Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F16104g5.432ON54049424180.0
Kwal_55.214335.432ON47639417800.0
SAKL0G02486g5.432ON50039416510.0
YOR119C (RIO1)5.432ON48439815940.0
AER257W5.432ON47739415910.0
Skud_15.2825.432ON48539815820.0
Smik_15.2975.432ON48639815750.0
Suva_8.1725.432ON48639815680.0
KLLA0E21121g5.432ON52642615620.0
KAFR0E039205.432ON49741415550.0
Kpol_1062.315.432ON51342615490.0
Ecym_47635.432ON53840315400.0
TDEL0E019305.432ON50238315330.0
TBLA0A037605.432ON50441215320.0
CAGL0L11594g5.432ON50740015210.0
KNAG0C049305.432ON49640915040.0
TPHA0E017805.432ON50842215020.0
NCAS0F033605.432ON50943114970.0
NDAI0B056505.432ON46237814410.0
ZYRO0F09988g5.432ON46037112711e-171
TPHA0H009202.44ON4292321278e-07
NCAS0G015802.44ON4243001223e-06
CAGL0H08019g2.44ON4252441205e-06
Suva_14.1362.44ON4262291205e-06
Smik_14.1252.44ON4202291205e-06
Kwal_23.45632.44ON4252331143e-05
Skud_14.1292.44ON4252291134e-05
NDAI0F036002.44ON4212281108e-05
KLTH0B07722g2.44ON4282331108e-05
SAKL0E13552g2.44ON4192421108e-05
KAFR0A077602.44ON4252291081e-04
ZYRO0C10340g2.44ON4162331036e-04
TDEL0A008602.44ON4192421037e-04
Kpol_400.72.44ON425300990.002
KLLA0D19008g2.44ON422228880.035
KLLA0F15576g5.200ON51251780.72
Ecym_11191.104ON79149761.2
TDEL0B034208.768ON489177761.2
Suva_4.5351.336ON527202742.0
YBR274W (CHK1)1.336ON527199732.9
Skud_12.2238.365ON33367713.6
KLTH0A00902g7.533ON32449696.5
Smik_12.2198.365ON34067688.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F16104g
         (540 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   936   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   690   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   640   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   618   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   617   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   613   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   611   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   608   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   606   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   603   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   601   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   597   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   595   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   594   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   590   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   583   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   583   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   581   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   559   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   494   e-171
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    54   8e-07
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      52   3e-06
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    51   5e-06
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    51   5e-06
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    51   5e-06
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    49   3e-05
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    48   4e-05
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    47   8e-05
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    47   8e-05
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    47   8e-05
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    46   1e-04
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    44   6e-04
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    44   7e-04
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    43   0.002
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    39   0.035
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    35   0.72 
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    34   1.2  
TDEL0B03420 Chr2 complement(609095..610564) [1470 bp, 489 aa] {O...    34   1.2  
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    33   2.0  
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    33   2.9  
Skud_12.223 Chr12 complement(425424..426425) [1002 bp, 333 aa] {...    32   3.6  
KLTH0A00902g Chr1 (91636..92610) [975 bp, 324 aa] {ON} highly si...    31   6.5  
Smik_12.219 Chr12 complement(424268..425290) [1023 bp, 340 aa] {...    31   8.0  

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/494 (91%), Positives = 454/494 (91%)

Query: 1   MAYILSECVERGIEITNLLVKNFKKLIAIRFPVKRDLKRSSRATAPARDHCKMSLEDGLG 60
           MAYILSECVERGIEITNLLVKNFKKLIAIRFPVKRDLKRSSRATAPARDHCKMSLEDGLG
Sbjct: 1   MAYILSECVERGIEITNLLVKNFKKLIAIRFPVKRDLKRSSRATAPARDHCKMSLEDGLG 60

Query: 61  KLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENVLDPRTMRF 120
           KLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENVLDPRTMRF
Sbjct: 61  KLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENVLDPRTMRF 120

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAIKIYKT 180
           LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAIKIYKT
Sbjct: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAIKIYKT 180

Query: 181 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVK 240
           SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVK
Sbjct: 181 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVK 240

Query: 241 SNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYN 300
           SNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYN
Sbjct: 241 SNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYN 300

Query: 301 TIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDK 360
           TIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDK
Sbjct: 301 TIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDK 360

Query: 361 LEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLG 420
           LEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLG
Sbjct: 361 LEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLG 420

Query: 421 KFDLLKSLIAHDNQKVASNFTASEQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
           KFDLLKSLIAHDNQKVASNFTASEQY                                  
Sbjct: 421 KFDLLKSLIAHDNQKVASNFTASEQYELSSSSDEEVSEDEDYNESGSGSEDDDGDDESGE 480

Query: 481 XXXXXXWLEKSKEI 494
                 WLEKSKEI
Sbjct: 481 SSDEEEWLEKSKEI 494

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/394 (82%), Positives = 362/394 (91%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MSL+D +  L L +      DHINTQILDKHAHNIK DELSV+R KTSKDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERRE 172
           LDPRTMRFLQAL SRGVIS+FNGC+STGKEANVYHAFA  GAK++EE  +VLPN  ERRE
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE 120

Query: 173 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVP 232
            AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSG+VP
Sbjct: 121 LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP 180

Query: 233 APEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLV 292
           APEP+EV+SNVLVMEFL+RG+GFASP+LKD+PYKDR+ET +YY+TMVAYIRLLYQCCQLV
Sbjct: 181 APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV 240

Query: 293 HADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAI 352
           HADLSEYN IVHN++LY+IDVSQSVQPEHPMSLDFLRMDIKN+N+YFERMS+D+FPER I
Sbjct: 241 HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI 300

Query: 353 FQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEER 412
           FQFVIS+ L+KF G+YT++ DLR YV+K L  KSGP+DEAEDEVFRSLHLVRNLGGLEER
Sbjct: 301 FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER 360

Query: 413 DFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446
           DFDRFTLGKFDLLKSLIAHDN++VAS FTASEQ+
Sbjct: 361 DFDRFTLGKFDLLKSLIAHDNERVASTFTASEQF 394

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/394 (77%), Positives = 346/394 (87%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MS+E    KL L +     RDH+N++ILDK++H IKTDELS+TR KT+KDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERRE 172
           LDPRTMRFL+ L SRGV+S+ NGCLSTGKEANVYHAFAG   + SEE +K   ++  +RE
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKRE 120

Query: 173 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVP 232
           YA+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QSGV+P
Sbjct: 121 YAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIP 180

Query: 233 APEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLV 292
            P+PIEV+SNVLVMEFLNRG+GFASP+LKD PYKDR+E  YYYHTMVAY+RLLYQ CQLV
Sbjct: 181 CPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLV 240

Query: 293 HADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAI 352
           HADLSEYNTIVH+ +LY+IDVSQSVQPEHPMSLDFLRMDIKNINSYFE+  IDIFPER I
Sbjct: 241 HADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVI 300

