Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F16060g5.434ON30930916640.0
Kwal_55.214265.434ON30830912591e-175
Kwal_47.18084na 1ON30930310971e-151
KLTH0E15532gsingletonON30930210741e-147
SAKL0G02530g5.434ON31230810331e-141
NDAI0C016005.434ON31330910161e-138
KLTH0A03476gna 1ON30830410101e-138
YDR368W (YPR1)5.434ON31230810021e-136
Smik_4.6345.434ON3123089901e-134
Suva_2.5405.434ON3123089801e-133
Skud_4.6375.434ON3123089731e-132
CAGL0I01100g5.434ON3103059581e-130
Smik_15.2985.434ON3123099561e-129
Suva_8.1735.434ON3123099561e-129
TDEL0E019105.434ON3113079551e-129
YOR120W (GCY1)5.434ON3123099511e-129
Skud_15.2835.434ON3123099481e-128
NCAS0H020605.434ON3223029431e-127
KNAG0C049105.434ON3133109381e-127
CAGL0A02816g5.434ON3103049351e-126
NCAS0F033805.434ON3133099181e-124
KAFR0E03850singletonON3113099081e-122
TBLA0A02825singletonON3112999061e-122
Kpol_1062.295.434ON3113059031e-121
KLLA0B14707gsingletonON3102968801e-118
TBLA0A065105.434ON3123088781e-117
ZYRO0F10032g5.434ON3102948741e-117
TPHA0E017605.434ON3103058731e-117
KLTH0E00220gsingletonON3063018711e-116
KLTH0A00528gsingletonON3063018711e-116
TDEL0D00230singletonON3123078691e-116
KAFR0E038405.434ON3103098611e-115
NDAI0B056705.434ON3183038421e-112
TPHA0G00210singletonON3113088391e-111
KLLA0D10109gsingletonON3092937951e-105
TBLA0A02835singletonON3113077741e-102
AER401W5.434ON3133037582e-99
NDAI0A070003.108ON3202995436e-67
NCAS0I024203.108ON3202915236e-64
KNAG0K020703.108ON3232995028e-61
SAKL0C10626gsingletonON3222904923e-59
Suva_4.3983.108ON3443094909e-59
Smik_2.2883.108ON3443034891e-58
YBR149W (ARA1)3.108ON3443024882e-58
Skud_2.2763.108ON3443024864e-58
Smik_2.289singletonON3443024821e-57
KAFR0G013503.108ON3242994802e-57
KLLA0F02728g3.108ON3302984769e-57
TDEL0D051603.108ON3252724732e-56
SAKL0C09922g3.108ON3223014714e-56
KLTH0C10010g3.108ON3212964672e-55
ZYRO0B06138g3.108ON3283104672e-55
Kwal_56.226113.108ON3212904636e-55
ACL107C5.409ON3543054133e-47
NCAS0A066605.409ON3263064105e-47
NDAI0D016005.409ON3273104071e-46
KNAG0B03780singletonON3262904036e-46
Ecym_55085.409ON3262923965e-45
TBLA0F01720singletonON3262913922e-44
TPHA0E018605.409ON3263053913e-44
TBLA0A00630singletonON3283243904e-44
KAFR0C05320singletonON3273143835e-43
KLTH0F16610g5.409ON3293113835e-43
Smik_8.1825.409ON3273253818e-43
CAGL0I01122g5.409ON3262883782e-42
TDEL0E021505.409ON3293163782e-42
ZYRO0A06336g5.409ON3272903782e-42
SAKL0G01914g5.409ON3293333756e-42
YHR104W (GRE3)5.409ON3273253756e-42
KLLA0E21627g5.409ON3293063757e-42
Skud_8.1655.409ON3273283749e-42
Kwal_47.18893na 2ON2893093595e-40
KLTH0G02420gna 2ON2892933589e-40
Ecym_7160na 3ON2712783551e-39
Kwal_55.215365.409ON3293243591e-39
Suva_15.3005.409ON3273243582e-39
KNAG0D013707.468ON2822763542e-39
KLTH0F01892gna 4ON3022773545e-39
CAGL0C04543g7.468ON2872753482e-38
KAFR0G009207.468ON2862793483e-38
KLLA0F05775g7.285ON3093173493e-38
NCAS0A137407.285ON3093153423e-37
Smik_4.1137.285ON3123163408e-37
NCAS0H005607.468ON2842883352e-36
YJR096W7.468ON2822803343e-36
Suva_12.1847.468ON2822803325e-36
Kpol_1013.827.468ON2852853301e-35
ABL209Cna 3ON3103013321e-35
CAGL0J09394g7.285ON3113173311e-35
Kwal_33.13276na 4ON3022773301e-35
KLLA0F03256g7.468ON2852783291e-35
SAKL0F02574gna 2ON2892903273e-35
Skud_4.1317.285ON3123063283e-35
Skud_10.3187.468ON2822753263e-35
SAKL0F14278g7.468ON2862763221e-34
Kwal_47.19278na 5ON3143043223e-34
Smik_10.3847.468ON2822873194e-34
ZYRO0G17600g7.468ON2832733185e-34
KAFR0B012007.285ON3153193206e-34
Kpol_1020.137.285ON3133243181e-33
TDEL0D02790singletonON3293183172e-33
YDL124W7.285ON3123163153e-33
ZYRO0C09196g7.285ON3123203129e-33
TDEL0C033207.468ON2832753082e-32
SAKL0F09746g7.285ON3123133065e-32
ZYRO0E09614gna 5ON3083133057e-32
KLTH0G05786g7.468ON2862762994e-31
Kwal_47.182197.468ON2932762986e-31
KNAG0C041107.285ON3113072952e-30
KLTH0G00638gna 5ON3133042925e-30
TBLA0F019807.285ON3023152855e-29
SAKL0F00704gna 5ON3153042856e-29
NDAI0A023007.285ON3133212822e-28
Kpol_381.8singletonON3093152691e-26
Ecym_32647.285ON3112692541e-24
Kwal_33.13274singletonON108901613e-13
Suva_4.1227.285ON2061791199e-07
Kpol_449.4singletonON3413311042e-04
Suva_12.272singletonON265194880.012
TBLA0E05040singletonON342224830.065
YCR107W (AAD3)singletonON36390800.15
TBLA0B10110singletonON345248780.23
YFL056C (AAD6)singletonON212124750.47
Skud_10.383na 6ON376123750.56
NCAS0C02450singletonON343279740.71
Ecym_22962.604ON340213740.76
Kpol_2000.109singletonON342202721.2
Smik_14.1na 7ON376124711.7
SAKL0H11770gna 8ON421130711.7
TDEL0A08000singletonON319168711.8
NCAS0E017807.201ON114364712.2
KAFR0D04230singletonON34246702.5
TBLA0I014502.529ON69374703.1
YDL243C (AAD4)singletonON329124683.7
TDEL0D051403.110ON30470675.5
NCAS0F04070singletonON344107676.3
TBLA0D012608.702ON912139677.6
TBLA0C025603.443ON2578111678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F16060g
         (309 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   645   0.0  
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   489   e-175
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   427   e-151
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   418   e-147
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   402   e-141
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   395   e-138
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   393   e-138
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   390   e-136
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   385   e-134
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   382   e-133
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   379   e-132
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   373   e-130
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   372   e-129
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   372   e-129
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   372   e-129
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   370   e-129
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   369   e-128
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     367   e-127
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   365   e-127
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   364   e-126
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     358   e-124
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     354   e-122
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     353   e-122
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   352   e-121
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   343   e-118
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   342   e-117
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   341   e-117
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   340   e-117
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   340   e-116
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   340   e-116
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   339   e-116
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   336   e-115
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   328   e-112
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 327   e-111
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   310   e-105
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     302   e-102
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   296   2e-99
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   213   6e-67
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   206   6e-64
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   197   8e-61
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   194   3e-59
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   193   9e-59
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   192   1e-58
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   192   2e-58
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   191   4e-58
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   190   1e-57
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   189   2e-57
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   187   9e-57
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   186   2e-56
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   186   4e-56
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   184   2e-55
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   184   2e-55
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   182   6e-55
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   163   3e-47
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             162   5e-47
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               161   1e-46
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               159   6e-46
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   157   5e-45
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     155   2e-44
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   155   3e-44
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     154   4e-44
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   152   5e-43
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   152   5e-43
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   151   8e-43
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   150   2e-42
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   150   2e-42
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   150   2e-42
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   149   6e-42
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   149   6e-42
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   149   7e-42
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   148   9e-42
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   142   5e-40
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   142   9e-40
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   141   1e-39
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   142   1e-39
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   142   2e-39
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   140   2e-39
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   140   5e-39
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   138   2e-38
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   138   3e-38
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   139   3e-38
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   136   3e-37
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   135   8e-37
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   133   2e-36
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   133   3e-36
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   132   5e-36
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   131   1e-35
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   132   1e-35
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   132   1e-35
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   131   1e-35
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   131   1e-35
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   130   3e-35
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   130   3e-35
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   130   3e-35
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   128   1e-34
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   128   3e-34
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   127   4e-34
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   127   5e-34
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   127   6e-34
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   127   1e-33
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     126   2e-33
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   125   3e-33
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   124   9e-33
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   123   2e-32
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   122   5e-32
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   122   7e-32
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   119   4e-31
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   119   6e-31
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   118   2e-30
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   117   5e-30
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   114   5e-29
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   114   6e-29
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     113   2e-28
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   108   1e-26
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   102   1e-24
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    67   3e-13
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    50   9e-07
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    45   2e-04
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    39   0.012
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             37   0.065
YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putati...    35   0.15 
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    35   0.23 
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    33   0.47 
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    33   0.56 
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    33   0.71 
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    33   0.76 
Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]...    32   1.2  
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    32   1.7  
SAKL0H11770g Chr8 complement(1004615..1005880) [1266 bp, 421 aa]...    32   1.7  
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              32   1.8  
NCAS0E01780 Chr5 (346617..350048) [3432 bp, 1143 aa] {ON} Anc_7....    32   2.2  
KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {O...    32   2.5  
TBLA0I01450 Chr9 (315841..317922) [2082 bp, 693 aa] {ON} Anc_2.5...    32   3.1  
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    31   3.7  
TDEL0D05140 Chr4 complement(931425..932339) [915 bp, 304 aa] {ON...    30   5.5  
NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {O...    30   6.3  
TBLA0D01260 Chr4 (313649..316387) [2739 bp, 912 aa] {ON} Anc_8.7...    30   7.6  
TBLA0C02560 Chr3 (604893..612629) [7737 bp, 2578 aa] {ON} Anc_3....    30   8.5  

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/309 (100%), Positives = 309/309 (100%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
           VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE
Sbjct: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120

Query: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180
           QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID
Sbjct: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
           SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK
Sbjct: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
           LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH
Sbjct: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300

Query: 301 NPTWFSFEE 309
           NPTWFSFEE
Sbjct: 301 NPTWFSFEE 309

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  489 bits (1259), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 230/309 (74%), Positives = 264/309 (85%), Gaps = 1/309 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           MT +LKKCTATA LNTGA+IPLLGLGTWR TKE GY A LAA+KAGYRHID AAVCMNEQ
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
           V+G+AIRDSGV R+ELFVTTKLW TQHRDP  AL QSLKRLGL+YVDLYMMHWP+AFR +
Sbjct: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120

Query: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180
           Q+K  N+MLIP+  +G+P VD  WDYVKTWELMQ+LP T KT A+GVANFSV QL  L+ 
Sbjct: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLK 179

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
           SP NKI+PAASQLETHPFLP ++ML+FC++  ILMEAYSPLG +G PL+DEPV+REISKK
Sbjct: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
           LHVEPAQLL+SWGL+RG AVL KSKT +RIE+NL  FD+ + D  RI+E+AQERG KR H
Sbjct: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTH 299

Query: 301 NPTWFSFEE 309
           NP WFSFEE
Sbjct: 300 NPPWFSFEE 308

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  427 bits (1097), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 193/303 (63%), Positives = 246/303 (81%)

Query: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGR 64
           LK  T   KLNTGA IPLLG GTWRST+E GYNA L+AIK GYRHID AAV  NE  VGR
Sbjct: 4   LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVGR 63

Query: 65  AIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH 124
           AIRDSGVPREELFVTTKLW TQ R+P  AL QSL+RLGLDYVDLY++HWP+  +++++  
Sbjct: 64  AIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDRITD 123

Query: 125 TNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGN 184
            N   IP ++DG+PDVD  WDY+KTW+LMQELP+TGKT A+GV+N SVSQL+KL+   GN
Sbjct: 124 GNLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKGN 183

Query: 185 KIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVE 244
           K+VPA  Q+ETHP LPQNK+L FC K++IL+EAYSPLGS+G+PL+DEPV++EI+KK + +
Sbjct: 184 KVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYNAD 243

Query: 245 PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTW 304
           PAQ+++SW ++RG+ VL KS TPSRI++NL T D+ + D  +IN+L  E+G KR+++P W
Sbjct: 244 PAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVNDPEW 303

Query: 305 FSF 307
           F+F
Sbjct: 304 FTF 306

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  418 bits (1074), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 183/302 (60%), Positives = 242/302 (80%)

Query: 8   CTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR 67
            +A  KL TGA IPLLG GTWRST+E+GYNA L A+K GYRHID AAV  NE  VGRAIR
Sbjct: 7   SSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAIR 66

Query: 68  DSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNY 127
           DSGVPR++LFVTTKLW TQHRDP+ AL QSL+RLGLDYVDLY++HWP+  R++++   N 
Sbjct: 67  DSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGNL 126

Query: 128 MLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNKIV 187
             +P ++DG+PDVDE W YVKTWE+MQ+LP T KT A+GV+NFSV+QL+ L+ + G K++
Sbjct: 127 FTVPTKEDGKPDVDEQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTKVI 186

Query: 188 PAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEPAQ 247
           PA +Q+ETHP LPQ+K+  FC +NNIL+EAYSPLGS+G+PL++EP V+EI+ K + +PAQ
Sbjct: 187 PAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADPAQ 246

Query: 248 LLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTWFSF 307
           +L+SWG++RG+ +L KS TPSRIE+N    D+ + D  +IN + +E+G KRI++P WF F
Sbjct: 247 VLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWFHF 306

Query: 308 EE 309
           +E
Sbjct: 307 DE 308

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  402 bits (1033), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 244/308 (79%), Gaps = 1/308 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M+  LK  +AT KLNTGA IP LGLGTWRS+ E  YN+ L+AIK GYRHID AA+  NE+
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VG+AIRDSGVPR ELFVTTKLW TQ R+P+ AL  SLKRLGLDYVDLY++HWP+AF+++
Sbjct: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            +K  +Y+ +P  KDG+ DVD + W++VKTWEL+QELPATGK  A+GV+NFSV+ LK+L+
Sbjct: 121 NIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            SPGNK+VPA +Q+E HP LPQ++++ F K   I++EAYSPLGS G+PLL EPV+ E++K
Sbjct: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K  VEPAQ+L++WG+QRG+ +L KS  P R+E+N   FD+ + D+ RI+++++E+G KR 
Sbjct: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 300 HNPTWFSF 307
            +P W SF
Sbjct: 301 VHPDWPSF 308

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  395 bits (1016), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 184/309 (59%), Positives = 240/309 (77%), Gaps = 2/309 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKEN-GYNATLAAIKAGYRHIDIAAVCMNE 59
           M + LK  TAT KLNTGA IP +GLGTW+ST EN GY A + A+KAGYRHID AA+  NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 60  QVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRS 119
             VG+AI DSG+PREE+FVTTKLW TQHRDP+TAL+QSL+RLGLDYVDLY+MHWPVAF+ 
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 120 EQVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
           + +K  NY  +P   +GQ D+D   W++VKTWELMQELP TGKT A+GV+NFS++ LK L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 179 IDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREIS 238
           + SPGNK+VPAA+Q+E HP LPQ+++  FCK+  I++EAYSPLGS  AP+L EP + EI+
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 239 KKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKR 298
           KK +V+PAQ+++SW +Q+GH VL KS    RI+AN  TF++ + ++  +N L++E+G +R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 299 IHNPTWFSF 307
           I  P W  F
Sbjct: 301 IVQPNWAPF 309

