Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F16082g5.433ON2062069231e-128
Kwal_55.214325.433ON2072077251e-97
NCAS0F033705.433ON2112064942e-62
CAGL0A02794g5.433ON2162054933e-62
SAKL0G02508g5.433ON2282084925e-62
KNAG0C049205.433ON2172054872e-61
Suva_2.5395.433ON2272074803e-60
YDR367W (KEI1)5.433ON2212054785e-60
Smik_4.6335.433ON2212054603e-57
Skud_4.6365.433ON2342104544e-56
KAFR0E039305.433ON2112064491e-55
Kpol_1062.305.433ON2142064309e-53
TDEL0E019205.433ON2202064161e-50
TPHA0E017705.433ON2172064142e-50
ZYRO0F10010g5.433ON2081944082e-49
AER256C5.433ON2392053962e-47
KLLA0E21099g5.433ON2242063725e-44
TBLA0A065205.433ON2061983707e-44
Ecym_47625.433ON2212073518e-41
NDAI0B056605.433ON1611743293e-38
TBLA0G020105.433ON2131903091e-34
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F16082g
         (206 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   360   e-128
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   283   1e-97
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   194   2e-62
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   194   3e-62
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   194   5e-62
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   192   2e-61
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   189   3e-60
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   188   5e-60
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   181   3e-57
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   179   4e-56
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   177   1e-55
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   170   9e-53
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   164   1e-50
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   164   2e-50
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   161   2e-49
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   157   2e-47
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   147   5e-44
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   147   7e-44
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   139   8e-41
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   131   3e-38
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   123   1e-34

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  360 bits (923), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 180/206 (87%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
           QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDP               KLLTAR
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
           GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKY           
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDL 180

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206
           KHKKLWQRWWIRAENWSYRVCHHYLA
Sbjct: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  283 bits (725), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 159/207 (76%), Gaps = 1/207 (0%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           MGVEIGLGIT+LNKCSGFYGILGLLTGH LDFMQWVLYLTS+ T++VYS+GL+++YKP +
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXX-XXXXXXKLLTA 119
            +Y+ +LLTFT DTL+TCFFTLWFSG WF+AK SEL+DP                 L++ 
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 120 RGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXX 179
           RG+TLSSQSASQ TEYFFTILV++ AL +RFYFNFII+AFVQRL RHPKY          
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 180 XKHKKLWQRWWIRAENWSYRVCHHYLA 206
            KH+   +RWWIRAE  SY++C  YLA
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  194 bits (494), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 128/206 (62%), Gaps = 17/206 (8%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVEI LGITI NKCSG YGIL L TGH LDF+QWV YL S+FTL++++ GL  ++KP L
Sbjct: 23  LGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTLIIFAQGLYEIHKPTL 82

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
            T++ +L+ ++ DT+ TC FTLWF+  WF  + +   +                  L  R
Sbjct: 83  LTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEEA-----------------LQRR 125

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
            E+L SQ A++A EY  TI ++L+ L  R YFN ++ AFVQ L  HPKY           
Sbjct: 126 NESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQDL 185

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206
           K+K +W+RWWI+ + WSY+VC H LA
Sbjct: 186 KNKPVWKRWWIKNQKWSYKVCSHLLA 211

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  194 bits (493), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 98/205 (47%), Positives = 129/205 (62%), Gaps = 9/205 (4%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVEI LGITILNKCSG YGIL L TGH LD+MQW+ YL SVFTL+V+S GL  ++KPKL
Sbjct: 20  LGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIVFSQGLFMIHKPKL 79

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
             ++ +L+ FTADT++TCFFTLWFS  WF +   E  +                     R
Sbjct: 80  IVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVSQNY---------RR 130

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
              L+SQ AS+  EY  T+L +L+ L+ R YFNFI+ +FVQ L RHPKY           
Sbjct: 131 STDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYMVDQDDVEQDL 190

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYL 205
           K+K   +RWWI+++ + Y++C H L
Sbjct: 191 KNKSAIKRWWIKSQKFCYKLCRHTL 215

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  194 bits (492), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 99/208 (47%), Positives = 127/208 (61%), Gaps = 2/208 (0%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVE+GLGI+I NK SGFYGIL L TGH LDFMQW  Y  SV TL+VY  GL  + KP  
Sbjct: 21  IGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTLLVYLSGLWQIRKPNP 80

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXX--XXKLLT 118
            TY+ VL+ FT DTL+ CFFT+WFS  WF+ +E++ +                   K L 
Sbjct: 81  LTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAGRALGPAKELN 140

Query: 119 ARGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXX 178
            R  +L+SQSASQ  EY  T+L +++ L  RFYFNFI+ AFVQ++ RHPKY         
Sbjct: 141 RRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYIVDKDDVEQ 200