Query: 353 FQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEER 412
           FQF+IS+ L+KF+G+Y N +DLR YV+K L  KS  EDEAEDEVFRSLHLVRNL GLEER
Sbjct: 301 FQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEER 360

Query: 413 DFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446
           DFDRFT GKFDLLKSLIAHDN+K A+NF ASEQ+
Sbjct: 361 DFDRFTDGKFDLLKSLIAHDNKKNATNFNASEQF 394

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/398 (75%), Positives = 343/398 (86%), Gaps = 10/398 (2%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MSLED    LS+ +  GA  DHIN Q+L+K++H IKTDELS +RAKTSKDKANRATVENV
Sbjct: 1   MSLEDKFDSLSVSQ--GAS-DHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENV 57

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQ----KVLPNQG 168
           LDPRTMRFL+++ +RGVI++ NGCLSTGKEANVYHAFAG G     +E+    +VL   G
Sbjct: 58  LDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117

Query: 169 ERREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 228
            R EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS
Sbjct: 118 SRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177

Query: 229 GVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQC 288
           GV+PAP+PIEVK+NVLVMEFL+RG+GFASPKLKD+PYK+RDE  +YYHTMVAY+RLLYQ 
Sbjct: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQV 237

Query: 289 CQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFP 348
           C+LVHADLSEYNTIVH+ KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M I IFP
Sbjct: 238 CRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297

Query: 349 ERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGG 408
           ER IFQFVIS+ LEKF+G+Y N   L  Y+A  L  KS  +DEAEDE+FRSLHLVR+LGG
Sbjct: 298 ERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 409 LEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446
           LEERDFDR+T GKFDLLKSLIAHDN++   NF ASEQ+
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQF 392

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/394 (75%), Positives = 334/394 (84%), Gaps = 15/394 (3%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           M LED L KL L +    D DH NT+IL+K A+ IKTDELS+T+ KT+KDKANRATVENV
Sbjct: 1   MDLEDQLRKLKLRD----DTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENV 56

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERRE 172
           LDPRTMRFL+AL +RGV+SEFNGCLSTGKEANVYHA +G    + E           + E
Sbjct: 57  LDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPE-----------KSE 105

Query: 173 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVP 232
           YA+KIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRIYQSGV+P
Sbjct: 106 YAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIP 165

Query: 233 APEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLV 292
            P+P+E+KSNVLVMEFLNRGDGFASP+LKD+P+KDRDE  +YYH MV+YIRLLYQ CQLV
Sbjct: 166 CPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLV 225

Query: 293 HADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAI 352
           HADLSEYN+IVH  KLY+IDVSQSVQPEHPMSLDFLRMDIKNIN YFERM IDIFPER I
Sbjct: 226 HADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVI 285

Query: 353 FQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEER 412
           FQFVIS+ L+KF G+  +AEDLR YVA  L  K   +DEAED+VFRSLHLVRNLGGLEER
Sbjct: 286 FQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEER 345

Query: 413 DFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446
           DFDRFT GKFDLLKSLIA DN K+++ FTASEQY
Sbjct: 346 DFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQY 379

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/398 (73%), Positives = 345/398 (86%), Gaps = 10/398 (2%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MSLED   +L++ ++     DHIN Q+L+K++H IKTDELS ++AKTSKDKANRATVENV
Sbjct: 1   MSLEDRFDRLTVSQRAS---DHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENV 57

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQ----KVLPNQG 168
           LDPRTMRFL+++ +RGVI++ NGCLSTGKEANVYHAFAG G     +E+    +VL   G
Sbjct: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117

Query: 169 ERREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 228
            R+EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QS
Sbjct: 118 LRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 177

Query: 229 GVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQC 288
           GV+PAP P+EVK+NVLVMEFL+RG+GFASPKL+D+PY+DR+E  +YYHTMVAY+RLLYQ 
Sbjct: 178 GVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQV 237

Query: 289 CQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFP 348
           C+LVHADLSEYNTI+HN KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M + IFP
Sbjct: 238 CRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFP 297

Query: 349 ERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGG 408
           ER IFQFVIS+ LEKF+G+Y N  DL  Y+AK L  KS  +DEAEDE+FRSLHLVR+LGG
Sbjct: 298 ERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 409 LEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446
           LEERDFDR+T GKFDLLKSLIAHDN++   NF ASEQ+
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQF 392

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/398 (74%), Positives = 342/398 (85%), Gaps = 10/398 (2%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MSLED   KL++ ++     DHIN Q+L+K++H IKTDELS  RAKTSKDKANRATVENV
Sbjct: 1   MSLEDNFDKLTVSQRAS---DHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENV 57

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQ----KVLPNQG 168
           LDPRTMRFL+++ +RGVI++ NGCLSTGKEANVYHAFAG G     +E+    +VL   G
Sbjct: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDG 117

Query: 169 ERREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 228
            R EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS
Sbjct: 118 PRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177

Query: 229 GVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQC 288
           GV+PAP+PIEVK+NVLVMEFL+RG+GFASPKLKD+PY+DR E  +YY+TMVAY+RLLYQ 
Sbjct: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQV 237

Query: 289 CQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFP 348
           C+LVHADLSEYNTI+H+ KL++IDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M I IFP
Sbjct: 238 CRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297

Query: 349 ERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGG 408
           ER IFQFVIS+ LEKF+ +Y N  DL  Y+AK L  KS  +DEAEDE+FRSLHLVR+LGG
Sbjct: 298 ERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 409 LEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446
           LEERDFDR+T GKFDLLKSLIAHDN++   NF ASEQ+
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQF 392

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/398 (73%), Positives = 344/398 (86%), Gaps = 10/398 (2%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MS ED   KL++ ++     DHIN Q+LDK +H IKTDELS ++AKTSKDK+NRATVENV
Sbjct: 1   MSFEDKFEKLTVSQRAS---DHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENV 57

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQ----KVLPNQG 168
           LDPRTMRFL+++ +RGVI++ NGCLSTGKEANVYHAFAG G     +E+    +VL   G
Sbjct: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVVDEETGKYEVLETDG 117

Query: 169 ERREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 228
            R EYAIKIYKTSILVFKDRE+YVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLKRI+QS
Sbjct: 118 LRAEYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIHQS 177

Query: 229 GVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQC 288
           GV+PAP+P+EVK+NVLVMEFL+RGDGFASPKLKD+PYKDR+E  +YY+TMVAY+RLLYQ 
Sbjct: 178 GVIPAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFHYYYTMVAYMRLLYQV 237

Query: 289 CQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFP 348
           C+LVHADLSEYNTI+H+ +LY+IDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M I+IFP
Sbjct: 238 CRLVHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGINIFP 297

Query: 349 ERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGG 408
           ER IFQFVIS+ LEKF+G+Y N  DL  Y++K L  KS  +DEAEDE+FRSLHLVR+LGG
Sbjct: 298 ERVIFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 409 LEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446
           LEERDFDR+T GKFDLLKSLIAHDN++   NF ASEQ+
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQF 392

