+LK  +LL + R  +Y+        KL++I L 
Sbjct: 81  ILLWNFFLKISAFPFLSNRSESMTGFGILKGIILLTRERIKKYLGWSNAKLIKLIFIGLT 140

Query: 137 LNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVIKN 196
             + V     +           V+ T + +      V               S      N
Sbjct: 141 SQEKV----GVKTEASVFKIQHVLDTLDGIDLASSTVKDTDMLSFITWLLLLSVHCPTSN 196

Query: 197 SRL-DVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVP 255
            +L + ++ +KW  ++  A S++R+MN  I T+   +   ISY+ F + I +V  N++ P
Sbjct: 197 CKLNEKSLYDKWKDYEIVASSMVRSMNKKITTTGKGIG--ISYSDFSHTIVAVSKNVMSP 254

Query: 256 LECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRD 315
           LE ++EH+L+   DL++       + ++KL+T PL+AQL TV P E+V S+LQKLYVGR+
Sbjct: 255 LENIVEHMLYKQDDLLEFPCLDTFLKETKLMTYPLVAQLCTVLPNEIVMSQLQKLYVGRE 314

Query: 316 SGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHIL 375
           SG+SMRS Q+K F W A +ILLV G+RI DD +Y++NKN RYK+FL+EYP+LKDEDQ + 
Sbjct: 315 SGYSMRSLQSKVFNWKAATILLVSGTRIVDDIEYSENKNPRYKRFLEEYPKLKDEDQEMD 374

Query: 376 PALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLXXX 435
              + K+K+ FA+ I+EPW+VTN   FG+ +T+I++LSP Q+ + + K G+VYFNT+   
Sbjct: 375 DCHNLKKKVTFAVYIDEPWRVTNKNYFGEKRTSIIELSPRQDKFNSLKVGSVYFNTIGGG 434

Query: 436 XXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS--------NTPTS 487
                         V++ PGNVSLT+D  LEF  FR+ G+GG+I PS             
Sbjct: 435 IGIGNNQPVTKLNSVRYAPGNVSLTLDNTLEFGVFRHTGYGGTIGPSELLKKNNEENKAF 494

Query: 488 EHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGLVGQ 547
           E +FLI+D+E WGCGGEKELEEQ++              INLK++ +DRALLE+AG++GQ
Sbjct: 495 EIRFLIRDVEVWGCGGEKELEEQLREWKWEEAEAKRRQEINLKTMGEDRALLEMAGIIGQ 554

Query: 548 N-QSGGSV 554
           + QSGGS+
Sbjct: 555 HGQSGGSI 562

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  375 bits (963), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 209/550 (38%), Positives = 321/550 (58%), Gaps = 27/550 (4%)

Query: 28  YDKKALKLVSTPELVSYKGNID-GKPLDAALNRKELMR--VLRLQNANEAVEGLLFNCVQ 84
           Y+ + L+  +  EL ++K  +   + L+  +  +EL+    L L+   +    LL   ++
Sbjct: 32  YNDRVLRQFNASELYTFKCRVGMTRQLNDVVLEQELLEWLCLPLEGHLQQPSKLLVGVIK 91

Query: 85  TLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLAL----NKA 140
            L  FP I +   N+T + +LK+ +L+N+ +CL+Y+ +K YNH +L++++L L    + +
Sbjct: 92  VLGQFPFISNTGGNLTAVSLLKAVILINRGKCLKYIGNKSYNHLELIFMALYLAQDSHDS 151

Query: 141 VKEMSSLPNSNDSLDAPKVIATFNNVAE--EELVVPAXXXXXXXXXXXXXSKATVIKNSR 198
            K+ S  P    +++  KVI++++  ++   E+ V A             S      NS+
Sbjct: 152 TKKESYDPKEPHNIE--KVISSYDGNSDCVSEITVQADNLLQFTTMLLLLSARIPRPNSQ 209

Query: 199 LDVNISEK-WDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPLE 257
           +D+  ++  W  ++  A +++RTMN+ I++S     + IS+ QF +VIS + P +L  L+
Sbjct: 210 IDLKTADNDWAKYEKSAYNVIRTMNSSIISS--CQTHTISFHQFYDVISILLPTILTTLD 267

Query: 258 CLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLA-TVWPRELVFSRLQKLYVGRDS 316
            L++H+L+    LVD  A  P   ++K++     A L   +  +    S+LQKLYVGRDS
Sbjct: 268 NLLQHLLYTPDQLVDHTALGPTFTETKVMNHGSFALLQFALADKGYPISKLQKLYVGRDS 327