Query: 179 XXKHKKLWQRWWIRAENWSYRVCHHYLA 206
             K+K L++R  I++E W Y  C   LA
Sbjct: 201 DLKNKSLFRRLCIKSEKWCYNACQRALA 228

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  192 bits (487), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 132/205 (64%), Gaps = 8/205 (3%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVEI LG+T+LNKCSG +GIL L TGH LD MQW  YL SVFTLVVY+ GL  ++KPKL
Sbjct: 20  IGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVYAQGLYQIHKPKL 79

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
            T++ +++ F+ DT++TC FTLWF+G+WFA  E   +D                  L  R
Sbjct: 80  LTFSQIVVVFSIDTVLTCLFTLWFTGVWFA--EESNTDAAMGTAASAVAR------LVKR 131

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
           G  + +Q A+++ EY FTI++++++LV R YFNF++ +FVQ L RHP+Y           
Sbjct: 132 GAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDDIEQDL 191

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYL 205
           K+K   +RWW+ ++  SY +C H L
Sbjct: 192 KNKFFLRRWWVVSQKSSYSICRHVL 216

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  189 bits (480), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 128/207 (61%), Gaps = 2/207 (0%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           + VEI LGI+ILNKCSG YGIL L TGH LDFMQWV YL SVFTL+V++ GL  ++KP L
Sbjct: 20  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFAQGLYLIHKPNL 79

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFA--AKESELSDPXXXXXXXXXXXXXXXKLLT 118
             ++ + + +T DT+ TCFFTLWF+  WF      S ++D                  LT
Sbjct: 80  LVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADASSTATQTINYNPIATGKLT 139

Query: 119 ARGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXX 178
           AR    S Q AS++ EY  TIL++L++L+ RFYFNFI+ +FVQ L  HPKY         
Sbjct: 140 ARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASFVQELLHHPKYLVDRDDVEQ 199

Query: 179 XXKHKKLWQRWWIRAENWSYRVCHHYL 205
             K+K +W+R W +++   Y++C + L
Sbjct: 200 DLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  188 bits (478), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 130/205 (63%), Gaps = 4/205 (1%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           + VEI LGI+ILNKCSG YGIL L TGH LDFMQW+ YL SVFTL+V+S GL  ++KP L
Sbjct: 20  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVFSQGLYLIHKPNL 79

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
             ++ + + +T DT+ TCFFTLWF+  WF  +++   D                  LT R
Sbjct: 80  LVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNNALQSNPISTGK----LTER 135

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
           G  +S QSA+++ EY  TIL++L++L+ RFYFNFI+ +FVQ L  HPKY           
Sbjct: 136 GIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVDRDDVEQNL 195

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYL 205
           K+K +W+R W +++   Y++C + L
Sbjct: 196 KNKPIWKRLWAKSQKGCYKLCKNLL 220

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  181 bits (460), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 127/205 (61%), Gaps = 4/205 (1%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           + VEI LGI+ILNKCSG YGIL L TGH LDFMQWV YL SVFTL+++S GL  ++KP L
Sbjct: 20  LAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSVFTLIIFSQGLYLIHKPNL 79

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
             ++ +   +T DTL TCFFTLWF+  WF  +++                    + LT R
Sbjct: 80  LLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTA----GGVASQSNNSNLISTERLTVR 135

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
              +S QSA+++ EY  TIL++L++L+ RFYFN I+ +FVQ L  HPKY           
Sbjct: 136 NTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLHHPKYLVDRDDVEQNL 195

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYL 205
           K+K +W+R + +++   Y++C + L
Sbjct: 196 KNKPIWKRLYAKSQKGCYKLCKNLL 220

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  179 bits (454), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 124/210 (59%), Gaps = 5/210 (2%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           + VEI LGI+ILNKCSG YGIL L TGH LDFMQWV YL SVFTL+V+S GL  ++KP L
Sbjct: 24  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQGLYLIHKPNL 83

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKE-----SELSDPXXXXXXXXXXXXXXXK 115
             ++ + + +T DT+ TCFFTLWF+  WF  +      S  +                  
Sbjct: 84  LVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDFGSIANSTADTALRTNGLSPIMAG 143

Query: 116 LLTARGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXX 175
            LTAR    S QSA++  EY  TI ++L +L+ RFYFN I+ +FVQ L  HPKY      
Sbjct: 144 KLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQELLHHPKYLVDRDD 203

Query: 176 XXXXXKHKKLWQRWWIRAENWSYRVCHHYL 205
                K+K +W+R W +++   YR+C + L
Sbjct: 204 VEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  177 bits (449), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 121/206 (58%), Gaps = 14/206 (6%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           + VEI LGIT  NK SG +GIL L TGH L FMQWV YL S  TL V++ GL  ++KP +
Sbjct: 20  LAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVFAQGLFEIHKPNI 79