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  393 bits (1010), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 233/304 (76%), Gaps = 1/304 (0%)

Query: 6   KKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRA 65
           K  T+  KLNTGA IPL+GLGT+ S  E GY A L AIK GYRHID AA+  NE  VGRA
Sbjct: 5   KPSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRA 64

Query: 66  IRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHT 125
           IRDSGVPREELFVTTK+W TQHR+P  AL +SL RLGLDYVDL++MHWP A R+E++   
Sbjct: 65  IRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDG 124

Query: 126 NYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNK 185
           N + +PKR+D +PDVD  W+Y+KTW LMQ+LPA+GKT A+GV+NFSV QL+KL+  PG+K
Sbjct: 125 NMITVPKREDEKPDVDTEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGSK 184

Query: 186 IVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEP 245
           +VPA +Q+E HP LPQ  +  FCKK NI++ AYSPLGS+ APLLD+PV+ EI+ K   +P
Sbjct: 185 VVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKADP 244

Query: 246 AQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTWF 305
           AQ+++ W ++RG+  L KS TPSRIE+NL   ++ + +L +INE+  ++G KR+ +P WF
Sbjct: 245 AQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEI-HKKGEKRVVDPEWF 303

Query: 306 SFEE 309
            FEE
Sbjct: 304 DFEE 307

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  390 bits (1002), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 175/308 (56%), Positives = 238/308 (77%), Gaps = 1/308 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M   LK  +AT KLNTGA IP+LG GTWRS   NGY++ +AA+KAGYRHID AA+ +NE+
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VGRAI+DSGVPREE+F+TTKLW T+ RDP+ AL++SLKRLGLDYVDLY+MHWPV  +++
Sbjct: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
           +V   N + IP  +DG  D+D + W+++KTWELMQELP TGKT A+GV+NFS++ +K+L+
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
           +SP NK+VPA +Q+E HP LPQ+++++FCK+  I++EAYSP GS  APLL E  + +++K
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K  VEPAQL++SW +QRG+ VL KS  P RI +N   F +PE D + I+ L++  GTKR+
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 300 HNPTWFSF 307
            +  W SF
Sbjct: 301 VDMKWGSF 308

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  385 bits (990), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 235/308 (76%), Gaps = 1/308 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M   LK  +A+ KLNTGA IP+LG GTWRS + NGY++ +AA+KAGYRHID AA+ +NE+
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VGRAI+DSGVPRE++F+TTKLW T+ RDP+ AL++SLKRLGLDYVDLY+MHWPV  ++E
Sbjct: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            +   N + IP   DG  DVD   W+++KTW+LMQELP TGKT A+GV+NFS++ +K L+
Sbjct: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
           +SP NK+VPAA+Q+E HP LPQN++++FCK+  I++EAYSP GS  APLL+E  + +++K
Sbjct: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K  V PAQL++SW +QRG+ VL KS  P RI +N   F +PE D + I+ L++  G KR+
Sbjct: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300

Query: 300 HNPTWFSF 307
            +  W SF
Sbjct: 301 VDMKWSSF 308

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  382 bits (980), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 235/308 (76%), Gaps = 1/308 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M   LK  +AT KLNTGA IP+LG GTWRS   +GY++ +AA+KAGYRHID AA+ +NE+
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VG+AI+DSGVPREE+F+TTKLW T+ RDP+ AL +SLKRLGLDYVDLY+MHWPV  +++
Sbjct: 61  EVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            +   +++ IP  +DG  DVD + W++VKTW+LMQ+LP TGKT A+GV+NFS++ +K+L+
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            SP NK+VPA +Q+E HP LPQ+++++FCK+  I++EAYSP GS  APLL E  + +++K
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K  VEPAQL++SW +QRG+ VL KS  P R+ +N   F +PE D + I+ L++  G KR+
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 300 HNPTWFSF 307
            N  W SF
Sbjct: 301 VNMQWNSF 308

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  379 bits (973), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 169/308 (54%), Positives = 232/308 (75%), Gaps = 1/308 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M   L+  +AT KLNTGA IP LG GTWRS   NGY++ +AA+K GYRHID AA+ +NE+
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VGRAI+DSG+ REE+F+TTKLW T+ RDP+ AL++SLKRLGLDYVDLY+MHWPV  +++
Sbjct: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            V   N + IP  +DG  DVD + W+++KTW+LMQELP TGKT A+GV+NFS++ +K+L+
Sbjct: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            SP NK+VPA +Q+E HP LPQ+++++FCK+  I++EAYSP GS  APLL E  + +++K
Sbjct: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K  VEP+QL++SW +QRG+ VL KS  P R+ +N   F +PE D + I +L++  G KR+
Sbjct: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 300 HNPTWFSF 307
            N  W SF
Sbjct: 301 VNMKWASF 308

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  373 bits (958), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 231/305 (75%), Gaps = 2/305 (0%)

Query: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGR 64
           L K T+T KLNTGA IP++GLGTW+S++  GYNATL A+KAGYRHID AA+  NE+ +GR
Sbjct: 4   LHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGR 63

Query: 65  AIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH 124
           AIRDS +PR ELFVTTKLW TQHR+P  AL QSLKRLGLDYVDLY+MHWPVA +++ +K 
Sbjct: 64  AIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKD 123

Query: 125 TNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183
            N + IP+R+DG  DVD E W++VKTWELMQELP   K  A+GV+NFS++ LK+L++S G
Sbjct: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKG 182

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
           NK+VPAA+Q+E HP LPQ+++++FCK+  I++EAYSPLGS  AP+L E  + EI+KK  V
Sbjct: 183 NKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGV 242

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPT 303
              QL++SW  QRG+ VL KS  P RI  N  TF + + D   ++  A++ G +R+ +P 
Sbjct: 243 NAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPN 302

Query: 304 WFSFE 308
           W  F+
Sbjct: 303 WGPFK 307

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  372 bits (956), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 224/309 (72%), Gaps = 1/309 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M+T L   T T  LNTGAQIP +GLGTW+S   + Y + LAA+KAGY+HID AA+  NE 
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VG+AI+DSGVPREE+FVTTKLW TQH +P  AL +SL+RLGLDYVDLY++HWP    + 
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            +K  + + +P + DG   VD   W+++KTWELMQELP TGKT A+GV+NFS++ LK L+
Sbjct: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            SPGNK+ PAA+Q+E HP LPQN++++FCK   I++EAYSPLGS  APLL EP + +I+K
Sbjct: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K +V+P  +++SW  QRG+ VL KS  P RIE N   F +   D   IN +++E+G KR+
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 300 HNPTWFSFE 308
            NP W  FE
Sbjct: 301 VNPNWSPFE 309

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  372 bits (956), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 173/309 (55%), Positives = 225/309 (72%), Gaps = 1/309 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M+  L+  T T  LNTGA+IP +GLGTW+S   + Y + +AA+K GYRHID AA+  NE 
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNED 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VG+AI+DSGVPREE+FVTTKLWCTQH +P  AL QSLKRLGLDYVDLY+MHWPV     
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPN 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            +K  + + IP ++DG   VD   W+++KTWELMQELP T KT A+GV+NFS++ LK L+
Sbjct: 121 YIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLL 180

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            SPGN++ PAA+Q+E HP LPQN+++ FCK   I++EAYSPLGS  APLL EPVV EI+K
Sbjct: 181 ASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAK 240

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K +V+P  +++SW  QRG+ VL KS  P RI+ N   F + + D   IN +++E+G KR+
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRV 300

Query: 300 HNPTWFSFE 308
            NP W  FE
Sbjct: 301 VNPDWSPFE 309

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 168/307 (54%), Positives = 230/307 (74%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M+  L   T+T KLNTG  IP +GLGTWRS + +GY A  AA+KAGYRHID AA+ +NE+
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VG+AIRDSG+PREELF+TTKLW TQ R+P+ AL QSL+RLGL+YVDLY+MHWPV  +++
Sbjct: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120

Query: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180
           ++   N +  P ++DG+PDVD  WD+VKTWELMQELP T K  ++GV+NFS++ LK+L+ 
Sbjct: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA 180

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
           SPGNK+VPA  Q+E HP LPQ  +  FCK++NI +EAYSPLG  GAP+LD+P++++I+ +
Sbjct: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
            + +   ++VSWG+QRG   L KS TP R+ +NL TF + + ++  IN L++ RG KR +
Sbjct: 241 HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTN 300

Query: 301 NPTWFSF 307
            P    F
Sbjct: 301 APDMSPF 307

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  370 bits (951), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 224/309 (72%), Gaps = 1/309 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M   L   T    LNTGAQIP +GLGTW+S + + Y A L A+K GYRHID AA+  NE 
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VG+AI+DSGVPREE+FVTTKLWCTQH +P+ AL QSLKRLGLDYVDLY+MHWP      
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            +K+ + + +P +KDG   VD   W+++KTWELMQELP TGKT A+GV+NFS++ LK L+
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            S GNK+ PAA+Q+E HP LPQ+++++FCK   I++EAYSPLGS  APLL EPV+ EI+K
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K +V+P  +++SW +QRG+ VL KS  P RI+ N   F +   D   IN +++E+G KR+
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 300 HNPTWFSFE 308
            +P W  FE
Sbjct: 301 VHPNWSPFE 309

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  369 bits (948), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 224/309 (72%), Gaps = 1/309 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M   L+  T T  LNTGAQIP +GLGTW+S   + Y + LAA+K GYRHID AA+  NE 
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VG+AIRDSGVPRE++FVTTKLWCTQH +P  AL QSL+RLGLDYVDLY+MHWPV    +
Sbjct: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            +K  N + +P ++DG   VD   W+++KTWELMQELP TGK  A+GV+NFS++ LK L+
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            S GNK+ PAA+Q+E HP LPQN+++ FC+   I++E YSPLGS  APLL EPV+ EI+K
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K +V+PA +++SW  QRG+ VL KS  P R++AN   F + + D   IN +++ +G KR+
Sbjct: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300

Query: 300 HNPTWFSFE 308
            +P W  FE
Sbjct: 301 VHPNWSPFE 309

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  367 bits (943), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/302 (57%), Positives = 223/302 (73%), Gaps = 2/302 (0%)

Query: 8   CTATAKLNTGAQIPLLGLGTWRSTKEN-GYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI 66
            T T KLNTGA I  +GLGTW+ST EN GY A +AA+KAGYRHID AA+  NE  VG+AI
Sbjct: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76

Query: 67  RDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTN 126
            DSGVPREE+FVTTKLW TQH DP   L+ SLKRLGLDYVDLY+MHWPV      +K  N
Sbjct: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136

Query: 127 YMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNK 185
           ++ IP   DG+ DV+ + WDYVKTWELMQELP TGKT A+GV+NFS++ LKK++ SPGNK
Sbjct: 137 FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNK 196

Query: 186 IVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEP 245
           +VPA +Q+E HP LPQ ++L +C    IL+EAYSPLGS  AP+L EPV+  ++KK  V+ 
Sbjct: 197 VVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQT 256

Query: 246 AQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTWF 305
           AQ+++SW +QRG+ VL KS    RI+AN  T  + + ++R IN +++E+G +RI  P W 
Sbjct: 257 AQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHWE 316

Query: 306 SF 307
            F
Sbjct: 317 PF 318

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  365 bits (938), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 228/310 (73%), Gaps = 2/310 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKE-NGYNATLAAIKAGYRHIDIAAVCMNE 59
           M+  L K T+  KLNTGA I  +GLGTWRS    + Y++ +AA++AGYRHID AA+  NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 60  QVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRS 119
             VGRAIR+SGVPR E+FVTTKLWCTQH++P+ AL QSLKRLGLDYVDLY+MHWPV  R 
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 120 EQVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
           E +   + +  P   +G+ D+D   W++VKTWELMQ+LP TGKT A+GV+NFS++ LK L
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 179 IDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREIS 238
           + SPGNKIVPAA+Q+E HP LPQ +++ FC    I++EAYSPLGS  AP+L EPV+ EI+
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 239 KKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKR 298
           KK  V  AQ+++SW +QRG+ VL KS    RIEANL TF +   D   +N +++ +GTKR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 299 IHNPTWFSFE 308
           I +P W  F+
Sbjct: 301 IIDPDWEPFK 310

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  364 bits (935), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 224/304 (73%), Gaps = 1/304 (0%)

Query: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGR 64
           LK  TAT KLNTGA+IP++GLGTWRS   +GY++ LAA+K GYRHID AA+  NE  VGR
Sbjct: 3   LKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVGR 62

Query: 65  AIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH 124
           AI+DSGVPR+E+F+TTKLW T+HR+P  AL  SLKRLGLDYVDLY+MHWPVA ++   + 
Sbjct: 63  AIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSEE 122

Query: 125 TNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183
            + + IPK+ DG+ D+D E WD++KTWELMQELP TGKT A+GV+NFS++ LK L +SP 
Sbjct: 123 KDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSPK 182

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
              VPAA+Q+E HP  PQ +++ +CK  NIL+EAYSP GS  AP+L EP + ++++K ++
Sbjct: 183 FNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYNI 242

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPT 303
             AQL++SW +QRG+ VL KS    RIEANL    + + D+  I  L++ +G KR+    
Sbjct: 243 STAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQLD 302

Query: 304 WFSF 307
           W  F
Sbjct: 303 WSPF 306

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  358 bits (918), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 178/309 (57%), Positives = 234/309 (75%), Gaps = 2/309 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRST-KENGYNATLAAIKAGYRHIDIAAVCMNE 59
           MT  LK  TAT KLNTGA IP + LGTWRS    +GY++ +AA+KAGYRHID AA+  NE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 60  QVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRS 119
             VG+AIRDSG+PREE+FVT+KLW TQ  +P  AL  +L RLGLDY+DLY+MHWPV F +
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 120 EQVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
             VK T++M+IPK ++G+PD++ + W++VKTWELMQELPATG T A+GV+NFS++ LK+L
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 179 IDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREIS 238
           + SPGNK+ PAA+Q+E HP LP++ ++ FC++  I++EAYSPLGS  AP+L EP + EIS
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 239 KKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKR 298
           KKL V PAQL++SW +QRG+ VLVKS    RI AN   F + + D   I  LA+E+GT R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 299 IHNPTWFSF 307
           + +P W  F
Sbjct: 301 VVDPDWSPF 309

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  354 bits (908), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 229/309 (74%), Gaps = 2/309 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKEN-GYNATLAAIKAGYRHIDIAAVCMNE 59
           M + L+  T T KLNTGA +P+LGLGTWR+T +  GYNA  +A++AGYRHID AA+  NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 60  QVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRS 119
           +VVGRAIR+SG+PR+E+FVTTKLW TQHRDP  AL QSL+RLGLDYVDLY+MHWPV   +
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 120 EQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
           +  K ++ +  P R DG   V+  WD++KTWELMQELP T KT A+GV+NFS++ +  L+
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVESDWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDLL 179

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            SPGNKIVPAA+Q+E HP LPQ ++++FC++  I++EAYSP GS  APLL E  + E++K
Sbjct: 180 KSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAK 239

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K  V  AQ+++SW ++RG AVL KS    R+ +N  TF +PE D   IN +++E+G KR+
Sbjct: 240 KHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKRV 299

Query: 300 HNPTWFSFE 308
            N  W  F+
Sbjct: 300 VNFDWSPFK 308

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  353 bits (906), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 162/299 (54%), Positives = 223/299 (74%), Gaps = 2/299 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M+  LK CTAT KLNTGA IP +GLGTWRS   +GY++ +AA K GYRHID AA+  NE 
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNED 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VG+AI + GV R ELFVTTKLW TQ RDP+TAL+QSLKRLGLDYVDLY++HWPVAF+++
Sbjct: 61  QVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTD 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            +K  N + IPK KDG+ D+D   W+++KTWELMQ L  TGKT A+G++NFS++ +K+L+
Sbjct: 121 TIKDGNLLTIPK-KDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            +P   + PA +Q+E HP LPQ+++++FCK+  I++EAYSPLG   AP+L +  + EI+K
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKR 298
           + +V+  Q++ SW +QRG+ VL KS   SRI +NL TF + + D+ +IN L + +G  R
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENR 298