Query: 317 GFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHILP 376
           GFSMRSFQ K F W AP++L V GSRI DD DY+KNKN RY KFL+++ +L+D DQ + P
Sbjct: 328 GFSMRSFQGKVFHWHAPTLLFVSGSRIQDDDDYSKNKNPRYSKFLEDFRKLRDTDQQLSP 387

Query: 377 ALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLXXXX 436
            L  KRK++F I I  PW+VTN + F   +TTI QLSP  +++KA++   VYFNT+    
Sbjct: 388 CLLKKRKVMFVIYIESPWRVTNKDYFSAGRTTIFQLSPELDIFKANRDDVVYFNTMGGGI 447

Query: 437 XXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS------------NT 484
                         ++ PGN+SLT+D +LEF AFRNVG GG   P              +
Sbjct: 448 GIGDTQPYTKVNYREYRPGNISLTLDSSLEFGAFRNVGPGGMFEPGALFTRRNGDGVVTS 507

Query: 485 PTSEHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGL 544
            + E +FLIQD+E WGCGGEKEL EQMK              +NLKS+++DRALLE+AGL
Sbjct: 508 NSYELRFLIQDVEVWGCGGEKELSEQMKQLQWEETEAKRRQHVNLKSLSEDRALLEMAGL 567

Query: 545 VGQNQSGGSV 554
           VGQ+QSGGS+
Sbjct: 568 VGQHQSGGSI 577

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  346 bits (887), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/547 (36%), Positives = 297/547 (54%), Gaps = 18/547 (3%)

Query: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAA--LNRKELMRVLRLQNANEAV 75
           F   + L+++++ +AL+ +S  E  ++  NI GK ++    L+ + L  +  +       
Sbjct: 19  FTDRDALIAFFNARALRQLSAVEQWAFHQNI-GKNIEPTEELDLQALATLYGVPADVPWF 77

Query: 76  EGLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISL 135
             + +  V  L +FPL+ DC    TYMG+LK C+L NK R   Y   K Y+   LV   L
Sbjct: 78  TEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAARYTARKSYDVASLVLALL 136

Query: 136 ALNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVIK 195
           A  +      +   + D  D  K+I T +     EL V               S+     
Sbjct: 137 APPR-----DACDENVDQFDGDKLIDTLDGTFIAELEVRPNKLVRYSPFIAQISQVCNGS 191

Query: 196 NSRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVP 255
           N  L  ++   W+      L++LR++++ I++  DA    I+Y QF   + SV PN+   
Sbjct: 192 NEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVFPNVFDA 251

Query: 256 LECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRD 315
           L   +E + ++ RD  +     P    S +VT  LL QL+T++PR  +F+ +Q+L+V  D
Sbjct: 252 LGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSMQRLFVAGD 311

Query: 316 SGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHIL 375
           +GFSM  FQAK FKWMAP+IL V G+RI DD+     KN+RYK FL +YP LKD +Q + 
Sbjct: 312 AGFSMSVFQAKVFKWMAPTILFVSGTRIQDDE-IVCTKNKRYKAFLQDYPALKDAEQQLA 370

Query: 376 PALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLXXX 435
                KR L++AI + +PWK+TN +LFGD+ TTI+QL+P Q+++KA +  N+YFN +   
Sbjct: 371 LCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPNIYFNAVGGG 430

Query: 436 XXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSI-------APSNTPTS- 487
                          ++ PGNVS T+DP++EFA FRNVG GG         AP+  P S 
Sbjct: 431 IGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAPAEQPLSY 490

Query: 488 EHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGLVGQ 547
           EH+ +I+D+E WG GGE+EL++Q++              I     N+DRALLE+AG+VG 
Sbjct: 491 EHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLEMAGIVGH 550

Query: 548 NQSGGSV 554
            QSGGSV
Sbjct: 551 YQSGGSV 557

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/547 (32%), Positives = 304/547 (55%), Gaps = 19/547 (3%)

Query: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76
            F++ +++L +++ + +KL +  E+ ++K   +   L+  ++   +   L L +A   V 
Sbjct: 19  QFKTRDEILQYFNTRVVKLFTVTEIAAFKKRFNAIDLNEPIDDTLIKEALYL-DAQPNVW 77

Query: 77  GLLFNCVQTLANFPLIKD-CYENVTYMGVLKSCVLLNKNRCLEYVQDK--RYNHTKLVYI 133
             +   ++ L NFPL      +++T  G+LK   ++N  R  + V     RY+ T    +
Sbjct: 78  SAVSETIRLLQNFPLFHQPIADSITGFGLLKVIAIINVKRFEKLVNTTITRYDIT----V 133