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
            T++ + + ++ DTL  CFFTLWF+G WF  +                        +T R
Sbjct: 80  LTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQ--------------TEAAVGSTITKR 125

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
            E +SSQ ASQ  EY  TI ++L +LV RFYFNFI+ +FVQ L RHPKY           
Sbjct: 126 TEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQDL 185

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206
           K+K +W+RWW++ +   Y++C + LA
Sbjct: 186 KNKSIWKRWWLKCQKSCYKLCKNLLA 211

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  170 bits (430), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 117/206 (56%), Gaps = 20/206 (9%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVE  LGITILNKCSG YGIL L TGH L+  QWV YL SVFTL++YS GL  V+ P L
Sbjct: 29  IGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIYSQGLFQVHTPSL 88

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
            TY+ + + F+ DT +TC FT+ FS  WF    S +SD                      
Sbjct: 89  LTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSD--------------------GS 128

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
           G     Q AS+  EY FTIL++++ALVSR YFNFI+ AF Q LF HPKY           
Sbjct: 129 GVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQDL 188

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206
           K+K    +WWI+++   Y +  H L 
Sbjct: 189 KNKNKIVQWWIKSKKSCYNLARHILT 214

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  164 bits (416), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 119/206 (57%), Gaps = 8/206 (3%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVEI LGI+I+NKCSG YGIL L TGH LD MQWVLY+ S+FTL++   GL  ++KP +
Sbjct: 23  IGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSIFTLIICVQGLYQIHKPNV 82

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
            T++ + +TF  DTL T FFTLWF+  W+  + +  +                 K     
Sbjct: 83  LTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTKSSYSDAPVDYSSK----- 137

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
              ++ Q AS+  EY  T+ +++++L  + YF FII +FVQ L  HP+Y           
Sbjct: 138 ---IAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYMLDQDDVEQDL 194

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206
           KH+  W+RWWI+++   Y++    LA
Sbjct: 195 KHQSFWKRWWIKSQKSCYKMSKSLLA 220

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  164 bits (414), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 124/206 (60%), Gaps = 17/206 (8%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVE  LGITI NKCSG YGIL L TGH L  +QWV YL S FTL++Y+ GL  V+ P L
Sbjct: 29  IGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIYAQGLFQVHHPNL 88

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
            TY  +L+T++ DT+ TCFFT++F   WF  +ES   D                 + ++ 
Sbjct: 89  LTYCQILITYSFDTICTCFFTIYFCSHWF-TEESNAGD----------------NINSST 131

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
                +Q AS++ E+F+T+ ++LIALVSRFYFNFI+ +F Q+LF HPKY           
Sbjct: 132 TVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQDL 191

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206
           K+K +  +WWI+++   Y     +LA
Sbjct: 192 KNKSIIVQWWIKSKKRCYYTSKRFLA 217

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  161 bits (408), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 117/194 (60%), Gaps = 16/194 (8%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVE+ LG+TILNKCSG +GIL L TGH L+F+QWVLYL S+F+ VVY+ GL T  KP L
Sbjct: 19  IGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVYAQGLFTYSKPSL 78

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
             ++ + + F+ DT +TC FTLWF+  W+  +++  +                 K + A 
Sbjct: 79  LVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQ----------------KSIAAA 122

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
                +Q ASQ+ E+  TI ++L +L++R YFNF++ +FVQ L +HP+Y           
Sbjct: 123 AMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQEL 182

Query: 181 KHKKLWQRWWIRAE 194
           + + +W+R W R +
Sbjct: 183 RTQPVWKRVWTRTQ 196

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  157 bits (396), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 115/205 (56%), Gaps = 5/205 (2%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVE+ LGI I NK  G +G+L L TGH LD +QW+ YL S  TL+VY  GL  +Y+P+L
Sbjct: 40  IGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVYLHGLMQIYQPRL 99

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
             Y  VL+ ++ DT++TC +TLWF+  WF        D                  +T  
Sbjct: 100 AAYCLVLVVYSTDTILTCLYTLWFTRGWFID-----GDVGVTATAKEDDADATQGSVTVE 154

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
            E +S QSAS++ EY FT+  +L AL  RFY NF+I +FVQR+F+H K+           
Sbjct: 155 NEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAGCDDVEQDL 214

Query: 181 KHKKLWQRWWIRAENWSYRVCHHYL 205
           KHK +  R + + + W Y +C  YL
Sbjct: 215 KHKSVAYRAYAKMQRWCYFLCRRYL 239

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  147 bits (372), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 117/206 (56%), Gaps = 3/206 (1%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVE+ LG+   NK SG YG+L L TGH LDF+QW  Y+ S+F LVV+  G+  VYKP +
Sbjct: 21  IGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVFISGIRQVYKPNI 80