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  352 bits (903), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 167/305 (54%), Positives = 223/305 (73%), Gaps = 2/305 (0%)

Query: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGR 64
           LK C    KLNTGA++P +GLGTW+S + + Y A L A+K GYRHID AA+  NE  VG+
Sbjct: 3   LKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVGK 62

Query: 65  AIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH 124
           AIRDSGVPR E+FVTTKLW TQ R P+ AL QSL+RLGLDYVDLY++HWP+     Q + 
Sbjct: 63  AIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCEE 122

Query: 125 T-NYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSP 182
           + NY+  P   +G+ DVD + W++VKTWELMQELPATGK  A+GV+NFS++ +K+L+ SP
Sbjct: 123 SGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSSP 182

Query: 183 GNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLH 242
           GNK+VPA +Q+E HP LPQ ++++FCK+  I++EAYSPLG  GA +L EP+V E++KK +
Sbjct: 183 GNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKYN 242

Query: 243 VEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNP 302
           +  A L+VSW +QRG  VL KS T SRI +NL T  +   D+ +I  L++E+G KR   P
Sbjct: 243 IPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTCAP 302

Query: 303 TWFSF 307
            +  F
Sbjct: 303 DFSPF 307

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  343 bits (880), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 212/296 (71%), Gaps = 1/296 (0%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRDSGVP 72
           KLNTGA IP++GLGTW+S +E+ YNA ++A++ GYRHID AA+  NE+ VG+ IRDSGVP
Sbjct: 11  KLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGIRDSGVP 70

Query: 73  REELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNYMLIPK 132
           REE+FVTTKLW TQ RDP+ AL  SL+RLGLDYVDLY++HWPV   +  +   NY+  P+
Sbjct: 71  REEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDGNYLTFPR 130

Query: 133 RKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNKIVPAAS 191
             DG+ D+D E W+++KTWE MQ LP +GKT A+GV+NFS+  ++ L+ +  + IVPAA+
Sbjct: 131 TADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPDFIVPAAN 190

Query: 192 QLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEPAQLLVS 251
           Q+E HP LPQ +++ +CK   IL+EAYSPLGS  + +L +P +  I+ K + EPA +L+S
Sbjct: 191 QIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAEPANILIS 250

Query: 252 WGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTWFSF 307
           WG  RG+ VL KS  P RI+ NL   D+   DL +IN+L +  G KR   P +  F
Sbjct: 251 WGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPDFSPF 306

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  342 bits (878), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 158/308 (51%), Positives = 215/308 (69%), Gaps = 1/308 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M   LK       LN G +IP +GLGTW+S + +GYN+ + A+KAGYRHID AA+  NE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VGRAI+DSGVPR+++F+TTKLWCT+ ++PK AL  SLKRLGLDYVDLY+MHWPV     
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            +K  +Y+++P+  DG  DVD E WDY+KTWEL+QELPATG T ++GV+NFS++ L+K++
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            SPGNK+ PA +Q+E HP LPQ ++  +C    I +EAYSP GS+ AP L +  + +I+ 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K  V PAQ++ SW +QR   VL KS    R+ +N   FD+ + D+  I+ LA+  G KRI
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 300 HNPTWFSF 307
           + P W  F
Sbjct: 301 NKPDWDPF 308

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  341 bits (874), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 212/294 (72%)

Query: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGR 64
           L+  T+T KLNTG  IP +GLGTWRS +  GY A + A+KAGYRHID AAV  NE  VG+
Sbjct: 4   LQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGK 63

Query: 65  AIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH 124
           AI+DSGVPR E+F+TTKLWCTQ R+P+ AL QSL+RLGLDYVDLY++HWPV  R+E +K 
Sbjct: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123

Query: 125 TNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGN 184
            N     ++ DG  DVD  W+++KTWELMQ+L  +GKT A+GV+NFSV+ LK L+ +P  
Sbjct: 124 GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTT 183

Query: 185 KIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVE 244
           K+ PA +Q+E HP LPQ  ++ F K+N I++EAYSPLG E AP+L +P V+EI+K   VE
Sbjct: 184 KVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVE 243

Query: 245 PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKR 298
              +++SW +Q+G   L KS TPSRI  NL    + + D+ +++ L + +G +R
Sbjct: 244 AGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERR 297

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  340 bits (873), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 164/305 (53%), Positives = 214/305 (70%), Gaps = 3/305 (0%)

Query: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGR 64
           L   TA   LN G Q+P +GLGTW+S + + Y A +AA+KAGYRHID AA+  NE+ VGR
Sbjct: 3   LSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62

Query: 65  AIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQV-K 123
           AI+DSGV R E+FVTTKLW TQHR P  AL+QSL+RLGLDYVDLY+MHWPV     Q  K
Sbjct: 63  AIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122

Query: 124 HTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSP 182
             NY+ IP  +DG  D+D   WD++KTWELMQ LP + K  ++GV+NFS++ +K L+ SP
Sbjct: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASP 181

Query: 183 GNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLH 242
           GNK VP  +Q+E HP LPQ +++ FCK  NI++EAYSPLGS GAP+L+   + E+SKKL 
Sbjct: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241

Query: 243 VEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNP 302
           + PA ++ SW +QR   VL KS T SRI +NL T ++P  +  ++N ++ E G KR   P
Sbjct: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKP 301

Query: 303 TWFSF 307
            W  F
Sbjct: 302 NWTPF 306

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  340 bits (871), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 225/301 (74%), Gaps = 1/301 (0%)

Query: 8   CTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR 67
            T   ++NTG  IP+LGLGTW++   + Y A LAA+++GYRHID AA+  NE  VGRAIR
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 68  DSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNY 127
           DSGVPRE++FVTTKLWCTQ RDP++AL+ SL+RLGLDYVDLY+MH+PVA +++ +K  N 
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 128 MLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNKI 186
           + IP R DG  DVD +GW +VKTW+LMQ+LP +GKT A+GV+NFS+  +++++       
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 187 VPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEPA 246
           VPAA+Q+E HP LPQ++++ +CK   I++EAYSPLGS  + +L +P + ++++K  VEPA
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 247 QLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTWFS 306
           Q+L+SWG+ RG+ +L KS    R+++NL    +   D+++I+++ ++ G+KR  +P+W  
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 307 F 307
           F
Sbjct: 302 F 302

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  340 bits (871), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 225/301 (74%), Gaps = 1/301 (0%)

Query: 8   CTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR 67
            T   ++NTG  IP+LGLGTW++   + Y A LAA+++GYRHID AA+  NE  VGRAIR
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 68  DSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNY 127
           DSGVPRE++FVTTKLWCTQ RDP++AL+ SL+RLGLDYVDLY+MH+PVA +++ +K  N 
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 128 MLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNKI 186
           + IP R DG  DVD +GW +VKTW+LMQ+LP +GKT A+GV+NFS+  +++++       
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 187 VPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEPA 246
           VPAA+Q+E HP LPQ++++ +CK   I++EAYSPLGS  + +L +P + ++++K  VEPA
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 247 QLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTWFS 306
           Q+L+SWG+ RG+ +L KS    R+++NL    +   D+++I+++ ++ G+KR  +P+W  
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 307 F 307
           F
Sbjct: 302 F 302

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  339 bits (869), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 222/307 (72%), Gaps = 2/307 (0%)

Query: 3   TVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVV 62
           TV    T + KLNTGA +P +GLGTW+S++E+ Y A L+A+KAGY+HID AA+  NE+ V
Sbjct: 2   TVTSTKTPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERAV 61

Query: 63  GRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQV 122
           G+AIRDSG+PR+ELF+TTKLW TQHRDPK AL  SL+RLGLDYVDLY++H+PVAF+++++
Sbjct: 62  GKAIRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRI 121

Query: 123 KHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDS 181
           +  N    P   +G+ DVD   WD+VKTW L+Q LP +GK  A+GV+NFS++ LK L++S
Sbjct: 122 EDGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLES 181

Query: 182 PGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK- 240
                VPA +Q+E HP LPQ +++ FCK  +I++EAYSPLGS G+ +L +  +++I++K 
Sbjct: 182 DEKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKX 241

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
              +PAQ+L++WG+ RG+ VL KS TP RIEAN    DI + DL ++  L    G KR  
Sbjct: 242 XDAQPAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYL 301

Query: 301 NPTWFSF 307
            P W  F
Sbjct: 302 EPDWSPF 308

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  336 bits (861), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 220/309 (71%), Gaps = 3/309 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKE-NGYNATLAAIKAGYRHIDIAAVCMNE 59
           M+  LK  T T KLN G+QIP++GLGTW++T E + YNA  AA+ AGYRHID AA+  NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 60  QVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRS 119
             VG AIRDSGVPREE+FVTTKLW  QH +P+ AL +SL+RLGLDYVDLY+MHWPV+   
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 120 EQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
             +K +   L+ KR DG   V+  W ++ TWELMQ+LP   K  ++GV+NFSV+ LK L+
Sbjct: 121 SYMKESPLELM-KRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLL 178

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            +P   +VP  +Q+E HP LPQ +++ +C++N I +EAYSPLGS  APLL EP+V +++K
Sbjct: 179 KAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAK 238

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           K  V+PA +++SW +QR   VL KS    R+ ANL TF +PE D   I +++Q+RG +RI
Sbjct: 239 KNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRI 298

Query: 300 HNPTWFSFE 308
           +NP +  F+
Sbjct: 299 NNPNFEPFK 307

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  328 bits (842), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/303 (51%), Positives = 213/303 (70%), Gaps = 8/303 (2%)

Query: 13  KLNTGAQIPLLGLGTWRSTKEN-GYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRDSGV 71
           KL+TGA IP +GLGTWRS   N  Y++ +AA+K GYRHID AA+  NE  VG+AIRDSGV
Sbjct: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSGV 71

Query: 72  PREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTN----- 126
           PR E+FVT+KLWC Q  DPK AL+Q+LKRLGLDY+DLY+MHWPV F    +K  +     
Sbjct: 72  PRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDA 131

Query: 127 YMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNK 185
           +M IP   +G  DV+ + W+++KTWELMQ LP +GKT A+GV+NFS++ L  L+ +   K
Sbjct: 132 FMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTTK 191

Query: 186 IVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEP 245
           +VPAA+Q+E HP L QN++L +CK+ NIL+EAYSP GS  AP+L +  +  I+KKL ++ 
Sbjct: 192 VVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQV 251

Query: 246 AQLLVSWGLQR-GHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTW 304
            Q+++SW +QR G+ VL KS    RI AN     +P+ D + IN L +E+G  R+ +P W
Sbjct: 252 GQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPDW 311

Query: 305 FSF 307
             F
Sbjct: 312 SPF 314

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  327 bits (839), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 151/308 (49%), Positives = 207/308 (67%), Gaps = 2/308 (0%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M+   K C  T  +    +IP + LGTW++     Y A L A+KAGYRHID AA+  NE+
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VG+AIRDSG+PR+++FVTTKLW T+ R+P  AL  SLKRLGLDYVDLY+MHWPVA +++
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
            +   + + IPK   G+ D+D E W+++KTWELMQELP T K  A+GV+NFS++ L +L+
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNELL 179

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
            +P  K +PAA+Q E HP LPQN+++ +C+   I++EAY PLG    PL+  PV+ EI+ 
Sbjct: 180 AAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIAT 239

Query: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
           KL V   QLL+SWG+QRG+ VL KS    RI  N  T  IP  +  ++N L +E G +R 
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRS 299

Query: 300 HNPTWFSF 307
            N  +  F
Sbjct: 300 VNIDFSPF 307

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  310 bits (795), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 202/293 (68%), Gaps = 3/293 (1%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRDSGVP 72
           KLNTGA IP LG GTW S+  + Y A + A+K GYRHID AA+  NE  VG+ IRDSG+P
Sbjct: 12  KLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSGIP 71

Query: 73  REELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNYMLIPK 132
           REE+FVTTKLW TQ RDP +AL +SL+RLGLDYVDL+++HWPV  +   V     +L   
Sbjct: 72  REEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKP--VGGPENLLKYP 129

Query: 133 RKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNKIVPAAS 191
               +P +D E W ++KTWELMQ LP TGKT A+GV+NFS+  L+ L++S  + +VPA +
Sbjct: 130 TPGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPAVN 189

Query: 192 QLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEPAQLLVS 251
           Q E HP LPQ +++++CK   I++EAY PLGS  + +L +P + EI+ K HV+PA +L++
Sbjct: 190 QFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVLIN 249

Query: 252 WGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTW 304
           WG+ RG+ VL KS TP+RI +N     +   D  RI +L++  G KR  +P +
Sbjct: 250 WGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDF 302

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  302 bits (774), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 209/307 (68%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           M   LK CT T  LN G +IP++GLGT+ S +   Y A + A KAGYRH+D AA   NE+
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            VG+A++D GVPR E++VTTK+W T+ RDP+ AL +SLKRLGL+Y+DLY+MHWPV  +++
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180
            +K    M IP+  DG  DVD+ W +V+ WE MQ+L  +GK  ++GV+NFS++ +K+L+ 
Sbjct: 121 TIKDGELMCIPRLPDGNADVDKDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELLA 180

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
           +P   +VP  +Q+E  P LP ++++ FC+  +I+ +AY P G   APL+ +  V EI+K 
Sbjct: 181 APTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAKG 240

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
             V+  Q++ SW +QRG+ VL KS   SRI +NL TF + + D+ ++N +++ +G KR++
Sbjct: 241 NGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRLN 300

Query: 301 NPTWFSF 307
           N  +  F
Sbjct: 301 NVNFSPF 307

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  296 bits (758), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 142/303 (46%), Positives = 210/303 (69%)

Query: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGR 64
           LK  T T  LNTGA+IPL GLGTW+ST ++  +A  AA+K GY+HID A+   NE++VG+
Sbjct: 7   LKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELVGK 66

Query: 65  AIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH 124
           A+++SG+PREELF+TTK+W  Q RDP  AL  SLK+LG +YVDL +MHWPV F+  +   
Sbjct: 67  AVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPENST 126

Query: 125 TNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGN 184
            +   +P+  DG+   DE WD+VKTW LMQ+L  TGK  A+GV+NFS++ L++L+++ G 
Sbjct: 127 LDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNAEGT 186

Query: 185 KIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVE 244
            +VPA +Q+E H  LPQ +++ +C+K  I++EAYSPLGS  APLL +  V ++++K  V 
Sbjct: 187 TVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKYGVT 246

Query: 245 PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTW 304
           PA +L+++   RG  VL KS   SRI +N   F + E D++ +N++ ++ G +R  +P +
Sbjct: 247 PAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVDPDF 306

Query: 305 FSF 307
             F
Sbjct: 307 SPF 309

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  213 bits (543), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 182/299 (60%), Gaps = 19/299 (6%)

Query: 14  LNTGAQIPLLGLGT------WRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR 67
           LN G +IP +GLGT      +  TKE    A  AAI+AGYRHID A     E  +G+A++
Sbjct: 13  LNNGTRIPAIGLGTASPKDRYPETKE----AVKAAIRAGYRHIDTAYFYKTEPYIGQALK 68

Query: 68  D----SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVK 123
           +    + + REELF+TTK+W T   +P  ++ QSLK LG+DYVDL + HWPV F+  +  
Sbjct: 69  ELFESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVENS 128

Query: 124 HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQLKKLID 180
             N + +P+ KDG    ++  D++ T++ ++++   P   +  A+GV+N+ +  L++L  
Sbjct: 129 QGNIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLFK 188

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
               K+ PA +Q+E HP LPQ ++  FC  + IL+ AYSPLGS+GAP L    V++++KK
Sbjct: 189 E--CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAKK 246