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/426 (70%), Positives = 352/426 (82%), Gaps = 37/426 (8%)

Query: 53  MSLEDGLGKLSLHEKHGADRD-HINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVEN 111
           M+++D L KL+L     A+RD H+NTQIL+++A++IKTDELS+TR KTSKDKANRATVEN
Sbjct: 2   MNIDDKLEKLNL-----ANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVEN 56

Query: 112 VLDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAG---------------YGAKS 156
           VLDPRTMRFL+++ +RG++S FNGCLSTGKEANVYHAFAG                GA  
Sbjct: 57  VLDPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQ 116

Query: 157 SEE--EQKVLPNQGE--------------RREYAIKIYKTSILVFKDRERYVDGEFRFRN 200
           + E  +QK L  + E              ++EYA+KIYKTSILVFKDRERYVDGEFRFRN
Sbjct: 117 NIESTKQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRN 176

Query: 201 SRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKL 260
           SRSQHNPRKMIKIWAEKEFRNLKRIYQSGV+P P+PIEV+SNVLVMEFLNRGDGFASP+L
Sbjct: 177 SRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRL 236

Query: 261 KDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPE 320
           KD PYKDR+E  +YY+ M+AY+RLLYQ C+LVHADLSEYN+IVH  KLY+IDVSQSVQPE
Sbjct: 237 KDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPE 296

Query: 321 HPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAK 380
           HPMSLDFLRMDIKN+NSYF+++ IDIFPER IFQF+IS+ L+KF+G+Y +++DL  YVA 
Sbjct: 297 HPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVAD 356

Query: 381 TLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNF 440
            L  K   EDEAEDEVFRSLHL+RNLGGLEERDFDRFT GKFDLLKSLIA++N+K + NF
Sbjct: 357 NLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENF 416

Query: 441 TASEQY 446
           TASEQY
Sbjct: 417 TASEQY 422

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/414 (71%), Positives = 341/414 (82%), Gaps = 24/414 (5%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MS+ED    L +    G+  DHIN QILDK+ H IKT+E S++R KT+KDKANRATVENV
Sbjct: 1   MSIEDKFDNLKISGGRGSS-DHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENV 59

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSE-----EEQKVLP-- 165
           LDPRTM+FLQAL SRGVIS F+GCLSTGKEANVYHAFAG G  + +     +E+  +P  
Sbjct: 60  LDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVD 119

Query: 166 ------------NQGERRE-YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK 212
                       N  +RRE YAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIK
Sbjct: 120 PSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIK 179

Query: 213 IWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETL 272
           IWAEKEFRNLKRIYQS V+PAP+PIE+K+NVLVMEFLNRGDGFASP+LKD PYKDR+E  
Sbjct: 180 IWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIF 239

Query: 273 YYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDI 332
           +YYHT+VAYIRLLYQ C LVHADLSEYNT+VH  +LYVIDVSQSV+PEHPMSLDFLRMDI
Sbjct: 240 HYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDI 299

Query: 333 KNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEA 392
           KN+N YFE+M IDIFPER IFQFVIS+ L+KF G+Y +++DLR YV + L  K+  +DEA
Sbjct: 300 KNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEA 359

Query: 393 EDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446
           EDE+FRSL+LVRNL GLEERDFDR+T G+FDLLKSL+AHDN+K   NF ASEQY
Sbjct: 360 EDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEK---NFAASEQY 410

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/426 (70%), Positives = 341/426 (80%), Gaps = 41/426 (9%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MS ++   +L +    G D   +NT+IL+K+ H IKTDELS T+ KT+KDKANRATVENV
Sbjct: 1   MSFDEKFDRLKIS---GND---VNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENV 54

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKS---------------- 156
           LDPRTMRFL+AL +RGVIS FNGCLSTGKEANVYHAFAG G  S                
Sbjct: 55  LDPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSV 114

Query: 157 -----SEEEQKVLPNQGE-----------RREYAIKIYKTSILVFKDRERYVDGEFRFRN 200
                SEE+     N  +           R+EYAIKIYKTSILVFKDRERYVDGE+RFRN
Sbjct: 115 EVNQDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRN 174

Query: 201 SRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKL 260
           SRSQHNPRKMIKIWAEKEFRNL+RI+QSGV+PAP+P+EVKSNVLVMEFLNRG+GFASP+L
Sbjct: 175 SRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRL 234

Query: 261 KDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPE 320
           KD+PYKDRDE  +YYH +VAY+RLLYQ C+LVHADLSEYNTIVH  KLY+IDVSQSV+PE
Sbjct: 235 KDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPE 294

Query: 321 HPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAK 380
           HPMSLDFLRMDIKN+N YFE+M IDIFPER IFQFVIS+KLE F+G+  +A+DLR++V  
Sbjct: 295 HPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKN 354

Query: 381 TLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNF 440
            L  KS  EDEAEDEVFRSLHLVRNLGGLEERDFDRFT GKFDLLK+LIA DNQK   NF
Sbjct: 355 NLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQK---NF 411

Query: 441 TASEQY 446
           TASEQY
Sbjct: 412 TASEQY 417

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/403 (72%), Positives = 338/403 (83%), Gaps = 14/403 (3%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           M LE+ LG+L L +      +H N++ILDK A+ IKTDELSVTR KTSKDKANRATVENV
Sbjct: 33  MDLENKLGRLKLLDH----SEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENV 88

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVL-------P 165
           LDPRTMRFL++L  RG+I+EFNGCLSTGKEANVYHAF G      E++ KV+        
Sbjct: 89  LDPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-GNAVDIVEKQHKVIRQSSICSD 147

Query: 166 NQGERR--EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK 223
           ++G+ +  EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK
Sbjct: 148 SEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK 207

Query: 224 RIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIR 283
           RIY +GV+  P+PIE+KSNVLVMEFLNRGDGFASPKLKD+PY DR E  Y+YH MVAYIR
Sbjct: 208 RIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIR 267

Query: 284 LLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMS 343
           LLYQ CQLVHADLSEYN+IVH  KLY+IDVSQSVQPEHPMSLDFLRMDIKNIN+YF ++ 
Sbjct: 268 LLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIG 327

Query: 344 IDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLV 403
           I++F ERAIFQFVIS+KLEKF+G+Y + + L++Y ++ L  K   EDE EDE+FRSLHLV
Sbjct: 328 INVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLV 387

Query: 404 RNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446
           RNLGGLEE DFDRFT GKFDLLKSL++ DNQKVA  FTASEQ+
Sbjct: 388 RNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQF 430

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/383 (75%), Positives = 330/383 (86%), Gaps = 8/383 (2%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MSLED   +L +   HG  R+H N QILDKH++NIKTDELS TR+K+SKDKANRATVENV
Sbjct: 1   MSLEDQFDRLDI--SHG--REHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENV 56