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKES-ELSDPXXXXXXXXXXXXXXXKLLTA 119
              + V   F+ DT+++C + LWF+ +WF+ + S +++D                  ++ 
Sbjct: 81  LLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALGPAHEGTTSTIST 140

Query: 120 RGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXX 179
           + +T  S+SAS   E+F  IL++L+ L  RFYFNFII+AF Q+L R  K+          
Sbjct: 141 KVDT--SKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKFTFDQNDIEVN 198

Query: 180 XKHKKLWQRWWIRAENWSYRVCHHYL 205
             ++ +  +W  + E W + +C  YL
Sbjct: 199 LHNRNILFKWRYKFEKWCFYLCKRYL 224

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  147 bits (370), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 111/198 (56%), Gaps = 26/198 (13%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVE+ LGITI NKC G YGIL L  GH L+F QWVLY  S+  L +Y+ GL  V++P L
Sbjct: 27  LGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIYAQGLAKVHRPTL 86

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
            T++ V + F+ DTL+TC FT++F+  WFAA  +                          
Sbjct: 87  YTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTRPP---------------------- 124

Query: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXXX 180
               ++Q AS A EY  ++LV+L +LVSR YFNFI+ +F+Q LF  P Y           
Sbjct: 125 ----AAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTDEVETEL 180

Query: 181 KHKKLWQRWWIRAENWSY 198
           +H  L +R W++ +++ Y
Sbjct: 181 RHSSLLRRLWLQNQHYCY 198

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  139 bits (351), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 111/207 (53%), Gaps = 2/207 (0%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVE+ LG+ I NK  G YGIL L TG  LD +QW  Y+ S   L+V++ GL+ VYKPKL
Sbjct: 15  IGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVFTKGLSQVYKPKL 74

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKE-SELSDPXX-XXXXXXXXXXXXXKLLT 118
            TY  VL  ++ DT++ CFF + F+G WF+ ++ S  S+P                +   
Sbjct: 75  MTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVDVGKSGTQNFA 134

Query: 119 ARGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXX 178
            R     +QSAS   EY  TIL++LI    RFY NFII +FV+R+ +  +Y         
Sbjct: 135 YRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQNRYITEPDDVEY 194

Query: 179 XXKHKKLWQRWWIRAENWSYRVCHHYL 205
             K+  +  R ++  + W Y  C  YL
Sbjct: 195 DLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  131 bits (329), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 98/174 (56%), Gaps = 13/174 (7%)

Query: 33  MQWVLYLTSVFTLVVYSLGLTTVYKPKLQTYAFVLLTFTADTLITCFFTLWFSGMWFAAK 92
           MQWV YL S+F L++++ GL  ++KP L T++ + + FT DTL TCFFTLWF+  WF   
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGS 60

Query: 93  ESELSDPXXXXXXXXXXXXXXXKLLTARGETLSSQSASQATEYFFTILVSLIALVSRFYF 152
           E E +                   +  R  +L+SQ A+   EYF T+L++ I L  RFYF
Sbjct: 61  EGESAVQTSTG-------------VQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYF 107

Query: 153 NFIILAFVQRLFRHPKYXXXXXXXXXXXKHKKLWQRWWIRAENWSYRVCHHYLA 206
           N I+ +FVQ L  +PK+           K+K + +RWWI+ E + YR+C   L+
Sbjct: 108 NCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  123 bits (309), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 106/190 (55%), Gaps = 14/190 (7%)

Query: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60
           +GVE+ LGI ILNKCSGFYGIL L TGH L  +QW+ Y+ S+FTL++Y+ G+  + KP +
Sbjct: 25  LGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIYTQGMFHIKKPNV 84

Query: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPXXXXXXXXXXXXXXXKLLTAR 120
             ++ +   F+ DT+ T F TL+F+  WF++  S                       T +
Sbjct: 85  YLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENSLQR-------------TEK 131

Query: 121 GETLS-SQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYXXXXXXXXXX 179
              LS  Q AS   E F  ++V+L  L+SR Y+N ++ +F+ +LF +PK+          
Sbjct: 132 DIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVETD 191

Query: 180 XKHKKLWQRW 189
            K+K  ++++
Sbjct: 192 LKNKSFFKKF 201

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.140    0.459 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,852,844
Number of extensions: 544871
Number of successful extensions: 1666
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1660
Number of HSP's successfully gapped: 25
Length of query: 206
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 102
Effective length of database: 41,556,135
Effective search space: 4238725770
Effective search space used: 4238725770
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 63 (28.9 bits)