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
             VEPA +L S+ + +G+ VL +S  P RI AN+    + + DL +++++  +   + I
Sbjct: 247 YKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVGIDEPNRFI 305

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  206 bits (523), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 177/291 (60%), Gaps = 19/291 (6%)

Query: 14  LNTGAQIPLLGLGT------WRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI- 66
           LN G +IP +GLGT      +  TK+    A  AAI+AGYR ID A     E  +G A+ 
Sbjct: 13  LNNGGRIPAIGLGTASPKGRYPETKK----AVKAAIRAGYRQIDTAWYYKTEPYIGEALK 68

Query: 67  ---RDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVK 123
              RD  + RE+LF+TTK+W     DP T++++SLK LG+DYVD+ + HWP+ ++    +
Sbjct: 69  ELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKKTYDE 128

Query: 124 HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQLKKLID 180
           +   +  P  KDG+    EG D++ T++LM+++   P   +  A+GV+N+ +  L+++I 
Sbjct: 129 NGTIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLERVIK 188

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
               K+ P  +Q+E HP LPQ ++  FC KN IL+ AYSPLGS GAP    P+V+E +KK
Sbjct: 189 E--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEYAKK 246

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELA 291
             V PA +L S+ +++G+ V+ +S  P R+ +N++   + + +++ +++  
Sbjct: 247 HEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFG 297

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  197 bits (502), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 175/299 (58%), Gaps = 14/299 (4%)

Query: 13  KLNTGAQIPLLGLGTW--RSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD-- 68
           KLN G  +P LGLGT   R        A  AAIKAGYRHID A     E  +G A+++  
Sbjct: 12  KLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKELL 71

Query: 69  --SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTN 126
               V R +LF+T+K+W     D   +L++SLK LGLDYVDLY+ HWP+ F+  +     
Sbjct: 72  ENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQKIEDSKDG 131

Query: 127 YMLI---PKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQLKKLID 180
              +   P  KDG   + EG DY+ T++ M+++   P   +  A+GV+N+ V  L +L+ 
Sbjct: 132 VNGLKGKPIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLDRLLK 191

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
               K  PA +Q+E HP LPQ ++  FC+ ++I + AYSPLGS GAPLL  P+V+E+S+K
Sbjct: 192 VCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPLVKELSEK 249

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
             V    +L+S+ +++G  V+ +S  P R+   ++   + EG+L +++++ ++   + I
Sbjct: 250 YQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGRKDSIRYI 308

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  194 bits (492), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 107/290 (36%), Positives = 175/290 (60%), Gaps = 11/290 (3%)

Query: 14  LNTGAQIPLLGLGTWRSTKE--NGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD--- 68
           LNTGA+IP LGLGT    ++     +A   A+K GYR ID A +  +E  +G A+++   
Sbjct: 13  LNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQELFE 72

Query: 69  -SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNY 127
              V RE+LF+TTK+W   +   + +L +SLK+L LDYVDL + HWP+ F  +  +H   
Sbjct: 73  EGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHGKL 132

Query: 128 MLIP-KRKDGQPDVDEGWDYVKTWELMQEL--PATGKTNALGVANFSVSQLKKLIDSPGN 184
              P   K G   +DE  DY+ TW+ ++++    +G+   +GV+N+ V  L++L+     
Sbjct: 133 KSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE--T 190

Query: 185 KIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVE 244
           ++VP  +Q+E HP LPQ ++  +C  + ILME++SPLGS G P L+ P+V+E+SKK   E
Sbjct: 191 EVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKYDCE 250

Query: 245 PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQER 294
           P  +L+++ +++G+ V+ +S    RI  N     + E DL +++ L +E+
Sbjct: 251 PGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREK 300

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  193 bits (490), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 110/309 (35%), Positives = 184/309 (59%), Gaps = 17/309 (5%)

Query: 14  LNTGAQIPLLGLGTWRSTKE--NGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD--- 68
           LN G ++P LGLGT    ++      A  AAIKAGYRHID A     E  VG AI++   
Sbjct: 27  LNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLE 86

Query: 69  -SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH--- 124
              + RE+LF+TTK+W     + + +LS+SLK +GLDYVDL++ HWP+ F  E+VK    
Sbjct: 87  EGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCF--EKVKDPKG 144

Query: 125 -TNYMLIPKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQLKKLID 180
            +  +  P  K G+  +    D+++T++ ++++   P   +  A+GV+NFS+  L++L+ 
Sbjct: 145 ISGLVKTPVHKSGEAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLVK 204

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
               ++ P  +Q+ETHP LPQ ++  FC  ++IL+ AYSPLGS GAP L  P+V+++ +K
Sbjct: 205 E--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLVEK 262

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
            +V    +L+S+ +++G  V+ +S  P RI +++    + + +L+ +N+  ++   + I 
Sbjct: 263 YNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDFGEKYPVRFID 322

Query: 301 NPTWFSFEE 309
            P   S  E
Sbjct: 323 EPFAASLPE 331

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  192 bits (489), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/303 (36%), Positives = 180/303 (59%), Gaps = 17/303 (5%)

Query: 14  LNTGAQIPLLGLGTWRSTKE--NGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD--- 68
           LN G +IP LGLGT    ++      A  AAIKAGYRHID A     E  VG AI++   
Sbjct: 27  LNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLE 86

Query: 69  -SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH--- 124
              + RE+LF+TTK+W     +   +L++SLK LGLDYVDL + HWP+ F   +VK    
Sbjct: 87  EGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFG--KVKDPEG 144

Query: 125 -TNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATG---KTNALGVANFSVSQLKKLID 180
            + YM +P    G+       D+++T++ ++++       +  A+GV+NFS+  L++LI 
Sbjct: 145 ISGYMKLPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERLIK 204

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
               K+ P  +Q+E+HP LPQ ++  FC  ++IL+ AYSPLGS+GAP L  P+V+++ +K
Sbjct: 205 E--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLCEK 262

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
            +V    LL+S+ +++G  V+ +S  P RI +N+    + + +L+ +NE  ++   + + 
Sbjct: 263 YNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGEKYPVRFMD 322

Query: 301 NPT 303
            P+
Sbjct: 323 VPS 325

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  192 bits (488), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 179/302 (59%), Gaps = 17/302 (5%)

Query: 14  LNTGAQIPLLGLGTWRSTKE--NGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR---- 67
           LN G +IP LGLGT    ++      A  AAIKAGYRHID A     E  VG AI+    
Sbjct: 27  LNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLE 86

Query: 68  DSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH--- 124
           D  + RE+LF+TTK+W     +   +L++SLK LGL+YVDL + HWP+ F  E++K    
Sbjct: 87  DGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCF--EKIKDPKG 144

Query: 125 -TNYMLIPKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQLKKLID 180
            +  +  P    G+       DY++T++ ++++   P   +  A+GV+NFS+  L++LI 
Sbjct: 145 ISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLIK 204

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
               ++ P  +Q+ETHP LPQ ++  FC  ++IL+ AYSPLGS GAP L  P+V+++++K
Sbjct: 205 E--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLVKKLAEK 262

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
            +V    LL+S+ +++G  V+ +S  P RI +++    + + +L+ +N+  ++   + I 
Sbjct: 263 YNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDFGEKYPVRFID 322

Query: 301 NP 302
            P
Sbjct: 323 EP 324

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  191 bits (486), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 179/302 (59%), Gaps = 17/302 (5%)

Query: 14  LNTGAQIPLLGLGTWRSTKE--NGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR---- 67
           LN G +IP LGLGT    ++      A  AAIKAGYRHID A     E  VG AI+    
Sbjct: 27  LNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLE 86

Query: 68  DSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH--- 124
           D  + RE+LF+TTK+W     +   +L++SLK LGLDYVDL++ HWP+ F  E+VK    
Sbjct: 87  DGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCF--EKVKDPKG 144

Query: 125 -TNYMLIPKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQLKKLID 180
            +  +  P    G+       D+++T++ ++++   P   +  A+GV+NFS+  L++LI 
Sbjct: 145 LSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEYLERLIK 204

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
               ++ P  +Q+ETHP LPQ  M  FC  ++IL+ AYSPLGS GAP L  P+V+++++K
Sbjct: 205 E--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLTEK 262

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
            ++    +L+S+ +++G  V+ +S  P RI +++    + + +L+ +N+  ++   + I 
Sbjct: 263 YNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDFGEKYPVRFID 322

Query: 301 NP 302
            P
Sbjct: 323 EP 324

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  190 bits (482), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/302 (36%), Positives = 178/302 (58%), Gaps = 17/302 (5%)

Query: 14  LNTGAQIPLLGLGTWRSTKE--NGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD--- 68
           LN G +IP LGLGT    ++      A  AAIKAGYRHID A     E  VG AI++   
Sbjct: 27  LNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVGEAIKELLE 86

Query: 69  -SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH--- 124
              + RE+LF+TTK+W     +   +L++SLK LGLDYVDL + HWP+ F  E+VK    
Sbjct: 87  EGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCF--EKVKDPKG 144

Query: 125 -TNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATG---KTNALGVANFSVSQLKKLID 180
            +  +  P    G+       D+++T++ ++++       +  A+GV+NFS+  L++LI 
Sbjct: 145 ISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERLIK 204

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
               K+ P  +Q+E+HP LPQ ++  FC  ++IL+ AYSPLGS+GAP L  P+V+++ +K
Sbjct: 205 E--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLCEK 262

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
            +V    LL+S+ +++G  V+ +S  P RI +N+    + + +L+ +NE  ++   + I 
Sbjct: 263 YNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGEKYPVRFID 322

Query: 301 NP 302
            P
Sbjct: 323 EP 324

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  189 bits (480), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 178/299 (59%), Gaps = 14/299 (4%)

Query: 13  KLNTGAQIPLLGLGTW--RSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD-- 68
           KLN G  IP LG GT+  R        A  AAIKAGYRHID A V  +E  VG AI++  
Sbjct: 12  KLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGEAIKEMI 71

Query: 69  --SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAF-RSEQVKHT 125
               V R +LFVTTK+W     + + +L++SL+ LGLDYVDL + HWP+ F R E  K+ 
Sbjct: 72  EEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPRVEDEKNG 131

Query: 126 NYMLI--PKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQLKKLID 180
              L+  P+  +G+P ++E  D+++T+  ++++   P   +  A+GV+N+++  L+ L  
Sbjct: 132 VNGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIEYLEALFK 191

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
               K+ P  +Q+E HP LPQ ++  FC  + IL+ AYSPLGS+GAP L  P+V ++++K
Sbjct: 192 E--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPLVHQLAEK 249

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
             +    +L+S+ +++G+ V+ +S  P RI + +      + +L++++ +  E   + +
Sbjct: 250 YDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVGIEEPARFV 308

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  187 bits (476), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 171/298 (57%), Gaps = 13/298 (4%)

Query: 14  LNTGAQIPLLGLGTWRSTKE--NGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD--- 68
            N G ++P  GLGT    +       A  AAIKAGYRHID A     E+ VG A+++   
Sbjct: 13  FNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELFE 72

Query: 69  -SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNY 127
              V RE+L +T+K+W T   D   +L++SL RL +DYVDL++ HWP+  +     H   
Sbjct: 73  ERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPLCTQKVPDPHGVD 132

Query: 128 MLI--PKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQLKKLIDSP 182
            +   P    G P  DE  D+++T++ ++++       +  A+GV+NF +  LK+++   
Sbjct: 133 KIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVLKE- 191

Query: 183 GNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLH 242
             + VPA +Q+E HP LPQ ++  FC ++ IL+ AYSPLG  GAPLL+ P+++ + +K +
Sbjct: 192 -CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCEKYN 250

Query: 243 VEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300
             P  +L S+ L++G  V+ +S   +RI +NL    + E D+ ++NE  Q+   + I+
Sbjct: 251 ASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQKNKKRYIN 308

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  186 bits (473), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 163/272 (59%), Gaps = 13/272 (4%)

Query: 14  LNTGAQIPLLGLGTWRSTKE--NGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD--- 68
           LN G ++P +GLGT    ++      A  AA+KAGYR+ID A    +E  VG AI++   
Sbjct: 13  LNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVGEAIKELIE 72

Query: 69  -SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNY 127
              + RE+LF+T+K+W     D + +L +SLK LG+DY+DL++ HWP+ +   +  H   
Sbjct: 73  EGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNRREDPHGIN 132

Query: 128 MLI--PKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQLKKLIDSP 182
            L   P++ DG PD +E  D++ T++ M+ +   P   +  A+GV+NF V  LK+++   
Sbjct: 133 GLARNPEKADGSPDFNEKADWLDTYKQMERIYSNPKDNRVRAIGVSNFPVEYLKRVLKE- 191

Query: 183 GNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLH 242
              + P  +Q+E HP LPQ ++  FC  N+I + AYSPLGS GAP++  P+++E+S+K  
Sbjct: 192 -CPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHPLIKEMSQKYK 250

Query: 243 VEPAQLLVSWGLQRGHAVLVKSKTPSRIEANL 274
                +L S+ +++G+ V+ +S    RI +N+
Sbjct: 251 ASENDILTSFHIRQGNTVVPRSINSVRIASNI 282

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  186 bits (471), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 109/301 (36%), Positives = 172/301 (57%), Gaps = 21/301 (6%)

Query: 14  LNTGAQIPLLGLGT------WRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR 67
           LN G +IP +GLGT      W  TKE    A  AA+KAG+R ID A     E+ +G A++
Sbjct: 13  LNNGTRIPAVGLGTANPKDKWPQTKE----AVKAAVKAGFRQIDTAWAYGTEEYIGEALQ 68

Query: 68  D----SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVK 123
           +      V RE+LF+TTK+W       + +L++SLKRL LDYVDL + HWP  F  +Q  
Sbjct: 69  ELFAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKKQDP 128

Query: 124 HTNYMLI--PKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQLKKL 178
             +  L+  P+ +DG P  D   D+++T++ ++ +       +  A+GV+N+ +  L++L
Sbjct: 129 EGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLERL 188

Query: 179 IDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREIS 238
                 K VPA +Q+E HP LPQ ++  +C K+ ILM +YSPLGS GAP L  P+V+E++
Sbjct: 189 FKE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQELA 246

Query: 239 KKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKR 298
            K +     +LVS+ +++G  V+ +S    RI   L    + + +L ++N+   E   + 
Sbjct: 247 SKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVEHEYRY 306

Query: 299 I 299
           I
Sbjct: 307 I 307

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  184 bits (467), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/296 (36%), Positives = 175/296 (59%), Gaps = 13/296 (4%)

Query: 14  LNTGAQIPLLGLGTWRSTKE--NGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD--- 68
           LN G ++P +GLGT    ++      A  AAIK+GYRHID A     E  VG A+++   
Sbjct: 13  LNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVGEALKELFE 72

Query: 69  -SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAF-RSEQVKHTN 126
              V RE++FVTTK+W T       ++S+SL+ LGLD+VDL + HWP+ F R E     +
Sbjct: 73  EGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNRLEDPDGID 132

Query: 127 YMLI-PKRKDGQPDVDEGWDYVKTWELMQEL--PATGKTNALGVANFSVSQLKKLIDSPG 183
            +   P  +DG P  +E  DY++T++ +++L      +  A+GV+N+ V  L++L+    
Sbjct: 133 GVRRNPYHEDGSPHYNEKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEYLERLLKE-- 190

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
            ++VPA +Q+E HP LPQ ++  FC K+NI +EAYSPLG+  APL+D  +V++I+ K   
Sbjct: 191 CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELVKKIAGKYAC 250

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299
               +L+++ +++G   + +S  P  I +N+    + + D+  +N+   E  TKRI
Sbjct: 251 STQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFGVE-NTKRI 305

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  184 bits (467), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/310 (34%), Positives = 184/310 (59%), Gaps = 14/310 (4%)