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERRE 172
           LDPRTMRFL+++ +RGVISEFNGCLSTGKEANVYHAFAG   + S++       QGE++E
Sbjct: 57  LDPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHV----QGEKKE 112

Query: 173 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVP 232
            AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI QSGV+P
Sbjct: 113 LAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIP 172

Query: 233 APEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLV 292
           AP+P+EVK+NVLVMEFL+RGDGFASP+LKD  + DR E  +YYHTM+AYIRLLYQ C+LV
Sbjct: 173 APKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLV 232

Query: 293 HADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAI 352
           HADLSEYN IVH+QKLY+IDVSQSV+PEHPMSLDFLRMDIKNIN+YFE+M IDIFPER I
Sbjct: 233 HADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLI 292

Query: 353 FQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEER 412
           FQFVIS+ LEKF+G   ++ DL  YV+K L  KS   D  EDE+FRSLHLVRNL GLEER
Sbjct: 293 FQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEER 352

Query: 413 DFDRFTLGKFDLLKSLIAHDNQK 435
           DFDRFT GKFDLLKSLIAHDN++
Sbjct: 353 DFDRFTDGKFDLLKSLIAHDNER 375

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/412 (70%), Positives = 334/412 (81%), Gaps = 27/412 (6%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           M L+D   KL L   H       N +ILDKH H IKTDE S++R KT+KDKANRATVENV
Sbjct: 1   MVLDDDFQKLDLSNNHD------NNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENV 54

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAG-----YGAKSSEEEQKVL--- 164
           LDPRTMRFL+AL SRG+IS+FNGC+STGKEANVYHAFAG     +  K+ +  + ++   
Sbjct: 55  LDPRTMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTY 114

Query: 165 -----PNQGE-----RREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIW 214
                PN  +     R+EYAIKIYKTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIW
Sbjct: 115 DPYSNPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIW 174

Query: 215 AEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYY 274
           AEKEFRNLKRIYQS V+P P+PIEVK+NVLVMEFLNRGDGFASP+LKD+PYKD ++ ++Y
Sbjct: 175 AEKEFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIVHY 234

Query: 275 YHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKN 334
           YHTM+ YIRLLYQ C+LVHADLSEYNT+VH  KLYVIDVSQSV+PEHPMSLDFLRMDIKN
Sbjct: 235 YHTMIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDIKN 294

Query: 335 INSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAED 394
           IN+YFERM + IF ER IFQF IS+ L+ F G Y+N +DLR YV   L  K   +D+AED
Sbjct: 295 INNYFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDAED 354

Query: 395 EVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446
           E+FRSLHLVRNLGGLEERDFDR+T GKFDLLKSLIAHDN+K   NF+ASEQY
Sbjct: 355 EIFRSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEK---NFSASEQY 403

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/400 (71%), Positives = 330/400 (82%), Gaps = 33/400 (8%)

Query: 73  DHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENVLDPRTMRFLQALKSRGVISE 132
           DHIN QI+DK+ H IKTDELS+ +AKT+KDKANRATVENVLDPRTMRFL AL +RGVI+ 
Sbjct: 16  DHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRTMRFLNALVNRGVIAG 75

Query: 133 FNGCLSTGKEANVYHAFAGYGAKSSEEEQ----------KVLPNQGE------------- 169
            NGCLSTGKEANVYHAFAG  +K + E+Q            +P++G              
Sbjct: 76  LNGCLSTGKEANVYHAFAG--SKMATEQQSDEPKEDIDANAIPSKGNIDISENRAKTAED 133

Query: 170 -----RREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKR 224
                R+EYAIKIYKTSIL+FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKR
Sbjct: 134 LIREGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKR 193

Query: 225 IYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRL 284
           IYQ GV+P+PEPIEVK+NVLVMEFLNRGDGFASPKL+D+PYKDR+E  YYYH +V+Y+RL
Sbjct: 194 IYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDREEIYYYYHILVSYMRL 253

Query: 285 LYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSI 344
           LYQ C+LVHADLSEYNTIVH +KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M I
Sbjct: 254 LYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGI 313

Query: 345 DIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVR 404
           +IF E+AIFQFVI+D L+KF+G+  + EDLR+YVA  +  K   EDEAEDEVFRSLHLVR
Sbjct: 314 EIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQEDEAEDEVFRSLHLVR 373

Query: 405 NLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASE 444
           NL GLEERDFDRFT GKFDLLKSL+A DN+K   N+ A++
Sbjct: 374 NLEGLEERDFDRFTDGKFDLLKSLLAQDNKK---NYIAAQ 410

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/409 (69%), Positives = 333/409 (81%), Gaps = 21/409 (5%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAK-TSKDKANRATVEN 111
           MS+E+   KLS+   H    D  N ++LDK+AH IK D+ S ++ K T+KDKANRATVEN
Sbjct: 1   MSVEEKFEKLSID--HHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVEN 58

Query: 112 VLDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYG---------------AKS 156
           VLDPRTMRFLQAL +RG+IS+FNGCLSTGKEANVYHAFAG G               A+ 
Sbjct: 59  VLDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARL 118

Query: 157 SEEEQKVLPNQGERREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 216
           ++EE+ V  + G ++EYAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE
Sbjct: 119 TQEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 178

Query: 217 KEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYH 276
           KEFRNLKRIYQSG VP P+P+EVK+NVLVMEFLNRGDGFASP+L+D+PYKD D    YY 
Sbjct: 179 KEFRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDSIRQYYC 238

Query: 277 TMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNIN 336
           T+VAY+RL+YQ C LVHADLSEYN +VHN +LY+IDVSQSVQPEHPMSLDFLRMDIKN+N
Sbjct: 239 TLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVN 298

Query: 337 SYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEV 396
            YF +M IDIFPER IFQFVIS+ L+KFEG+Y +++DL +YV   L  K   +DE EDEV
Sbjct: 299 LYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEV 358

Query: 397 FRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQ 445
           FRSL+LVRNL GLEERDFDRFT GKFDLLKSL+AHD +K   NFTA+EQ
Sbjct: 359 FRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEK---NFTAAEQ 404

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/422 (68%), Positives = 334/422 (79%), Gaps = 36/422 (8%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MSLE    KL +HE      +HIN++IL+K+ H IKTDELS T+ KT+KDKANRATVENV
Sbjct: 1   MSLEGKFDKLKVHES-----EHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENV 55

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEE------------ 160
           LDPRTM+ L+ L +RGVI EFNGCLSTGKEANVYHAFAG G      E            
Sbjct: 56  LDPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVL 115

Query: 161 -QKVLPNQGE---------------RREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 204
            ++++P Q E               R+EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQ
Sbjct: 116 NKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQ 175

Query: 205 HNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFP 264
           HNPRKMIKIWAEKEFRNL+RI+QSG++PAPEP+EVK N+LVMEFL RGDGFASP+L+D  
Sbjct: 176 HNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQ 235

Query: 265 YKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMS 324
           YK R+E +YYYHT+VAYIRLLYQ C+LVHADLSEYNTIVH+ KLYVIDVSQSV+PEHPMS
Sbjct: 236 YKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMS 295