Query: 134 SLALNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATV 193
           +L L    KE     N   S +   ++ T++++  E + +P                   
Sbjct: 134 TLGLCGQAKESE---NKIKSTNLGDILKTYDHIEIESIHIPYDKLILLVAWLLTLVTGVA 190

Query: 194 IKNSRLDVNIS-EKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNL 252
             N +++++ +   W++FK+ A+SI  T++T  L + + +   I  T   N  +++  +L
Sbjct: 191 TTNCKVELSDTIANWNNFKSSAISIANTISTSALGNANDIG--IPATDILNAFNTIMISL 248

Query: 253 LVPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYV 312
           +  +  L EH+LF   DL+D       +    ++T  L AQ+    P  +  ++LQKLYV
Sbjct: 249 VPYMSNLFEHLLFGVDDLIDHVNDLANLSHQDVLTPSLYAQVIIGLPNSITITKLQKLYV 308

Query: 313 GRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQ 372
           G++SGFSMRS Q+K F+W AP++++V G+RI DD+ YA +KN RY+ FL  +P+L++ DQ
Sbjct: 309 GKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDESYADSKNPRYRSFLYSFPKLRENDQ 368

Query: 373 HILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTL 432
           ++      K+K+ +A+ I+EPWKV+N E FG    TI++L+P Q+ Y++     +YFNT+
Sbjct: 369 NLDAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMTIMELTPQQKTYQSCMERTMYFNTI 428

Query: 433 XXXXXXXXXXXXXXXXXVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS-----NTPTS 487
                            +KF+PGN+SLT+D +LEF  FR+VG GG    S     ++ + 
Sbjct: 429 GGGIGVGSEQPIVKQNDIKFIPGNISLTMDSSLEFGVFRHVGAGGGFKTSLLDNDDSKSF 488

Query: 488 EHKFLIQDIETWGCGGEKELEEQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGLVGQ 547
           E +F+IQ++E WGCGGEKEL EQ+K              INL+S+++D+ALLE+ GLVGQ
Sbjct: 489 EIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAEAKRRQTINLQSLSEDKALLEMVGLVGQ 548

Query: 548 NQSGGSV 554
           +QSGGSV
Sbjct: 549 HQSGGSV 555

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  209 bits (533), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 160/519 (30%), Positives = 250/519 (48%), Gaps = 57/519 (10%)

Query: 34  KLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEGLLFNCVQTLANFPLIK 93
           ++ +  EL++++  I+ + LD  ++ KE+++   + ++   ++ L    ++ L  +P   
Sbjct: 23  EIFTVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYPSND 81

Query: 94  DCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLALNKAVKEMSSLPNSNDS 153
           +     +Y+ ++    LLNK R     ++K +   K+ +I +       E    P    +
Sbjct: 82  NIITGYSYLKII---TLLNKKR-----RNKMF--PKIEWIKIIFMCLSDEEVQFPCWETT 131

Query: 154 LDAPKVIATFNNVAEEELVVPAXXXXXXXXXXXXXSKATVIKNSRLDVNISEKWDSF-KT 212
            D         +V E +L+                     + N  L  N    WD++ + 
Sbjct: 132 HDI--------HVLENDLI---EFISLLLTLNMNCCTDYCLINQDLTFN-DHDWDTYWRK 179

Query: 213 CALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPLECLMEHVLFLNRDLVD 272
            A  I+R M               +  +F+NV+  + PN+   L+ L+EH L+    L +
Sbjct: 180 SASCIVRDMKE------------CNVEEFENVLL-IVPNIFDCLKNLIEHSLYTKDQLKE 226

Query: 273 LEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDSGFSMRSFQAKAFKWMA 332
                    ++K+    L   L ++  R +  S   KLY+GR++G+SMRSFQ+K FKW A
Sbjct: 227 CPLGPSQFTKTKMNQAILCQILLSMRKRSMDIS---KLYIGRENGYSMRSFQSKVFKWKA 283

Query: 333 PSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHILPALSGKRKLLFAILINE 392
           P+ILL+ G +I +DQ+Y++ KN RYK FL+ YPRLKD        L       FAI I E
Sbjct: 284 PTILLITGKKIINDQEYSE-KNNRYKSFLNSYPRLKDGKTTFQTPLH----YTFAIYIEE 338

Query: 393 PWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLXXXXXXXXXXXXXXXXXVKF 452
           PWK+T    FG + T I+QLSP Q+V+  + P  VYF+T                   K+
Sbjct: 339 PWKMTKG-YFGGLHTKIIQLSPRQDVFTCTDPNAVYFHTQNGIGIGNEHMSSDN----KY 393