Query: 6   KKCTATAKLNTGAQIPLLGLGTWRSTKENGY--NATLAAIKAGYRHIDIAAVCMNEQVVG 63
           K    +  LN G ++P LGLGT     E G    A  AA+KAGYRHID A    +E  VG
Sbjct: 8   KGTEISFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVG 67

Query: 64  RAIRD----SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRS 119
            AI++      + RE++F+T+K+W     D + +L++SL+ LG+DY+DL++ HWP+ +  
Sbjct: 68  EAIKELMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVK 127

Query: 120 EQVKHTNYMLI--PKRKDGQPDVDEGWDYVKTWELMQEL---PATGKTNALGVANFSVSQ 174
           ++  H    L   P+  +G+P  +   D+++T+  M+++   P+  +  ++GV+NF V  
Sbjct: 128 QEDTHGINGLARNPETPNGEPYYEVDGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQY 187

Query: 175 LKKLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVV 234
           L++ +     K  PA +Q+E HP LPQ ++  FC+ +NIL+EAYSPLGS  AP +   +V
Sbjct: 188 LERTLFECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLV 245

Query: 235 REISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQER 294
           +++++K  + P+ +L S+ +++G+AV+ +S    RI +N+    + E +L  +++L   +
Sbjct: 246 QDLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGITK 305

Query: 295 GTKRIHNPTW 304
             KR  N  W
Sbjct: 306 -PKRFVNEKW 314

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  182 bits (463), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 98/290 (33%), Positives = 169/290 (58%), Gaps = 12/290 (4%)

Query: 14  LNTGAQIPLLGLGTWRSTKE--NGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD--- 68
           LN G ++P LGLGT    ++      A  AAIK+GYRHID A     E  +G A+++   
Sbjct: 13  LNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKELFE 72

Query: 69  -SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH--T 125
              + RE++F+TTK+W T       ++S+SL+ LG+DYVDL + HWP+ F   Q      
Sbjct: 73  EGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNRLQDPEGID 132

Query: 126 NYMLIPKRKDGQPDVDEGWDYVKTWELMQE--LPATGKTNALGVANFSVSQLKKLIDSPG 183
                P  +DG P  +E  DY++T++ +++  L    +  ++GV+N+ V  L++L+    
Sbjct: 133 GICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYLERLLKE-- 190

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
            K+VPA +Q+E HP LPQ ++  FC K+NI +EA+SP G+ G+P++   +V+++++K   
Sbjct: 191 CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQKVAQKYSC 250

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQE 293
            P  +L+++ L++G   + +S  P  I +N+    + + D+  +N+   E
Sbjct: 251 TPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFGVE 300

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  163 bits (413), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 161/305 (52%), Gaps = 28/305 (9%)

Query: 11  TAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR--- 67
           T KLN GA +PL+GLG W+   E        AIK GYR +D A    NE+ VG+ IR   
Sbjct: 32  TIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAI 91

Query: 68  DSG-VPREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFR----SE 120
           D G V REELFV +KLW   HR  D   AL ++L  LGLDY+DL+ +H+P+AF+     E
Sbjct: 92  DEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFVPLEE 151

Query: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180
           +     Y      + G+    E    ++T+  +++L   G+  A+G++NF    ++ L+ 
Sbjct: 152 RYPAGLYTGAADEQAGRL-AQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDLLR 210

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSE------------GAPL 228
             G +I PAA Q+E HP+L Q +++ + K   + +  YS LG +             APL
Sbjct: 211 --GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAAPL 268

Query: 229 LDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT---FDIPEGDLR 285
           L   VV  I+++    PA++L+ W  QR  AV+ KS    R+  NL       + + +LR
Sbjct: 269 LQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADDELR 328

Query: 286 RINEL 290
            ++ L
Sbjct: 329 ELSSL 333

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  162 bits (410), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 103/306 (33%), Positives = 163/306 (53%), Gaps = 32/306 (10%)

Query: 14  LNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----RAIRDS 69
           LN G ++P +GLG W+   +   +    AIKAGYR  D A    NE  VG    RA+ D 
Sbjct: 7   LNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMDDG 66

Query: 70  GVPREELFVTTKLWCTQHRDP--KTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNY 127
            V R++LFV +KLW   H     K  L ++LK LGLDY+DLY +H+P+AF+   ++    
Sbjct: 67  IVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEER-- 124

Query: 128 MLIPKRKDGQPD------VDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDS 181
              P+   G+ D       +E    + T+  ++E    G   ++G++NF+   +  ++  
Sbjct: 125 -YPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADILR- 182

Query: 182 PGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEG------------APLL 229
            G  I P A Q+E HP+L Q K+L +CK +++ +  YS  G +              PL 
Sbjct: 183 -GCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPLF 241

Query: 230 DEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFD---IPEGDLRR 286
           D PV+++I++K +V  A++L+ W  QRG A++ KS    R+ +NL+  D   + E DL+ 
Sbjct: 242 DHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDLKS 301

Query: 287 INELAQ 292
           I+ L Q
Sbjct: 302 ISGLNQ 307

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  161 bits (407), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 107/310 (34%), Positives = 163/310 (52%), Gaps = 29/310 (9%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----R 64
           +A   LN G ++PL+GLG W+            AIK GYR  D A    NE+ VG    R
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 65  AIRDSGVPREELFVTTKLWCTQHRDP--KTALSQSLKRLGLDYVDLYMMHWPVAFR--SE 120
           AI +  V RE+LF+ +KLW   H     K  L ++LK LGLDYVDLY +H+P+AF+  S 
Sbjct: 62  AIDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVSP 121

Query: 121 QVKHTNYMLIPKRKDGQPDV-DEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
             ++   M   K  + +  + +E    + T+  M++L   G   ++G++N++   +   +
Sbjct: 122 DERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVADTL 181

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEG------------AP 227
              G +I P A Q+E HP+L Q K+L +CK +++ + AYS  G +              P
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNTPP 239

Query: 228 LLDEPVVREISKKLH-VEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFD----IPEG 282
           L D P +++I+ K   V  +Q+L+ W  QRG A++ KS    R+  NL T D    + E 
Sbjct: 240 LFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENL-TIDQKVTLAEE 298

Query: 283 DLRRINELAQ 292
           DLR I+ L Q
Sbjct: 299 DLREISALNQ 308

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  159 bits (403), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 155/290 (53%), Gaps = 27/290 (9%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----R 64
           + T  LN G  +PL+GLG W+ + +        AIK GYR  D A    NE+ VG    R
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 65  AIRDSGVPREELFVTTKLWCTQHRDPK---TALSQSLKRLGLDYVDLYMMHWPVAFR--- 118
           AI +  V RE+LFV +KLW T H DPK    AL ++L  + L+Y+DLY +H+P+AF+   
Sbjct: 62  AIDEGIVKREDLFVVSKLWNTYH-DPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVP 120

Query: 119 -SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKK 177
             E+     Y      K G    +E    + T+  M+EL   G T ++G++N++ + ++ 
Sbjct: 121 FEERYPPGFYTGAEDAKKGIL-TEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQD 179

Query: 178 LIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEG------------ 225
            +   G +I P   Q+E HP+L Q K++ +CK N I + AYS  G +             
Sbjct: 180 TLR--GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHT 237

Query: 226 APLLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLH 275
            PL D PV+++I+++  V  +Q+++ W  QRG AV+ KS    R+  NL 
Sbjct: 238 PPLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQ 287

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  157 bits (396), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 155/292 (53%), Gaps = 29/292 (9%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----R 64
           T T  LN G ++P++GLG W+ + +        AIK GYR  D A    NE+ +G    +
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 65  AIRDSGVPREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQV 122
           AI +  V RE+LF+ +KLWC  H     K AL ++L  LGLDYVDLY +H+P+  +   +
Sbjct: 64  AINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVPL 123

Query: 123 KHTNYMLIPKRKDGQPD------VDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLK 176
           +       P+   G+ D       ++    + T+  M++L   G   +LG++NF    ++
Sbjct: 124 EEK---YPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQ 180

Query: 177 KLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLG------------SE 224
            L+   G +I P A Q+E HP+L Q +++++ +  +I + AYS  G             +
Sbjct: 181 DLLR--GARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKD 238

Query: 225 GAPLLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT 276
             PLL+  +V  I+KK  V P+Q+++ W  QRG AV+ KS    R+  NL++
Sbjct: 239 VTPLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNS 290

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  155 bits (392), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 152/291 (52%), Gaps = 29/291 (9%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----R 64
           ++ A LN G ++P++GLG W+            AIK GYR  D A    NE+ VG    R
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 65  AIRDSGVPREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQV 122
           AI +  V R +LF+ +KLW T H     K A+ ++L  LGLDY+DLY +H+P+AF+   +
Sbjct: 62  AIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPI 121

Query: 123 KHTNYMLIPKRKDGQPDVDEG------WDYVKTWELMQELPATGKTNALGVANFSVSQLK 176
           +       P    G+ D  +G        Y+ T+  M+ L   G   ++GV+N     L+
Sbjct: 122 EEK---YPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQ 178

Query: 177 KLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGS-----------EG 225
            ++   G KI P   Q+E HP+L Q++++ +CK+  I++ AYS  G            E 
Sbjct: 179 DVL--MGCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKED 236

Query: 226 AP-LLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLH 275
            P L D PV++ I+ K +V  +++L+ W  Q G AV+ KS    R+  NL+
Sbjct: 237 TPNLFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLN 287

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  155 bits (391), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 161/305 (52%), Gaps = 34/305 (11%)

Query: 14  LNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----RAIRDS 69
           LN G ++P++GLG W+   +        AIK GYR  D A    NE+ VG    +AI + 
Sbjct: 7   LNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQAISEG 66

Query: 70  GVPREELFVTTKLWCTQHRDP---KTALSQSLKRLGLDYVDLYMMHWPVAFR----SEQV 122
            V REELFV +KLW + H DP   K AL ++L  + LDY+DLY +H+P+AF+     E+ 
Sbjct: 67  IVKREELFVISKLWNSYH-DPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVPFEEKY 125

Query: 123 KHTNYMLIPKRKDGQPDV--DEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180
               Y     ++D +  +  +E    + T+  M++L   G   ++G++NF+ + ++ L+ 
Sbjct: 126 PAGFYT---GKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDLLR 182

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGS------------EGAPL 228
           S   KI P   Q+E HP+L Q  ++ +CK N+I + AYS  G             +   L
Sbjct: 183 S--CKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAKVL 240

Query: 229 LDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANL---HTFDIPEGDLR 285
            +  V++ I+    VEP+Q+L+ W  QRG A++ KS    R+  NL       + E +L 
Sbjct: 241 FEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSEQELS 300

Query: 286 RINEL 290
            I++L
Sbjct: 301 TISDL 305

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  154 bits (390), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 168/324 (51%), Gaps = 36/324 (11%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----R 64
           TA   LN G ++PL+GLG W+   +   +    AIK GYR  D AA   NE+ VG    +
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 65  AIRDSGVPREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFR---- 118
           A+ +  V R +LF+ +KLW T H     K AL ++L  LGLDY+DLY +H+P+AF+    
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
            E+     Y      K G+  + +   Y+ T+  M++L   G T ++GV+N   S L+ +
Sbjct: 122 EEKYPPCFYTGAEDAKIGKISL-QNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDV 180

Query: 179 IDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLG-----------SEGAP 227
           +   G +I PAA Q+E HP+L Q  ++ FCK  NI + +YS  G           +E  P
Sbjct: 181 L--MGCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTP 238

Query: 228 -LLDEPVVREISKK--LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT---FDIPE 281
            L D PV+++I+      V  +++L+ W  QR  A++ KS    R+  NL+      + E
Sbjct: 239 ALFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLTLTE 298

Query: 282 GDLRRINELAQERGTKRIH-NPTW 304
            +L  I+ L      K I  N TW
Sbjct: 299 AELLEISAL-----NKNIRFNDTW 317

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  152 bits (383), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/314 (32%), Positives = 160/314 (50%), Gaps = 30/314 (9%)

Query: 14  LNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR---DSG 70
           LN G ++PL+GLG W+ + +        AIK GYR  D A    NE  VG+ I+   D G
Sbjct: 7   LNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAIDEG 66

Query: 71  -VPREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNY 127
            V R +LFV +KLW + H     K AL ++L+ LGLDY+DLY +H+P+AF+    +    
Sbjct: 67  LVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFEEK-- 124

Query: 128 MLIPKRKDGQPDVDEGW------DYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDS 181
              P    G  D  EG         + T+  ++E    G   ++G++NF+   ++ L++ 
Sbjct: 125 -YPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLLN- 182

Query: 182 PGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEG------------APLL 229
            G +I P A Q+E HP+L Q K++ +CK   I + AYS  G +               LL
Sbjct: 183 -GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSLL 241

Query: 230 DEPVVREISKKLHVE-PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRIN 288
           + P++++I+       P+++L+ W  QRG AV+ KS    R+  NL+  D        +N
Sbjct: 242 EHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEELN 301

Query: 289 ELAQERGTKRIHNP 302
           E++      R ++P
Sbjct: 302 EISSLNKNIRFNDP 315

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  152 bits (383), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 105/311 (33%), Positives = 164/311 (52%), Gaps = 30/311 (9%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR- 67
           + T KLN G ++PL+GLG W+   E   +    AIK GYR  D A    NE+ VG+ IR 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 68  --DSG-VPREELFVTTKLWCTQHRDPKT---ALSQSLKRLGLDYVDLYMMHWPVAFR--- 118
             D G V RE+LFV +KLW + H DPK    AL ++L+ LGL+Y+DL+ +H+P+AF+   
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYH-DPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVP 123

Query: 119 -SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKK 177
             E+     Y      K G   + E    + T+  +++    G   A+GV+NF    L  
Sbjct: 124 FEERYPPGFYTGAEDEKKGVISL-EKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHD 182

Query: 178 LIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLG-----------SEGA 226
           L+   G KI PA  Q+E HP+L Q K++ +CK+  I + AYS  G           ++  
Sbjct: 183 LL--AGAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKST 240

Query: 227 P-LLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT---FDIPEG 282
           P L +  VV++++    V  +++L+ W  QR  A++ KS    R+  NL       + + 
Sbjct: 241 PTLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDE 300

Query: 283 DLRRINELAQE 293
           +L+ I+ L ++
Sbjct: 301 ELQEISSLNKD 311

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  151 bits (381), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 104/325 (32%), Positives = 166/325 (51%), Gaps = 33/325 (10%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----R 64
           ++   LN G ++PL+GLG W+  K+   N    AIK GYR  D A    NE+ VG    R
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 65  AIRDSGVPREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFR---- 118
           AI +  V R+++FV +KLW   H     K AL ++L  +GLDY+DLY +H+P+AF+    
Sbjct: 62  AISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
            E+     Y  +   K G    +     + T+  ++E    G   ++G++NF  S ++ L
Sbjct: 122 EEKYPPGFYTGVDDEKKGHI-TEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDL 180

Query: 179 IDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVR--- 235
           +   G +I P A Q+E HP+L Q  ++ FC+ +NI + AYS  G +    +D  + +   
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTP 238

Query: 236 -----EISKKLHVE-----PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT---FDIPEG 282
                ++ KK+ +       +Q+L+ W  QRG AV+ KS    R+  NL     F + E 
Sbjct: 239 TLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQ 298

Query: 283 DLRRINELAQERGTKRIHNP-TWFS 306
           +L+ I+ L       R ++P TW  
Sbjct: 299 ELKEISAL---NANIRFNDPWTWLD 320

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  150 bits (378), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 152/288 (52%), Gaps = 25/288 (8%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR- 67
           ++   LN G ++PL+GLG W+   +        AIK GYR  D A    NE+ VG+ IR 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSGV-PREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFR---- 118
             D GV  RE++FV +KLW + H     K AL ++L  +GLDY+DL+ +H+P+AF+    
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
            E+     Y      K+G    +     + T+  +++    G   ++G++NFS S ++ L
Sbjct: 122 EEKYPPGFYTGKEDEKNGHI-TEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDL 180