Query: 325 LDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRP 384
           LDFLRMDIKN+N YFE+M IDIFPER IFQFVIS +L+KF G+  ++ DLR Y+A  L  
Sbjct: 296 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPV 355

Query: 385 KSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASE 444
           K   EDE +DE+FRSLHLVRNL GLEERDFDRFT GKFDLLK+LIA DNQK   NFTAS 
Sbjct: 356 KCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTAST 412

Query: 445 QY 446
           Q+
Sbjct: 413 QF 414

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/431 (67%), Positives = 338/431 (78%), Gaps = 42/431 (9%)

Query: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112
           MSLED   +L++  +   +  H N +ILDK+ H  KTDE+S TR+KT+KDKANRATVENV
Sbjct: 1   MSLEDKFDRLNISNEPRTE--HANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENV 58

Query: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAG---------YGAKSSEE---- 159
           LDPRTMRFL+AL SRGVIS+FNGCLSTGKEANVYHAFAG           AK  E+    
Sbjct: 59  LDPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDED 118

Query: 160 -------------------EQKVLPN-----QGERREYAIKIYKTSILVFKDRERYVDGE 195
                              E ++ P        +++EYA+KI+KTSILVFKDRERYVDGE
Sbjct: 119 ENEEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGE 178

Query: 196 FRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGF 255
           FRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSGV+P P+PIEVK+NVLVMEFL RGDGF
Sbjct: 179 FRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGF 238

Query: 256 ASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQ 315
           ASP+LKD PYKDR+E  +YYHT+VAY+RL+YQ C+LVHADLSEYN ++H  K+Y+IDVSQ
Sbjct: 239 ASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQ 298

Query: 316 SVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLR 375
           SV+PEHPMSLDFLRMDIKNIN YFE+M IDIFPER IFQF+ISD LE F G+Y +  DLR
Sbjct: 299 SVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLR 358

Query: 376 QYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQK 435
            YVA+ L  K   +DEAEDE+FRSL+LVRNL GLEERDFDR+T GKFDLLKSLIAHDN+K
Sbjct: 359 DYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEK 418

Query: 436 VASNFTASEQY 446
              NF+A+EQ+
Sbjct: 419 ---NFSAAEQF 426

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/378 (70%), Positives = 314/378 (83%), Gaps = 26/378 (6%)

Query: 92  LSVTRAKTSKDKANRATVENVLDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAG 151
           +S T+ KT+KDKANRATVENVLDPRTM+FL+AL SRGVIS+FNGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 152 YGAKSSEE-------------------EQKVLPN----QGERREYAIKIYKTSILVFKDR 188
                S++                   E ++ P     Q +++EYA+KI+KTSILVFKDR
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120

Query: 189 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEF 248
           ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS V+P P+PIEVK+NVL+MEF
Sbjct: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180

Query: 249 LNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKL 308
           LNRGDGFASP+L+D+PYKDR+E ++YYH  +AY+RL+YQ C+LVHADLSEYN ++HN  +
Sbjct: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240

Query: 309 YVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEY 368
           Y+IDVSQSV+PEHPMSLDFLRMDIKNIN YF+RM IDIFPER IFQF+IS+ L+KF G Y
Sbjct: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300

Query: 369 TNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSL 428
            +  DLR YVAKTL  K   +DEAEDE+FRSL+LVRNL GLEERDFDR+T GKFDLLKSL
Sbjct: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360

Query: 429 IAHDNQKVASNFTASEQY 446
           IAHDN+K   NF+A+EQ+
Sbjct: 361 IAHDNEK---NFSAAEQF 375

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  494 bits (1271), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 243/371 (65%), Positives = 292/371 (78%), Gaps = 23/371 (6%)

Query: 71  DRDHI-----NTQILDKHAHNIKTDELSVTRA-KTSKDKANRATVENVLDPRTMRFLQAL 124
           DR H+     NT+IL+K+ + I+    +  +  KT KDK++RATVENVLDPRTM+FL AL
Sbjct: 8   DRLHVSKHQDNTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVLDPRTMKFLSAL 67

Query: 125 KSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAIKIYKTSILV 184
            +RGVISEFNGC+S+GKEANVYHAF   G                 +E AIKIYKTSILV
Sbjct: 68  TNRGVISEFNGCISSGKEANVYHAFGPEG-----------------QELAIKIYKTSILV 110

Query: 185 FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVL 244
           FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+ SGVVP   P+EVKSNVL
Sbjct: 111 FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGVVPTACPVEVKSNVL 170

Query: 245 VMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIVH 304
           VM+FLNRGDG  SP+LKD+ YKD  E  +YY+  +AY+RLLYQ C+LVHADLSEYN +VH
Sbjct: 171 VMQFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCRLVHADLSEYNIVVH 230

Query: 305 NQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKF 364
              L++IDVSQSV+P HPMSLDFLRMDIKNIN+YF +M + +F ER IFQF+I++ LE F
Sbjct: 231 QNALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQERMIFQFIIAETLEGF 290

Query: 365 EGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDL 424
           +G+Y  A+DL +Y+ + L  K+  E   EDE+FRSLHLVR+LGGLEERDFDRFT GKFDL
Sbjct: 291 QGDYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGGLEERDFDRFTDGKFDL 350

Query: 425 LKSLIAHDNQK 435
           LKSLIA+DN++
Sbjct: 351 LKSLIANDNER 361

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 97/232 (41%), Gaps = 45/232 (19%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L++L ++  +    G +  GKE+++Y                     G +R   I ++ +
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEG---------------SDKNGNKRVLKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    K+   Y+      R S    N   + K+ A KE++ +  +Y  G    PEP + 
Sbjct: 130 TSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANKEYQFMSLLYTKG-FKVPEPFDN 182

Query: 240 KSNVLVMEFLNRGDGFASPKL---KDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADL 296
             +V+VME +    G+   +L   KD P          Y  ++ +I L      L+H D 
Sbjct: 183 SRHVIVMELIR---GYPMRRLRKHKDIP--------KLYSDLMKFI-LQLANSGLIHCDF 230

Query: 297 SEYNTIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER 341
           +E+N ++ ++          VID  Q +  +H  +  + + D+  I  +F++
Sbjct: 231 NEFNIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRFFKK 282

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/300 (20%), Positives = 122/300 (40%), Gaps = 57/300 (19%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L+ + +R  I    G +  GKE+++Y   A                 G  R   I ++ +
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSA---------------VDGNPRVMKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    ++   Y+      RN++   N   + ++ A KE++ +  +Y  G    PEP + 
Sbjct: 130 TSFHTVRNNRDYL------RNTKQGVNWMYLSRLAANKEYQFMSMLYTKG-FEVPEPFDN 182

Query: 240 KSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEY 299
             +++VME +    G+   +L+    K ++    Y   M   ++L      L+H D +E+
Sbjct: 183 SRHIIVMELIK---GYPMRRLR----KHKNIPKLYSDLMNFIVKL--GNSGLIHCDFNEF 233