Query: 453 VPGNVSLTIDPNLEFAAFRNVGFG----GSIAPSNTPTSEHKFLIQDIETWGCGGEKELE 508
            PGNVS+TID  LEFA FR+ G G    G IA  N    E +  IQ +E WGCGG KEL 
Sbjct: 394 KPGNVSITIDSTLEFAVFRHSGPGVFKTGIIA--NQEIFEIRLHIQSVEVWGCGGAKELA 451

Query: 509 EQMKNXXXXXXXXXXXXXINLKSVNDDRALLELAGLVGQ 547
           EQ                +++  V +DRALLELAG++G+
Sbjct: 452 EQKHEWEWEEREAQRRQHVSM-HVTEDRALLELAGIIGE 489

>SAKL0B10516g Chr2 (906415..910392) [3978 bp, 1325 aa] {ON} similar
           to uniprot|P22023 Saccharomyces cerevisiae YOR336W KRE5
           Protein required for beta-1 6 glucan biosynthesis
           mutations result in aberrant morphology and severe
           growth defects
          Length = 1325

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 70  NANEAVEGLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYN--H 127
           N+  +V G+L    Q + N   I D + + TY  +  + +    +R +EY +D  YN  H
Sbjct: 584 NSELSVRGILHLKSQEVRNLKYIPDHFSDATYTTMDNTALKTLGSRIVEYTKDGAYNLLH 643

Query: 128 TKLVYISLALNKAVKEMSSL 147
           T  V        A+K++ +L
Sbjct: 644 TVTVVDDFNTKSALKKLINL 663

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {ON}
           Anc_2.649 YKL012W
          Length = 583

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 327 AFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKD 369
           A + +A  ILL  G RIPD     ++++   K +L + PRLKD
Sbjct: 418 AHRLVADQILLDNGFRIPDSSSKVQDEHTTVKNYLTQDPRLKD 460

>KLTH0D07106g Chr4 complement(621467..624595) [3129 bp, 1042 aa]
           {ON} similar to uniprot|P36097 Saccharomyces cerevisiae
           YKL033W Protein of unknown function localized to the
           cytoplasm.
          Length = 1042

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 14/94 (14%)

Query: 263 VLFLNRDLVDL-EASKPLIPQSKLVTEPLLAQ----LATVWPRELVFSRLQKL--YVGRD 315
           ++ + +D + L E S+PL+P+     E  L+Q    L T + R+ +   + +L  + G +
Sbjct: 459 MVIVGQDFLTLTETSQPLLPKISTALEETLSQLLHTLGTCYSRDHIQGTVSELLTFDGSE 518

Query: 316 SGFSMRSFQAKAFK-WMAPSILLVQGSRIPDDQD 348
           SGF       KA   WM+ ++L      +PD  D
Sbjct: 519 SGF------GKAVSLWMSANLLKAASEVLPDAHD 546

>NCAS0E02300 Chr5 (448033..452058) [4026 bp, 1341 aa] {ON} Anc_7.57
           YOR336W
          Length = 1341

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 2/77 (2%)

Query: 54  DAALNRKELMRVLRLQNANEAVEGLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNK 113
           D +  + EL RV+R  + N  V  LL      L +     D + +  Y  +  S +   K
Sbjct: 586 DVSFIKSELKRVMRGSSNNNDVRALLHMKSANLRHNKYTPDYFSDSLYTVMNNSMLSSEK 645

Query: 114 NRCLEYVQDKRYN--HT 128
            R +EY+  + YN  HT
Sbjct: 646 ERIIEYIGSETYNTLHT 662

>SAKL0D12210g Chr4 complement(1009364..1011313) [1950 bp, 649 aa]
           {ON} similar to uniprot|P39682 Saccharomyces cerevisiae
           YML046W PRP39 U1 snRNP protein involved in splicing
           contains multiple tetriatricopeptide repeats
          Length = 649

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 42/96 (43%), Gaps = 12/96 (12%)

Query: 323 FQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHILPALSGKR 382
           F+ +  +W   S +    S IP  Q YAK     YK FL E+P L  + + I    +  +
Sbjct: 186 FETEQKQWANVSQVYQAVSMIPLHQ-YAKYYT-GYKAFLQEHPELAGDVKDIDNTFANTQ 243

Query: 383 KLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEV 418
           +     L+N  WK         IK T   L+P+ E+
Sbjct: 244 Q-----LVNSVWKYE-----SQIKQTFFNLTPLNEI 269

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,423,812
Number of extensions: 2238359
Number of successful extensions: 6031
Number of sequences better than 10.0: 28
Number of HSP's gapped: 6116
Number of HSP's successfully gapped: 28
Length of query: 554
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 439
Effective length of database: 40,294,809
Effective search space: 17689421151
Effective search space used: 17689421151
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)