Query: 179 IDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPV----- 233
           +     KI P A Q+E HP+L Q  ++ +CK N I + AYS  G +    L+ P+     
Sbjct: 181 LRQC--KIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTP 238

Query: 234 -------VREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANL 274
                  +++I+   +V  +Q+L+ W  QRG A++ KS    R++ NL
Sbjct: 239 NLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNL 286

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  150 bits (378), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/316 (32%), Positives = 161/316 (50%), Gaps = 28/316 (8%)

Query: 14  LNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR---DSG 70
           LN G ++PL+GLG W+   E   +    AIK GYR  D A    NE+ VG+ IR   D G
Sbjct: 7   LNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRKAIDEG 66

Query: 71  -VPREELFVTTKLWCTQH--RDPKTALSQSLKRLGLDYVDLYMMHWPVAFR----SEQVK 123
            V REELFV +KLW + H  ++ K AL ++L  + LDY+DL+ +H+P+A +     E+  
Sbjct: 67  IVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPFKEKYP 126

Query: 124 HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183
              Y      K G    +E    + T+  +++L   G   ++G++NFS S +  L+   G
Sbjct: 127 PGLYTGSQDEKQGTMS-EENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDLLR--G 183

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEG------------APLLDE 231
            +I P A Q+E HP+L Q +++ + K   + + AYS  G +              PL + 
Sbjct: 184 CRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTPPLFEN 243

Query: 232 PVVREISKK--LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINE 289
           P + EI+K     + P+Q+L+ W  Q   AV+ KS    R+  NLH  D      + + E
Sbjct: 244 PKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTDQELKE 303

Query: 290 LAQERGTKRIHNP-TW 304
           ++      R ++P TW
Sbjct: 304 ISALNKNIRFNDPYTW 319

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  150 bits (378), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 151/290 (52%), Gaps = 29/290 (10%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----R 64
            +   LN G ++PL+GLG W+   E        AI  GYR  D A    NE+ VG    R
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 65  AIRDSGVPREELFVTTKLWCTQH--RDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQV 122
           AI+D  V REELFV +KLW + H  ++ K AL ++L  +GLDY+DL+ +H+P+A +    
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 123 KHTNYMLIPKRKDGQPDVDEG------WDYVKTWELMQELPATGKTNALGVANFSVSQLK 176
           +       P    G+ D   G         + T+  ++E    G   ++GV+NFS S + 
Sbjct: 122 EEK---YPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIML 178

Query: 177 KLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSP--------LGSEGA-- 226
            L+   G +I PAA Q+E HP+L Q + + + +   I + AYS         +GSE A  
Sbjct: 179 DLLR--GARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKA 236

Query: 227 --PLLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANL 274
             PL +  VV++I+ K +V  +Q+L+ W  Q+  AV+ KS    R+  NL
Sbjct: 237 TPPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNL 286

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  149 bits (375), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 106/333 (31%), Positives = 171/333 (51%), Gaps = 38/333 (11%)

Query: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG- 63
           +   + T  LN G ++PL+GLG W+   +   +    AIK GYR  D A    NE+ VG 
Sbjct: 1   MSALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQ 60

Query: 64  ---RAIRDSGVPREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFR 118
              +AI +  V RE+LFV +KLW + H   + K AL ++L  +GLDY+DL+ +H+P+AF+
Sbjct: 61  GIKKAIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFK 120

Query: 119 ----SEQVKHTNYMLIPKRKDG---QPDVDEGWDYVKTWELMQELPATGKTNALGVANFS 171
                E+     Y      K+G   Q DV      + T+  +++    G   ++G++NF+
Sbjct: 121 FVPFEEKYPPGFYTGAEDEKNGVISQEDV----PLIDTYRALEKCVDEGLIKSIGISNFN 176

Query: 172 VSQLKKLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDE 231
            S ++ L+   G +I P A Q+E HP+L Q  ++ +CK   I + AYS  G +    LD 
Sbjct: 177 GSLVQDLLR--GARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDS 234

Query: 232 PV------------VREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFD- 278
            +            V+ I+    V  +Q+L+ W  QRG AV+ KS    R+  NL   D 
Sbjct: 235 ELAKTTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDS 294

Query: 279 --IPEGDLRRINELAQERGTKRIHNP-TWFSFE 308
             + + +L+ I+ L ++    R ++P TW + E
Sbjct: 295 LTLSDKELKAISALNKDI---RFNDPWTWLNSE 324

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  149 bits (375), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 104/325 (32%), Positives = 163/325 (50%), Gaps = 33/325 (10%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR- 67
           ++   LN G ++PL+GLG W+  K+   N    AIK GYR  D A    NE+ VG  IR 
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 68  ---DSGVPREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFR---- 118
              +  V R+++FV +KLW   H     K AL ++L  +GLDY+DLY +H+P+AF+    
Sbjct: 62  AISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
            E+     Y      K G    +     + T+  ++E    G   ++GV+NF  S ++ L
Sbjct: 122 EEKYPPGFYTGADDEKKGHI-TEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDL 180

Query: 179 IDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEG------------A 226
           +   G +I P A Q+E HP+L Q  ++ FCK ++I + AYS  G +              
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTP 238

Query: 227 PLLDEPVVREISKKL-HVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT---FDIPEG 282
            L +  V++++S+       +Q+L+ W  QRG AV+ KS    R+  NL     F + E 
Sbjct: 239 TLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQ 298

Query: 283 DLRRINELAQERGTKRIHNP-TWFS 306
           +L+ I+ L       R ++P TW  
Sbjct: 299 ELKDISAL---NANIRFNDPWTWLD 320

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  149 bits (375), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 100/306 (32%), Positives = 159/306 (51%), Gaps = 26/306 (8%)

Query: 11  TAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----RAI 66
           T  LN G ++PL+GLG W+   +   +    AIK GYR  D A    NE+ VG    RAI
Sbjct: 7   TVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAI 66

Query: 67  RDSGVPREELFVTTKLWCTQHRDPKT--ALSQSLKRLGLDYVDLYMMHWPVAFRSEQV-- 122
           ++  V RE+L V +KLW + H       AL ++L  L LDYVD++ +H+P+AF+      
Sbjct: 67  KEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPFDE 126

Query: 123 KHTNYMLIPKRKDGQPDVDEGW-DYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDS 181
           K+       K  + +  ++E     + TW  +++L   GK  +LG++NFS + ++ L+  
Sbjct: 127 KYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLLR- 185

Query: 182 PGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGS------EGAPLLDEP--- 232
            G +I P A Q+E HP+L Q +++ + K   I + AYS  G       E    L+ P   
Sbjct: 186 -GARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPTLF 244

Query: 233 ---VVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFD---IPEGDLRR 286
               ++ I+ K  V P Q+L+ W  Q G A++ KS    R+  NL   D   + + +L++
Sbjct: 245 EHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDELKQ 304

Query: 287 INELAQ 292
           I+ L Q
Sbjct: 305 ISGLNQ 310

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  148 bits (374), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 103/328 (31%), Positives = 165/328 (50%), Gaps = 39/328 (11%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR- 67
           ++   LN G ++PL+GLG W+  K    N    AIK GYR  D A    NE+ VG  IR 
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 68  ---DSGVPREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQV 122
              +  V R+++FV +KLW   H     K AL ++L  +GLDY+DLY +H+P+AF+    
Sbjct: 62  AIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPF 121

Query: 123 KHTNYMLIPKRKDGQPDVDEGW------DYVKTWELMQELPATGKTNALGVANFSVSQLK 176
           +       P    G  D ++G         + T+  +++    G   ++G++NF  S ++
Sbjct: 122 EEK---YPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQ 178

Query: 177 KLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEG----------- 225
            L+   G +I P A Q+E HP+L Q  ++ FCK ++I + AYS  G +            
Sbjct: 179 DLLR--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKA 236

Query: 226 -APLLDEPVVREISKKLHV--EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT---FDI 279
              L +  V++++S+  H     +Q+L+ W  QRG AV+ KS    R+  NL     F +
Sbjct: 237 TQTLFENDVIKKVSEN-HTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSL 295

Query: 280 PEGDLRRINELAQERGTKRIHNP-TWFS 306
            E +L++I+ L       R ++P TW  
Sbjct: 296 TEQELKKISAL---NANIRFNDPWTWLD 320

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  142 bits (359), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 157/309 (50%), Gaps = 50/309 (16%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI-- 66
           + T  L  G +IP+L LG + + KE   +    A+K+GYRH+D A +  NE+ VG  I  
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65

Query: 67  ---RDSGVPREELFVTTKLWCTQH--RDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRSE 120
                  V R E+F TTK+    H     K ++ +SL+ +  ++Y+DL ++H P+A   E
Sbjct: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125

Query: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180
           ++                          TW+ +QE  A GK  A+GV+N+S+  L++L +
Sbjct: 126 RLG-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160

Query: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240
             G K+ P  +Q E +P+L + ++  +C+K  +++EA+SPL + G    D P ++E+ K 
Sbjct: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQKFSD-PQLQELIKT 218

Query: 241 LHVE--PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT--FDIPEGDLRRINELAQERGT 296
            +    PAQ+L+ W LQ G   L KS    R  +NL    F+I + D++ +         
Sbjct: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT-------- 270

Query: 297 KRIHNPTWF 305
              H+ T+F
Sbjct: 271 ---HDDTYF 276

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  142 bits (358), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 90/293 (30%), Positives = 155/293 (52%), Gaps = 39/293 (13%)

Query: 8   CTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ----VVG 63
            + T  L  G +IP+LG GT+ + KE   +   AA K GYRH+D A +  NE+     V 
Sbjct: 5   ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVA 64

Query: 64  RAIRDS-GVPREELFVTTKLWCTQH--RDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRS 119
           + +++S  V R+++F TTK+    H     K ++ +SL+    L+YVDL+++H P A   
Sbjct: 65  KFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA--- 121

Query: 120 EQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
                                 E    + T++ +QE    GK  A+GV+++S+  L++L 
Sbjct: 122 ----------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELY 159

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239
              G ++ P  +Q E +P+L +  ++ +CK+ ++++EA+SP+    +    +PVV+++ K
Sbjct: 160 SWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITR--SKRFSDPVVQKLLK 217

Query: 240 KLH--VEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT--FDIPEGDLRRIN 288
           + +    PAQLL+ W LQ G   L KS    R E+NLH   F+I   D++ + 
Sbjct: 218 ESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLT 270

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  141 bits (355), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/278 (29%), Positives = 142/278 (51%), Gaps = 36/278 (12%)

Query: 11  TAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD-- 68
           T  L  G  +P LGLG +   K         A+K GYRH D A    NE  VG  I    
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 69  ----SGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRSEQ 121
               S   R+++F  TKLW +Q  + + KTA+ Q L+++  L Y+DL ++H P    +++
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKR 124

Query: 122 VKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDS 181
           +                          T+E MQE    G   ++GV+N+    L++L   
Sbjct: 125 LA-------------------------TYEAMQESVDAGIVKSIGVSNYERHHLQELYAM 159

Query: 182 PGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKL 241
           P  K  P  +Q+E  P+LP+N ++ +CK   + ++AYSPLG      +++P +  ++ + 
Sbjct: 160 PNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGC--GDRVNDPYIASLATQK 217

Query: 242 HVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
           +  PAQ+L++W L +G+A L K++   R+++NL ++++
Sbjct: 218 NCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNV 255

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  142 bits (359), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 101/324 (31%), Positives = 164/324 (50%), Gaps = 34/324 (10%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG----R 64
           + T KLN G Q+PL+GLG W+   E   +    AIK GYR  D A    NE+ VG    +
Sbjct: 5   SETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIHK 64

Query: 65  AIRDSGVPREELFVTTKLWCTQHRDPKT---ALSQSLKRLGLDYVDLYMMHWPVAFR--- 118
           AI +  V RE+LFV +KLW + H DPK    AL ++L+ + L+Y+DL+ +H+P+AF+   
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYH-DPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKYVP 123

Query: 119 -SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKK 177
             E+     Y      K G   +++    + T+  ++E    G   ++G++NF    +  
Sbjct: 124 FEEKYPPGFYTGAEDAKKGVISLEQ-VPIIDTYRALEECVKEGLIKSIGISNFRGILIHD 182

Query: 178 LIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPV---- 233
           L+   G  I P   Q+E HP+L Q K++ +C +  I + AYS  G +    LD  +    
Sbjct: 183 LL--AGATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKST 240

Query: 234 --------VREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT---FDIPEG 282
                   +++I+    V  +Q+L+ W  QR  A++ KS    R+  NL       + E 
Sbjct: 241 PTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLTLTEA 300

Query: 283 DLRRINELAQERGTKRIHNP-TWF 305
           +L+ I+ L ++    R ++P TW 
Sbjct: 301 ELQEISALNKDI---RFNDPFTWL 321

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  142 bits (358), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/324 (30%), Positives = 164/324 (50%), Gaps = 31/324 (9%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR- 67
           ++   LN G ++PL+GLG W+   +   N    AIK GYR  D A    NE+ VG  IR 
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 68  ---DSGVPREELFVTTKLWCTQHR--DPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE-- 120
              +  V R+++FVT+KLW   H     K AL ++L  +GLDY+DLY +H+P+AF+    
Sbjct: 62  AISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 121 QVKHTNYMLIPKRKDGQPDVDEGW-DYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179
           + K+          D +  + E     + T+  ++     G   ++G++NF  S ++ L+
Sbjct: 122 EEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLL 181

Query: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLG-----------SEGAP- 227
              G +I P A Q+E HP+L Q  ++ +CK ++I + AYS  G           ++  P 
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPT 239

Query: 228 LLDEPVVREISKKL-HVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT---FDIPEGD 283
           L +  VV+++S+       +Q+L+ W  QRG AV+ KS    R+  NL       + + +
Sbjct: 240 LFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQE 299

Query: 284 LRRINELAQERGTKRIHNP-TWFS 306
           L+ I+ L       R ++P TW  
Sbjct: 300 LKEISSL---NANIRFNDPWTWLD 320

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  140 bits (354), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 145/276 (52%), Gaps = 35/276 (12%)

Query: 11  TAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI---- 66
           + KL +G  IP +GLGT+     N      AA++ GYRH+D A +  NE  V +      
Sbjct: 6   SYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFL 65

Query: 67  -RDSGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRSEQV 122
            R   V RE++F TTKLW +Q  +   K A+ + ++ +G L Y+DL +MH P+    +QV
Sbjct: 66  GRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPIG--GKQV 123

Query: 123 KHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSP 182
           +                         TW+ MQE    G   ++GV+++    L+ L +  
Sbjct: 124 RR-----------------------GTWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEWS 160

Query: 183 GNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLH 242
             K  PA +Q+E  P++ + ++  +CK   I++EAYSPL + G   LD+P + +++++  
Sbjct: 161 ELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL-THGYK-LDDPDLLKVAEETG 218

Query: 243 VEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFD 278
             P Q+L+ W LQ G+  L K+KT SR++ NL  FD
Sbjct: 219 KNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVFD 254

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  140 bits (354), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 145/277 (52%), Gaps = 46/277 (16%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNE----QVVGRAIRD 68
           KLN G ++P++G G +    E        A++ GYRHID A V  N+    Q V R + +
Sbjct: 14  KLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGVHRFLEE 73

Query: 69  SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLD------YVDLYMMHWPVAFRSEQV 122
           +G PREE++ TTKLW TQ    + A  ++L+ +  D      YVDL ++H P+       
Sbjct: 74  TGTPREEVWFTTKLWNTQQ--GRDATPRALEEIAADVKEFIGYVDLLLLHSPLT------ 125

Query: 123 KHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQ---ELPATG--KTNALGVANFSVSQLKK 177
                       D Q         ++TW +++   + PA+   +  A+GV+NF V  L++
Sbjct: 126 ------------DAQ-------RRLETWAVLERAVQEPASSALEIRAIGVSNFGVRHLQE 166