Query: 300 NTIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER----------- 341
           N ++ ++          VID  Q +  +H  +  + + D+  I  +F++           
Sbjct: 234 NIMIKDKPEDENDCGFVVIDFPQCISIQHQDAAYYFQRDVDCIRRFFKKKLKYEPKSDSS 293

Query: 342 -MSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSL 400
            +  D F E   + + +      FE +    ++L + V  +   K  P D + +E   S+
Sbjct: 294 MLDTDGFGEGYKYAYPV------FERDIKRCDNLDELVQASGFSKKHPGDRSLEEAVESM 347

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 103/244 (42%), Gaps = 42/244 (17%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L+ L ++ V+      +  GKE+++Y               +V    G  +   I ++ +
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIY---------------QVSDRNGTAKVMKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    K+   Y+      RNSR   N   + K+ A KEF  +  +Y  G +  P+    
Sbjct: 130 TSFHTVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQAYGC 182

Query: 240 KSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEY 299
             +V+VM+ +   DG+   +L++     ++    Y   M   ++L      L+H D +E+
Sbjct: 183 SRHVVVMDLI---DGYPMRRLREH----KNIPKLYSDLMTFIVKL--ANSGLIHCDFNEF 233

Query: 300 NTIVHNQK---------LYVIDVSQSVQPEHPMSLDFLRMDIKNINSYF-ERMSIDIFPE 349
           N ++ N +           VID  Q +  +H  +  + + D+  I  +F +++  D  PE
Sbjct: 234 NIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKKKLKYDPQPE 293

Query: 350 RAIF 353
             + 
Sbjct: 294 AGML 297

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 97/229 (42%), Gaps = 39/229 (17%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L+ + +R  +      +  GKE+++Y               KV    G  R   I ++ +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIY---------------KVSDKDGNPRVIKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    ++   Y+      R S    N   + ++ A KE++ +  +Y  G    PEP + 
Sbjct: 130 TSFHTVRNNRDYL------RKSSQGANWMHLSRLAANKEYQFMSMLYSKGF-KVPEPFDN 182

Query: 240 KSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEY 299
             +++VME +N   GF   +L+    K ++    Y   M   ++L      L+H D +E+
Sbjct: 183 SRHIVVMELIN---GFPMRRLR----KHKNIPKLYSDLMCFIVQL--GNSGLIHCDFNEF 233

Query: 300 NTIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER 341
           N ++ ++          VID  Q V  +H  +  + + D+  I  +F++
Sbjct: 234 NVMIKDELEDENDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 98/229 (42%), Gaps = 39/229 (17%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L+ + +R  +      +  GKE+++Y               KV    G+ R   I ++ +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIY---------------KVSDKNGKPRVMKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    ++   Y+      RNS    N   + ++ A KE++ +  +Y  G    PEP + 
Sbjct: 130 TSFHSVRNNRDYL------RNSNQGANWMHLSRLAANKEYQFMSMLYSKGF-KVPEPFDN 182

Query: 240 KSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEY 299
             +++VME +   +G+   +L+    K ++    Y   M   + L      L+H D +E+
Sbjct: 183 SRHIVVMELI---EGYPMRRLR----KHKNIPKLYSDLMCFIVEL--ANSGLIHCDFNEF 233

Query: 300 NTIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER 341
           N ++ N+          VID  Q V  +H  +  + + D+  I  +F++
Sbjct: 234 NIMIKNEVEDEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 100/233 (42%), Gaps = 48/233 (20%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L+A+ +R  +      +  GKE++VY               +V    G  R   I ++ +
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVY---------------RVSAKDGTPRVLKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIYQSGVVPAPEPIE 238
           TS    K+   Y+         R+Q      + ++ A KE++ +  +Y  G V  PEP +
Sbjct: 130 TSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLYSKGFV-VPEPFD 180

Query: 239 VKSNVLVMEFLNRGDGFASPKL---KDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHAD 295
              ++++M+ +   DG+   ++   K+ P          Y  ++++I  L     L+H D
Sbjct: 181 NSRHMILMQLI---DGYPMRRMRSHKNLP--------KLYSDLMSFIVKLAN-HGLIHCD 228

Query: 296 LSEYNTIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER 341
            +E+N ++ N+          VID  Q +  +H  + ++ + D+  I  +F +
Sbjct: 229 FNEFNIMIKNKVTDADDCGFIVIDFPQCISIQHQDAEEYFKRDVDCIRRFFAK 281

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 97/229 (42%), Gaps = 39/229 (17%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L+ + +R  +      +  GKE+++Y               KV    G  R   I ++ +
Sbjct: 85  LKTMLNRNTVYSVGNTIGVGKESDIY---------------KVSDKNGNPRVMKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    ++   Y+      +NS    N   + ++ A KE++ +  +Y  G    PEP + 
Sbjct: 130 TSFHSVRNNRDYL------KNSNQGANWMHLSRLAANKEYQFMSMLYSKGF-KVPEPFDN 182

Query: 240 KSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEY 299
             +++VME +   +G+   +L+    K ++    Y   M   + L      L+H D +E+
Sbjct: 183 SRHIVVMELI---EGYPMRRLR----KHKNIPKLYSDLMCFVVEL--ANSGLIHCDFNEF 233

Query: 300 NTIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER 341
           N +V ++          VID  Q V  +H  +  + + D+  I  +F++
Sbjct: 234 NIMVKDKVEDEQDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 98/228 (42%), Gaps = 36/228 (15%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAIKIYKT 180
           L+ + +R  +    G +  GKE+++Y      G        KV+           ++ +T
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQVSDKNGV------SKVMKIH--------RLGRT 130

Query: 181 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVK 240
           S    ++   Y+      +N ++  N   + ++ A KE++ +  +Y  G    PEP +  
Sbjct: 131 SFHTVRNNRDYLK-----KNVKNGVNWMYLSQLAANKEYQFMSMLYTKGF-EVPEPFDNS 184

Query: 241 SNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYN 300
            ++++M  +   +G+   +L+    K  +    Y   M   +RL      L+H D +E+N
Sbjct: 185 RHIIIMGLI---EGYPMRRLR----KHNNIPKLYNDLMKFIVRL--ANSGLIHCDFNEFN 235

Query: 301 TIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER 341
            ++ ++          VID  Q +  +HP +  + + D+  I  +F++
Sbjct: 236 IMIKDEVEDENDCGFVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 96/233 (41%), Gaps = 48/233 (20%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L+A+ SR  I      +  GKE++VY               +V    G  R   I ++ +
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVY---------------RVSAKDGSARVLKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIYQSGVVPAPEPIE 238
           TS    K+   Y+         R+Q      + ++ A KE++ +  ++  G    PEP +
Sbjct: 130 TSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLHSKGFT-VPEPFD 180

Query: 239 VKSNVLVMEFLNRGDGFASPKL---KDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHAD 295
              ++++ME +   DG+    +   K+ P         Y   M+  ++L      L+H D
Sbjct: 181 NSRHMILMELI---DGYPMRNMRLHKNLPK-------LYSDLMLFIVKLANHG--LIHCD 228

Query: 296 LSEYNTIVHN-------QKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER 341
            +E+N ++ N           VID  Q +  +H  +  F + D+  I  +F++
Sbjct: 229 FNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK 281

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 49/242 (20%), Positives = 101/242 (41%), Gaps = 41/242 (16%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L+A+ +R  +      +  GKE+++Y               +V    G  R   I ++ +
Sbjct: 85  LKAMLNRDTVYSIGATIGVGKESDIY---------------QVSDRNGNSRVMKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    K+   Y+ G       R   +   + ++ A KE++ +  +Y  G    PEP + 
Sbjct: 130 TSFQTVKNNRDYLKG-------RQSASWMFLSRLAANKEYQFMSLLYSKG-FKVPEPFDN 181

Query: 240 KSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEY 299
             ++++ME +    G+   +L+    K  D    Y   M   + L      L+H D +E+
Sbjct: 182 SRHIILMELIK---GYPMRRLR----KHHDLPKLYSDLMCFIVNLANH--GLIHCDFNEF 232

Query: 300 NTIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYF-ERMSIDIFPERA 351
           N ++ ++          VID  Q +  +H  +  + + D+  I  +F +++  D  P+ +
Sbjct: 233 NIMIKDEVDDENDCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRFFKKKLKYDPKPDSS 292

Query: 352 IF 353
           + 
Sbjct: 293 ML 294

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/229 (20%), Positives = 99/229 (43%), Gaps = 38/229 (16%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L+ + +R  +    G +  GKE+++Y               +V    G  +   I ++ +
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIY---------------RVSDRNGTEKVMKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    K++  Y+      +N+++  N   + KI A KE++ +  ++  G    PE  + 
Sbjct: 130 TSFHTVKNKRDYIK-----KNAKNGVNWMYLSKIAAGKEYQFMTLLFAKG-FDVPEAFDC 183

Query: 240 KSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEY 299
             + +VME +    G+   +L+    K ++    Y   M   ++L      L+H D +E+
Sbjct: 184 SRHCIVMELIK---GYPMRRLR----KHKNIPKLYSDLMSFIVKL--GNSGLIHCDFNEF 234

Query: 300 NTIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER 341
           N ++ ++          VID  Q +  +H  +  + + D+  I  +F++
Sbjct: 235 NIMIKDKVEDENDPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRFFKK 283

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 97/233 (41%), Gaps = 46/233 (19%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           ++A+ +R  +      +  GKE+++Y               KV    G  +   I ++ +
Sbjct: 85  IKAMLNRDTVYSIGNTIGVGKESDIY---------------KVSDRNGNAQVMKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    ++   Y+      ++SR   +   +  + A KE+  L  ++  G    PE  + 
Sbjct: 130 TSFTSVRNNRDYL------KHSRQGTSWMHLSLLAAHKEYEFLALLHSRGF-QVPEAFDN 182

Query: 240 KSNVLVMEFLNRGDGFASPKLKDFPYKD---RDETLYYYHTMVAYIRLLYQCCQLVHADL 296
             ++++MEF+           K FP K+          Y  ++ +   L +   L+H D 
Sbjct: 183 SRHMVLMEFI-----------KGFPMKNLRTHSNIPKLYSDLMKFAVDLAKS-GLIHCDY 230

Query: 297 SEYNTIVHNQK--------LYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER 341
           +E+N ++ +Q           VID  Q +  +HP +  F R DI+ I  +F++
Sbjct: 231 NEFNIMIKDQDTTDSSDCGFVVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/242 (19%), Positives = 103/242 (42%), Gaps = 40/242 (16%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           ++++ +R  +  F   +  GKE+++Y               +V    G  +   I ++ +
Sbjct: 85  VKSMLNRDTVYSFGNTIGVGKESDIY---------------QVSDKNGVAKVMKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    K+   Y+      + +    N   +  + A+KE++ +  +Y  G +  P+P + 
Sbjct: 130 TSFHTVKNNRDYL------KKNAHGTNWMHLSLLAAQKEYQFMSLLYSKGFI-VPQPYDN 182

Query: 240 KSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEY 299
             ++++ME +   DGF    L++     +     Y   M   ++L      L+H D +E+
Sbjct: 183 SRHIVLMELI---DGFPMRNLRNHSNIPK----LYSDLMTFAVKL--ANSGLIHCDFNEF 233

Query: 300 NTIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYF-ERMSIDIFPERA 351
           N ++ N           VID  Q +  +H  +  + + DI+ I  +F +++  D  P+  
Sbjct: 234 NIMIKNTVEDSKDCGFVVIDFPQCISIQHKDADFYFQRDIECIRRFFRKKLKYDPTPDPT 293

Query: 352 IF 353
           + 
Sbjct: 294 ML 295

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/300 (18%), Positives = 119/300 (39%), Gaps = 57/300 (19%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAI-KIYK 179
           L++L ++  +      +  GKE+++Y A                   GE R   I ++ +
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQA---------------SDRNGEHRVMKIHRLGR 129

Query: 180 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEV 239
           TS    K+   Y+      +      +   + ++ A KE++ +  +Y  G    P+  + 
Sbjct: 130 TSFHTVKNNRDYL------KKYNQGASWMFLSRVAANKEYQFMSLLYSKGFT-VPKAFDN 182

Query: 240 KSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEY 299
             +++VME +    GF   +L+       D     Y  ++ +I  L     L+H D +E+
Sbjct: 183 SRHIVVMELIK---GFPLRRLRK-----HDNIPKLYSDLMCFIVNLANS-GLIHCDFNEF 233

Query: 300 NTIVHNQK-------LYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER----------- 341
           N ++ ++K         VID  Q +  +H  +  + + D+  I  +F++           
Sbjct: 234 NIMIKDEKDDENDCGFIVIDFPQCISIQHKDADFYFKRDVDCIRRFFKKKLKYEPQSDST 293

Query: 342 -MSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSL 400
            + +D F +   +Q+ +      F  +    ++L + V  +   K  P D   +E   S+
Sbjct: 294 MLDLDGFGDGYKYQYPV------FSRDVERTDNLDELVQASGFSKKHPGDRYLEEAVESM 347

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 46/228 (20%), Positives = 96/228 (42%), Gaps = 38/228 (16%)

Query: 121 LQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERREYAIKIYKT 180
           L+++ +R  +      +  GKE+++Y      G      E KVL           ++ +T
Sbjct: 85  LKSMLNRDTLYSVGTTIGVGKESDIYQVSDRSG------ESKVLKIH--------RLGRT 130

Query: 181 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVK 240
           S    K+   Y+      RN +S  +   + K+ A KE++ +  +Y       P+P +  
Sbjct: 131 SFHTIKNNRDYL------RNGQSA-SWMHLSKLAANKEYQFMTMLYDRNF-EVPQPFDNS 182