Query: 178 LIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREI 237
           L++    K  P   QLE HP+LP+ ++ +F ++N IL EAYSPL ++G  L D P +  +
Sbjct: 167 LLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL-TQGVRLQD-PELLAL 222

Query: 238 SKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANL 274
             K  +   ++L+ W   +G AVLVKS  P RI  NL
Sbjct: 223 EAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNL 259

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  138 bits (348), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 147/275 (53%), Gaps = 36/275 (13%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD---- 68
           +L  G +IP L LGT+             A+K GYRH D A +  NE+ VG+ I +    
Sbjct: 12  ELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINE 71

Query: 69  --SGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRL-GLDYVDLYMMHWPVAFRSEQVK 123
             +   RE++F TTKLW +Q  + + K A+ + ++++ GL Y+D+ ++H P++ +  +++
Sbjct: 72  DKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSGQRRRLE 131

Query: 124 HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183
                                    TW+ MQE    G   ++GV+N+    +++L+    
Sbjct: 132 -------------------------TWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWDE 166

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
            K  P  +Q+E  P++ + ++  +CK  N+++EAY+P+       +++P +REISK+  +
Sbjct: 167 LKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMAH--GYKMNDPGLREISKETGM 224

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFD 278
            P QLL+ W LQ G+  L K+KT +R+ +NL  ++
Sbjct: 225 NPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVYN 259

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  138 bits (348), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 89/279 (31%), Positives = 142/279 (50%), Gaps = 37/279 (13%)

Query: 11  TAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI---- 66
           T KL++   IP + LGT+             A+  GYRH D A +  NE+ V + I    
Sbjct: 8   TYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWL 67

Query: 67  -RDSGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRL-GLDYVDLYMMHWPVAFRSEQV 122
            R     R+E+F TTKLW +Q  +++ K A+ + + ++  L Y+DL +MH P+       
Sbjct: 68  IRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI------- 120

Query: 123 KHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSP 182
                        G P + E     +TW  MQE    G   ++GV+NF +  LK+L    
Sbjct: 121 -------------GGPQIRE-----ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQWD 162

Query: 183 GNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLH 242
           G K  P  +Q+E  P+L + ++  FCK   +++EAY+PL + G   ++ P + +IS +L+
Sbjct: 163 GLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL-THGYK-INHPDLIKISNELN 220

Query: 243 --VEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
                 Q+L+ W LQ G+  L K+KT  R+E+NL  +D 
Sbjct: 221 NTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVYDF 259

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  139 bits (349), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 163/317 (51%), Gaps = 60/317 (18%)

Query: 14  LNTGAQIP---LLGLGT-WRSTKENG--YNATLAAIKA-------GYRHIDIAAVCMNEQ 60
           L+ G +IP   ++G GT W  ++E    ++  L  I         G  HID A +     
Sbjct: 9   LSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTYP 68

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQH--RDPKTALSQSLKRLGLDYVDLYMMHWPVAFR 118
            +G A++D+  PR+E+F+T K    +    +PK AL  SLK+LG+DYVDLY++H P+   
Sbjct: 69  ELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLHSPII-- 126

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
                          K+ + DV+  W Y      ++EL  +GK   +GV+NF+V  L+KL
Sbjct: 127 ---------------KESKLDVEANWKY------LEELYKSGKAKNIGVSNFAVKDLEKL 165

Query: 179 IDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLGSEGAPLLDEP--- 232
           +     ++ P  +Q+E  PFL QN+   ++ F +KN IL+EAYSPLG    PL   P   
Sbjct: 166 LAVA--EVKPQVNQIEFSPFL-QNQTPGIVEFSQKNGILLEAYSPLG----PLQRRPEDA 218

Query: 233 -------VVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDIPEGD 283
                   + E+SKK +   AQ+L+SW  +RG   +  S    RI+   ++ +F +   +
Sbjct: 219 DKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEE 278

Query: 284 LRRINELAQERGTKRIH 300
           +++I +L  +    R++
Sbjct: 279 VQKITQLGLQHPALRLY 295

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  136 bits (342), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/315 (32%), Positives = 155/315 (49%), Gaps = 58/315 (18%)

Query: 14  LNTGAQIP---LLGLGT-WRSTKENGYNAT--------LAAIKAGYRHIDIAAVCMNEQV 61
           LN G +IP   ++G GT W  T+E     +        +A    G  HID A +      
Sbjct: 10  LNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYPE 69

Query: 62  VGRAIRDSGVPREELFVTTKLWCTQHR---DPKTALSQSLKRLGLDYVDLYMMHWPVAFR 118
           V  A+R+S  PR+E+F+T K + TQ +   DP   L+ SLK LGLDYVDLY++H P    
Sbjct: 70  VAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPF--- 125

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
                                +  G    + W+ M++L  +GK   +GV+NF V  L+K+
Sbjct: 126 ---------------------IKNGSTLEECWKQMEKLYKSGKAKNIGVSNFRVEDLEKI 164

Query: 179 IDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLG--------SEGAP 227
           +      I P  +Q+E +  L QN+   ++ FCK+NNI +EAY+PLG         E  P
Sbjct: 165 LKIAT--IKPQINQIEFNAAL-QNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKP 221

Query: 228 LLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDIPEGDLR 285
             D   + E+SKK +   AQ+L+ W  +RG   +  S  P R+    NL +FD+   ++ 
Sbjct: 222 FYD--YIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVD 279

Query: 286 RINELAQERGTKRIH 300
           +I EL  +    R++
Sbjct: 280 KITELGLKLKATRLY 294

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  135 bits (340), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 103/316 (32%), Positives = 161/316 (50%), Gaps = 57/316 (18%)

Query: 14  LNTGAQIP---LLGLGTWRSTKENGYNATLA---------AIK-AGYRHIDIAAVCMNEQ 60
           LN G +IP   ++G GT R  KE   +AT +         A+K  G  HID A +     
Sbjct: 10  LNNGNKIPAIAIIGTGT-RWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYP 68

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHR---DPKTALSQSLKRLGLDYVDLYMMHWPVAF 117
            VG+A+  +  PR E+F+T K + TQ +    P   L  +LK++G DYVDLY++H P   
Sbjct: 69  EVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSPFV- 126

Query: 118 RSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKK 177
                K TN                G+   + W+ M++L  +GK   +GV+NF++  L++
Sbjct: 127 ----SKETN----------------GFTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDLER 166

Query: 178 LIDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLG--------SEGA 226
           ++     +I P  +Q+E  PFL QN+   +  FC++N+IL+EAYSPLG         E  
Sbjct: 167 ILKVA--EIRPQVNQIEFSPFL-QNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDESL 223

Query: 227 PLLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDIPEGDL 284
           P  +   V+E+S+K     AQ+ + W  +RG   +  S  P RI    NL +FD+ + ++
Sbjct: 224 PFFE--YVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEV 281

Query: 285 RRINELAQERGTKRIH 300
            +I EL  E    R++
Sbjct: 282 NQITELGLEHEPLRLY 297

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  133 bits (335), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 146/288 (50%), Gaps = 40/288 (13%)

Query: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60
           MT+V K  T     N G QIP + LGT+   +         A+KAGYRH D A +  NE 
Sbjct: 1   MTSVPKYYT----FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEH 56

Query: 61  VVGRAIRD------SGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRL-GLDYVDLYMM 111
            VG  I            R ++F TTKLW +Q  +   +TA+ + L ++ GL Y+D+ ++
Sbjct: 57  QVGEGILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLI 116

Query: 112 HWPVAFRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFS 171
           H P+  R+++++                         TW  MQE   +G    +GV+N+ 
Sbjct: 117 HSPLEGRTKRLE-------------------------TWRAMQEAVESGLVKNIGVSNYG 151

Query: 172 VSQLKKLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDE 231
              +++L+      I P  +Q+E  P++ ++++  +CK   +++EA++PL + G  L D 
Sbjct: 152 RQHVEELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDA 210

Query: 232 PVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
            +VR +SK++     Q+L+ W LQ G+  L K+KT  R+E NL  ++ 
Sbjct: 211 DLVR-VSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNF 257

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  133 bits (334), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 140/280 (50%), Gaps = 36/280 (12%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI-----R 67
           KL+ G +IP + LGT+   +          +K GYRH D A +  NE+ VG  I      
Sbjct: 7   KLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 68  DSGV-PREELFVTTKLWCTQ--HRDPKTALSQSLKRL-GLDYVDLYMMHWPVAFRSEQVK 123
           D G   REE+F TTKLW +Q  ++  K A+ Q L  + GL Y+DL ++H P+     +  
Sbjct: 67  DPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGSKLR-- 124

Query: 124 HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183
                                  ++TW  MQE    G   ++GV+N+    + +L++ P 
Sbjct: 125 -----------------------LETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPE 161

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
            K  P  +Q+E  P++ + ++  +CK   +++EA++PL   G  + + P + ++ K++  
Sbjct: 162 LKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL-CHGYKMTN-PDLLKVCKEVDR 219

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGD 283
            P Q+L+ W LQ G+  L K+KT  R+E NL  ++    D
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSD 259

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  132 bits (332), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 81/280 (28%), Positives = 139/280 (49%), Gaps = 36/280 (12%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD---- 68
           K + G ++P + LGT+   +          IK GYRH D A +  NE+ VG  I      
Sbjct: 7   KFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHE 66

Query: 69  --SGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRL-GLDYVDLYMMHWPVAFRSEQVK 123
                 RE++F TTKLW +Q  ++  K A+ Q L  + GL Y+DL ++H P+     +++
Sbjct: 67  DPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPLEGSKLRLE 126

Query: 124 HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183
                                    TW+ MQE    G   ++GV+N+    + +L++   
Sbjct: 127 -------------------------TWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWSQ 161

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
            K  P  +Q+E  P++ + ++  +CK  N+++EA++PL   G  + D P + ++ K++  
Sbjct: 162 LKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL-CHGYKMTD-PDLLKVCKEVDR 219

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGD 283
            P Q+L+ W LQ G+  L K+KT  R+E+NL  ++    D
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSD 259

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  131 bits (330), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 142/285 (49%), Gaps = 36/285 (12%)

Query: 4   VLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVG 63
           ++ K     KL+ G  IP +GLGT+        N    A+KAGYRH D A +  NE+ VG
Sbjct: 1   MVNKVAKFYKLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVG 60

Query: 64  RAIRD------SGVPREELFVTTKLWCTQHRDPKT--ALSQSLKRL-GLDYVDLYMMHWP 114
           + I            RE +F TTKLW +Q+   K   A+   L ++  L+Y+DL ++H P
Sbjct: 61  QGIHRWLLEDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSP 120

Query: 115 VAFRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQ 174
           +     +++                         TW+ MQE    G   ++GV+N+ +  
Sbjct: 121 LGGTKLRLE-------------------------TWKAMQEAVDHGMVKSIGVSNYGMHH 155

Query: 175 LKKLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVV 234
           + +L+     K  P  +Q+E  P+L + ++  +CK N+I +E YSPL + G  L D+  +
Sbjct: 156 IDELLTWQYLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL-THGYKLNDQD-L 213

Query: 235 REISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
           ++++ +      Q+L+ W LQ G+  L K++T +R++ NL  +D 
Sbjct: 214 KKVANETGKNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDF 258

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  132 bits (332), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/301 (27%), Positives = 151/301 (50%), Gaps = 44/301 (14%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI-----R 67
           +L+ G QIP +GLG ++ +++   +    A++ GYR  D A    NE  V R I      
Sbjct: 14  RLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKH 73

Query: 68  DSGVPREELFVTTKLWCTQH--RDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRSEQVKH 124
             G  RE+++ TTK+    H     K +L +SL   G L Y+DL ++H P++ R+ ++  
Sbjct: 74  APGRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRLG- 132

Query: 125 TNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGN 184
                                   TW+ ++E    G+  ++GV+N+    L +L+   G 
Sbjct: 133 ------------------------TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEGL 168

Query: 185 KIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVE 244
           KI P  +Q+E +P+L + +++ +C++NNI ++A+SPL       LD+P++++++ +    
Sbjct: 169 KIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPLMR--GKRLDDPILQKVAHQYDKG 226

Query: 245 PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTW 304
            AQ+LV W +Q G  VL K+    R+  N   +D          EL+ E  ++  H+  +
Sbjct: 227 VAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDF---------ELSAETMSELTHSDDY 277

Query: 305 F 305
           F
Sbjct: 278 F 278

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  132 bits (331), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 93/317 (29%), Positives = 155/317 (48%), Gaps = 57/317 (17%)

Query: 13  KLNTGAQIP---LLGLGT-WRSTKENGYNATLAAIKA--------GYRHIDIAAVCMNEQ 60
           KLN G ++P   ++G GT W    E   N +   +          G  H+D A   M  +
Sbjct: 8   KLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTYR 67

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQH--RDPKTALSQSLKRLGLDYVDLYMMHWPVAFR 118
            VGRA+ ++  PR+E+F+T K W       +P   L   LKRLGL+YVDLY++H P    
Sbjct: 68  EVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPFI-- 125

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
               K TN                G+   + W +M+EL  +GK   +GV+NF+   L+++
Sbjct: 126 ---SKETN----------------GFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLERV 166

Query: 179 IDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLGSEGAPLLDEPV-- 233
           +     K+ P  +Q+E + FL QN+   + +FCK+N+I + AYSPLG    PL  +P   
Sbjct: 167 LKVC--KVKPQVNQIEFNAFL-QNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPADG 219

Query: 234 --------VREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDIPEGD 283
                   + ++++  +  P Q+L+ W  +RG   +  S+   RI+    +  FD+ + +
Sbjct: 220 NSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDE 279

Query: 284 LRRINELAQERGTKRIH 300
           +  I +L  +    R++
Sbjct: 280 VTEITKLGLDHEPLRLY 296

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  131 bits (330), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 141/277 (50%), Gaps = 46/277 (16%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR----D 68
           KLN G QIP++G G +   KE+  +   +A+K GYRHID A +  N++   + +R    +
Sbjct: 14  KLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKYLDE 73

Query: 69  SGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLD------YVDLYMMHWPVAFRSEQV 122
           +G  RE ++ TTKLW +Q    +T   ++L+ +  D      YVDL ++H P        
Sbjct: 74  TGEARENIWFTTKLWDSQFGREET--EKALQEVAADVKEYIGYVDLLLLHSPRGG----- 126

Query: 123 KHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNAL-----GVANFSVSQLKK 177
                    KR+            ++TW ++++      + AL     GV+NF V  L++
Sbjct: 127 --------AKRR------------LETWAILEQAVQEPGSKALEIKSIGVSNFGVDHLEE 166

Query: 178 LIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREI 237
           L+     K+ P   QLE HP+LP+ ++  + K+ +I  EAYSPL ++G  L D P +  +
Sbjct: 167 LLKVA--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL-TQGYRLQD-PELLAL 222

Query: 238 SKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANL 274
             K  +  A +L+ W   +G  VLVKS  P RI  NL
Sbjct: 223 EAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNL 259

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  131 bits (329), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/278 (29%), Positives = 142/278 (51%), Gaps = 36/278 (12%)

Query: 11  TAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD-- 68
           + KL++G  IP +GLGT+             A++ GYRH D A +  NE  VG+ I+   
Sbjct: 8   SYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWL 67

Query: 69  ----SGVPREELFVTTKLWCTQH--RDPKTALSQSLKRL-GLDYVDLYMMHWPVAFRSEQ 121
               +   R ++F TTKLW +QH     K A+   L+ +  L Y+DL ++H P+  +  +
Sbjct: 68  NENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLGGKKLR 127

Query: 122 VKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDS 181
           ++                         T+E MQE    GK  ++GV+N+    +++L++ 
Sbjct: 128 LE-------------------------TYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNW 162

Query: 182 PGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKL 241
              K  P  +Q+E  P+  + ++  FCKK  IL+EAY+PL + G  L D  +V+ ++ ++
Sbjct: 163 EKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL-THGTKLKDPDLVK-VANEV 220