Query: 241 SNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYN 300
            + ++ME +    G+   +L     K ++    Y   M   ++L      L+H D +E+N
Sbjct: 183 RHCVLMEHIR---GYPMRRLG----KHKNLPKLYSDLMCFIVKLANH--GLIHCDFNEFN 233

Query: 301 TIVHNQ-------KLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFER 341
            ++ ++          VID  Q +  +H  +  + + D+  I  +F++
Sbjct: 234 IMIKDEPEGEDDPGYVVIDFPQCISIQHQDAAYYFKRDVDCIRRFFKK 281

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 182 ILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVV 231
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  ++ S V+
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 177 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 225
           +++T  + F+D++R+ +G    R   +QH+P +++K+    E+ ++KR+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>TDEL0B03420 Chr2 complement(609095..610564) [1470 bp, 489 aa] {ON}
           Anc_8.768 YOR298W
          Length = 489

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 67/177 (37%), Gaps = 41/177 (23%)

Query: 86  NIKTDELSVTRAKTSKDKANRATVENVLDPRTMRFLQALKSRGVI-----SEFNGCLSTG 140
           NI T ELS+ + K ++D    A   NVL PR   F+  +K    I      E NG LS  
Sbjct: 254 NIMTTELSIVQRKLNQDYPFVAKFYNVLYPRFKTFISTIKCFAYIKHVKLKEQNGLLSNA 313

Query: 141 KEA---NVYHAFAGYGAKSSEEEQKV-------LPNQGERREYAIK-------------- 176
           +      V        +K + EE+         LPN  E  E  I               
Sbjct: 314 RHLLTNGVDKIILKAQSKHTNEEENAQASMIVDLPNFYETAEMTIASGDVEEPEQIKEPV 373

Query: 177 -----IYKTSILVFKDR-----ERYVDGEFRFRNSRS--QHNPRKMIKIWAEKEFRN 221
                +Y  +++ +K R       +++G+F   +     Q NP     +  EK+F++
Sbjct: 374 VISQDLYDLTMIYYKPRYTNVGHDHINGQFTLHDGYQLEQVNPSIFEMLKPEKDFKS 430

>Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W
           (REAL)
          Length = 527

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 83/202 (41%), Gaps = 30/202 (14%)

Query: 244 LVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIV 303
           ++ME  + GD F   K++     D D   +Y+  +V+ I  ++  C + H D+   N ++
Sbjct: 93  IIMEMADGGDLFD--KIEPDVGVDSDVAQFYFQQLVSAIDYMHVKCGVAHRDIKPENVLL 150

Query: 304 -HNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLE 362
             N  L + D   + Q        F R D         R+S+D   +R    ++  + L 
Sbjct: 151 DKNGNLKLADFGLASQ--------FKRKDGT------LRLSMD---QRGSPPYMAPEVLY 193

Query: 363 KFEGEYTNAEDLRQ-----YVAKTLR-PKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDR 416
              G Y +  D+       YV  T + P   P  E ED VF     ++N G L    + +
Sbjct: 194 SEAGFYADRTDIWSIGILLYVLLTGQTPWELPSLEDEDFVF----FIQNDGNLNWGPWSK 249

Query: 417 FTLGKFDLLKSLIAHDNQKVAS 438
                 +LL+ ++  D  K A+
Sbjct: 250 IEFTHLNLLRKILQPDPVKRAT 271

>YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}
           CHK1Serine/threonine kinase and DNA damage checkpoint
           effector, mediates cell cycle arrest via phosphorylation
           of Pds1p; phosphorylated by checkpoint signal transducer
           Mec1p; homolog of S. pombe and mammalian Chk1 checkpoint
           kinase
          Length = 527

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 81/199 (40%), Gaps = 30/199 (15%)

Query: 244 LVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIV 303
           +++E  + GD F   K++     D D   +Y+  +V+ I  L+  C + H D+   N ++
Sbjct: 93  IILEMADGGDLFD--KIEPDVGVDSDVAQFYFQQLVSAINYLHVECGVAHRDIKPENILL 150

Query: 304 -HNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLE 362
             N  L + D   + Q        F R D         R+S+D   +R    ++  + L 
Sbjct: 151 DKNGNLKLADFGLASQ--------FRRKDGT------LRVSMD---QRGSPPYMAPEVLY 193

Query: 363 KFEGEYTNAEDLRQ-----YVAKTLR-PKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDR 416
             EG Y +  D+       +V  T + P   P  E ED VF     + N G L    + +
Sbjct: 194 SEEGYYADRTDIWSIGILLFVLLTGQTPWELPSLENEDFVF----FIENDGNLNWGPWSK 249

Query: 417 FTLGKFDLLKSLIAHDNQK 435
                 +LL+ ++  D  K
Sbjct: 250 IEFTHLNLLRKILQPDPNK 268

>Skud_12.223 Chr12 complement(425424..426425) [1002 bp, 333 aa] {ON}
           YLR151C (REAL)
          Length = 333

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 314 SQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAED 373
           S+ +  E  M LD L MD+     Y  R  + + P   I  F+  DKLEK E +Y    D
Sbjct: 97  SEILHKEFGMRLDNLVMDMP---CYLSRTFLSVKP---IVCFLYKDKLEKNEDKYKVPLD 150

Query: 374 LRQYVAK 380
           +R++  K
Sbjct: 151 IRKFFGK 157

>KLTH0A00902g Chr1 (91636..92610) [975 bp, 324 aa] {ON} highly
           similar to uniprot|P20133 Saccharomyces cerevisiae
           YPR176C BET2 Beta subunit of Type II
           geranylgeranyltransferase required for vesicular
           transport between the endoplasmic reticulum and the
           Golgi provides a membrane attachment moiety to Rab-like
           proteins Ypt1p and Sec4p
          Length = 324

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%)

Query: 367 EYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFD 415
           E+ + E LR+++ K+  PKSG   +  D      H +  L GL    +D
Sbjct: 252 EWISFEKLREFILKSQDPKSGGISDRPDNEVDVFHTIFGLAGLSLMGYD 300

>Smik_12.219 Chr12 complement(424268..425290) [1023 bp, 340 aa] {ON}
           YLR151C (REAL)
          Length = 340

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 314 SQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAED 373
           S+ +  E  M LD L MD+     Y  R  + + P   +  F+  DKLEK E +Y    D
Sbjct: 104 SEILHKEFGMRLDNLVMDMP---CYLSRTFLSVKP---MVCFLYKDKLEKNEDKYKVPLD 157

Query: 374 LRQYVAK 380
           +R++  K
Sbjct: 158 IRKFFGK 164

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,358,527
Number of extensions: 2073278
Number of successful extensions: 6315
Number of sequences better than 10.0: 50
Number of HSP's gapped: 6484
Number of HSP's successfully gapped: 51
Length of query: 540
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 426
Effective length of database: 40,409,475
Effective search space: 17214436350
Effective search space used: 17214436350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)