Query: 242 HVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
             +  Q L+ W LQ+G+  L K+++ SR+ +NL  F  
Sbjct: 221 GCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  130 bits (327), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 149/290 (51%), Gaps = 39/290 (13%)

Query: 10  ATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI--- 66
            T  L  G ++P LGLG +++ KE   N    A+K GYR +D A +  NE+     I   
Sbjct: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66

Query: 67  --RDSGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRSEQ 121
                 V R ++F TTK+      +   K ++ +SL R+  LDY+DL+++H P+  + ++
Sbjct: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126

Query: 122 VKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDS 181
           +                          TW+  QE   TGK  A+GV+N+ +  L+++   
Sbjct: 127 LG-------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161

Query: 182 PGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKL 241
            G KI P  +Q E +P+L + ++ ++C +  ++++AYSPL    A  L +P + ++ +  
Sbjct: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTR--ARRLQDPELVKLVEDS 219

Query: 242 HVE--PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT--FDIPEGDLRRI 287
           + E   AQ+LV+W LQ G   LVK+    R++ N+ +  F++   DL+++
Sbjct: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  130 bits (328), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 96/306 (31%), Positives = 152/306 (49%), Gaps = 55/306 (17%)

Query: 14  LNTGAQIP---LLGLGT-WRSTKENGYNATLAAIKA--------GYRHIDIAAVCMNEQV 61
           LN G +IP   ++G GT W    E     + + ++         G  HID A +      
Sbjct: 10  LNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYPE 69

Query: 62  VGRAIRDSGVPREELFVTTKLWCTQHR---DPKTALSQSLKRLGLDYVDLYMMHWPVAFR 118
           VG+A+  +  PR+E+F+T K + TQ +    P   L  SLK++G DYVDLY++H P  F 
Sbjct: 70  VGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSP--FV 126

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
           S++                     G+   + W+ M++L   GK   +GV+NF+V  L+K+
Sbjct: 127 SKEAN-------------------GFTLEEAWKDMEQLYKAGKAKNIGVSNFAVKDLEKI 167

Query: 179 IDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLG--------SEGAP 227
           +     ++ P  +Q+E  PFL QN+   +  FC+ NNIL+EAYSPL          +  P
Sbjct: 168 LKIA--EVKPQVNQIEFSPFL-QNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDSKP 224

Query: 228 LLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDIPEGDLR 285
             +   V+E+S+K     AQ+++ W  +RG   +  S  P RI    NL +FD+ + ++ 
Sbjct: 225 FFE--YVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVD 282

Query: 286 RINELA 291
            I EL 
Sbjct: 283 EITELG 288

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  130 bits (326), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 135/275 (49%), Gaps = 36/275 (13%)

Query: 14  LNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI------R 67
           L+ G +IP + LGT+   +          IK GYRH D A +  NE+ VG  I       
Sbjct: 8   LSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNEN 67

Query: 68  DSGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRL-GLDYVDLYMMHWPVAFRSEQVKH 124
                RE++F TTKLW +Q  ++  K A+ Q L  + GL Y+DL ++H P+     +++ 
Sbjct: 68  PESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPLEGSKLRLE- 126

Query: 125 TNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGN 184
                                   TW+ MQE    G   ++GV+N+    + +L+  P  
Sbjct: 127 ------------------------TWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPDL 162

Query: 185 KIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVE 244
              P  +Q+E  P++ + ++  +CK   +++EA++PL   G  + + P + ++ K++   
Sbjct: 163 TYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL-CHGYKMTN-PDLLKVCKEVDRN 220

Query: 245 PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
           P Q+L+ W LQ G+  L K+KT  R+E NL  +D 
Sbjct: 221 PGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYDF 255

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  128 bits (322), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 143/276 (51%), Gaps = 36/276 (13%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI------ 66
           KL++G  +P +GLGT+             A+K GYRH+D A +  NE+ VG  I      
Sbjct: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70

Query: 67  RDSGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRL-GLDYVDLYMMHWPVAFRSEQVK 123
             S   RE++F  TKLW +Q  + + K A+ +  +++ GL Y+DL ++H P++   ++++
Sbjct: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRLE 130

Query: 124 HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183
                                    T++ MQE    G   ++GV+N+ V  + +L++   
Sbjct: 131 -------------------------TYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNE 165

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
            K  P  +Q+E  P+L + ++  +CK   +++EAY+PL + G   ++ P V  ++K+   
Sbjct: 166 LKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL-THGYK-INHPNVLRVAKEAGC 223

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
              Q+L+ W LQ G+  L K+K+  R+ +NL  ++I
Sbjct: 224 NSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  128 bits (322), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 87/304 (28%), Positives = 153/304 (50%), Gaps = 47/304 (15%)

Query: 15  NTGAQIPLLGLGT---WRSTKENG----------YNATLAAIKAGYRHIDIAAVCMNEQV 61
            +G +IP++G G+   WR  K +G           +   +AI AG+ HID A        
Sbjct: 12  GSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAYKTHPE 71

Query: 62  VGRAIRDSGVPREELFVTTKL--WCTQHRD---PKTALSQSLKRLGLDYVDLYMMHWPVA 116
           VGR +++SGVPR++L++T K   W    R    P  +LS SL+++ + YVDLY++H P  
Sbjct: 72  VGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLLHVP-- 129

Query: 117 FRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLK 176
           F + Q                     G D  + W  M+E+   G    +GV+NF V  L+
Sbjct: 130 FITVQTA-------------------GIDLKEAWRQMEEIYDRGLAKNIGVSNFDVESLE 170

Query: 177 KLIDSPGNKIVPAASQLETHPFLPQNK--MLSFCKKNNILMEAYSPLG--SEGAPLLDEP 232
            +  +   K +P  +Q+E + +L Q    ++++CK ++I++E YSPL   ++G P   + 
Sbjct: 171 YI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGRPGPLDK 228

Query: 233 VVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDIPEGDLRRINEL 290
           ++  +++K H    Q+L+ W  Q G  V+  S   +R++   N+  F++   D   I ++
Sbjct: 229 LLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAEDFDSITKI 288

Query: 291 AQER 294
            +E+
Sbjct: 289 GREK 292

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  127 bits (319), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 143/287 (49%), Gaps = 38/287 (13%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD---- 68
           KL+ G +IP + LGT+   +          IK GYRH D A +  NE+ VG  I      
Sbjct: 7   KLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNE 66

Query: 69  --SGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRL-GLDYVDLYMMHWPVAFRSEQVK 123
                 R ++F TTKLW +Q  +R  K A+ Q L  + GL+Y+DL ++H P+     +  
Sbjct: 67  DPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPLEGSKLR-- 124

Query: 124 HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183
                                  ++TW  MQE    G   ++GV+N+    + +L++   
Sbjct: 125 -----------------------LETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWSE 161

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
            +  P  +Q+E  P++ + ++  +CK   +++EA++PL   G  + + P +  + K++  
Sbjct: 162 LRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL-CHGYKMTN-PDLLIVCKEVDR 219

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANL--HTFDIPEGDLRRIN 288
            P Q+L+ W LQ G+  L K++T  R+E NL  ++F++ +  ++ ++
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSDEQMKTLD 266

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  127 bits (318), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 82/273 (30%), Positives = 140/273 (51%), Gaps = 36/273 (13%)

Query: 16  TGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD------S 69
            G +IP L LG +   +    N    A+K GYRH D A +  NE+ VG  I        +
Sbjct: 11  NGIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKEDPA 70

Query: 70  GVPREELFVTTKLWCTQ--HRDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRSEQVKHTN 126
              RE++F TTKLW +Q  +   K  +S+ + ++  L Y+DL ++H P++          
Sbjct: 71  NNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSPLSG--------- 121

Query: 127 YMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNKI 186
               P+R+            ++T++ MQE    G   ++GV+N+    +++L      K 
Sbjct: 122 ----PRRR------------LETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDKLKH 165

Query: 187 VPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEPA 246
            P A+Q+E  P+  +  + S+C+   +++EA+SPL + G   L EP +  ++KKL  +  
Sbjct: 166 KPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL-THGYK-LKEPGLVSLAKKLGRDTG 223

Query: 247 QLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
           Q+L+ W LQRG   L K++ P+R+ +NL  +D 
Sbjct: 224 QVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDF 256

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  127 bits (320), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 100/319 (31%), Positives = 168/319 (52%), Gaps = 61/319 (19%)

Query: 14  LNTGAQIP---LLGLGT-WRSTKEN--GYNATL------AAIKAGYRHIDIAAVCMNEQV 61
           LN G ++P   ++G GT W  T+E    ++  L      A    G  HID A V      
Sbjct: 11  LNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYPE 70

Query: 62  VGRAIRDSG--VPREELFVTTKLWCTQHR---DPKTALSQSLKRLGLDYVDLYMMHWPVA 116
           VG+A+R+S    PR+E+F+T K + TQ +   +P   L+  LK+LGLDYVDLY++H P  
Sbjct: 71  VGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSP-- 127

Query: 117 FRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLK 176
                        I K K+G   ++E W Y      M++L   GK   +GV+NFS++ L+
Sbjct: 128 ------------FISKEKNGFT-MEEAWKY------MEDLYKAGKVKNIGVSNFSMADLQ 168

Query: 177 KLIDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLGSEGAPLLDEP- 232
           +++ S   ++ P  +Q+E + FL QN+   +++FC++N+I + AY+PLG    PL  +  
Sbjct: 169 RILKSC--EVKPQVNQIEFNAFL-QNQTPGIVNFCRENDIQVVAYTPLG----PLQRKSK 221

Query: 233 ---------VVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDIPE 281
                     V+++++K     AQ+L+ W  +RG   +  S    RI+    L TFD+ +
Sbjct: 222 NFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTD 281

Query: 282 GDLRRINELAQERGTKRIH 300
            ++ +I +L  +   +R++
Sbjct: 282 SEVEKITQLGLKHEPQRMY 300

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  127 bits (318), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/324 (31%), Positives = 161/324 (49%), Gaps = 61/324 (18%)

Query: 14  LNTGAQIP---LLGLGT-W--RSTKENGYNATL------AAIKAGYRHIDIAAVCMNEQV 61
           LN G QIP   ++G GT W  R   E+ ++  L      A    G  HID A        
Sbjct: 10  LNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTYPE 69

Query: 62  VGRAIRDSGVPREELFVTTKLWCTQHR---DPKTALSQSLKRLGLDYVDLYMMHWPVAFR 118
           + +A+++S  PR E+F+T K + TQ +   DP   L+  LK LGLDYVDLY++H P    
Sbjct: 70  LAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSPFF-- 126

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
                              P+        K W+ M+ L   GK  ++GV+NFSV  ++++
Sbjct: 127 ------------------DPEFKGSLTLEKVWKDMETLYKEGKAKSIGVSNFSVKNIEEI 168

Query: 179 IDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLGSEGAPLLDEP--- 232
           +   G  I P  +Q+E + FL QN+   ++++C+KNNI +EAYSPLG    PL   P   
Sbjct: 169 LKIAG--IKPQVNQIEFNAFL-QNQTPGIVNYCQKNNIQLEAYSPLG----PLQKRPENS 221

Query: 233 -------VVREISKKLHVEPAQLLVSWGLQRG-HAVLVKSKTPSRIEA-NLHTFDIPEGD 283
                   + E++ K     +Q+L++W   RG   +   SKT   I+A N+ +F++ + +
Sbjct: 222 NELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTKDE 281

Query: 284 LRRINELAQERGTKRIHNPTWFSF 307
           +  + +L  E+   RI+   W +F
Sbjct: 282 VDTLTKLGLEQPALRIY---WTNF 302

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  126 bits (317), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/318 (31%), Positives = 161/318 (50%), Gaps = 54/318 (16%)

Query: 14  LNTGAQIP---LLGLGT-WRSTKENGYNATLAAIKA--------GYRHIDIAAVCMNE-Q 60
           LN G +IP   ++G GT W   +E   N +   ++         G  H+D AA C N  Q
Sbjct: 29  LNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLD-AAECYNTYQ 87

Query: 61  VVGRAIRDSGVPREELFVTTKLWCT--QHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFR 118
            +G+A+R+S  PR+E+F+T K   T   H          +K++G+DYVDLY++H P    
Sbjct: 88  ELGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSP---- 143

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
                     LI K K+G           + W+ +++L   GK   +GV+NF V  L+++
Sbjct: 144 ----------LIEKEKNGVT-------LEEVWKDLEKLYEAGKAKNIGVSNFRVEDLQRI 186

Query: 179 IDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLG------SEGAPLL 229
           +     K+ P  +Q+E H FL QN+   ++ F + NNI +EAY+PLG      S+     
Sbjct: 187 LKVA--KVKPQVNQIEFHVFL-QNQTPGIVKFSQDNNIQLEAYTPLGPLQRKQSDAGDFY 243

Query: 230 DEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEA--NLHTFDIPEGDLRRI 287
           +   V E++KK     AQ+L+ W  +R    +  S  P RI+A  +L +FD+ + ++++I
Sbjct: 244 N--YVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKKI 301

Query: 288 NELAQERGTKRIH-NPTW 304
            EL  +    R++ N  W
Sbjct: 302 TELGLKHKPLRLYWNDVW 319

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  125 bits (315), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 97/316 (30%), Positives = 157/316 (49%), Gaps = 57/316 (18%)

Query: 14  LNTGAQIP---LLGLGT-WRSTKENGYNATLA---------AIK-AGYRHIDIAAVCMNE 59
           LN G +IP   ++G GT W   +E   +AT +         A+K  G  HID A +    
Sbjct: 10  LNNGNKIPAIAIIGTGTRWYKNEET--DATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 60  QVVGRAIRDSGVPREELFVTTKL--WCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAF 117
             VG+A+  +  PR  +F+T K          P   L  +LK++G DYVDLY++H P  F
Sbjct: 68  PEVGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSP--F 125

Query: 118 RSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKK 177
            S++V                    G    + W+ M++L  +GK   +GV+NF+V  L++
Sbjct: 126 VSKEVN-------------------GLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQR 166

Query: 178 LIDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLG--------SEGA 226
           ++     ++ P  +Q+E  PFL QN+   +  FC++++IL+EAYSPLG         +  
Sbjct: 167 ILKVA--EVKPQVNQIEFSPFL-QNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQ 223

Query: 227 PLLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDIPEGDL 284
           P  +   V+E+S+K     AQ+++ W  +RG   +  S  P RI    NL +FD+   ++
Sbjct: 224 PFFE--YVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEV 281

Query: 285 RRINELAQERGTKRIH 300
            +I EL  E    R++
Sbjct: 282 DKITELGLEHEPLRLY 297

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  124 bits (312), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 95/320 (29%), Positives = 154/320 (48%), Gaps = 56/320 (17%)

Query: 14  LNTGAQIP---LLGLGT-WRSTKENGYNATLAAIKA--------GYRHIDIAAVCMNEQV 61
           LN G +IP   ++G GT W   +E   N + A +K         G  H+D A V      
Sbjct: 10  LNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYPE 69

Query: 62  VGRAIRDSGVPREELFVTTKLWCTQHR---DPKTALSQSLKRLGLDYVDLYMMHWPVAFR 118
              A++++  PR E+FVT K +  Q +   DP+  L   LKR GL+YVDLY++H P A +
Sbjct: 70  FSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFASK 128

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
            +                      G+   + W  ++EL   GK   +GV+NF V  L+K+
Sbjct: 129 EKN---------------------GFTIEEAWAQLEELYHEGKAKNIGVSNFRVEDLEKI 167

Query: 179 IDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLG--------SEGAP 227
           +     K+ P  +Q+E   FL QN+   ++ F + ++I +EAY+PLG         +  P
Sbjct: 168 LKVA--KVKPQVNQIEFSAFL-QNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKP 224

Query: 228 LLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDIPEGDLR 285
             D   ++++++K     AQ+L+ W  +RG   +  S  P RIE   NL  FD+ + ++ 
Sbjct: 225 FYD--YIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVD 282

Query: 286 RINELAQERGTKRIH-NPTW 304
            I +L       R++ NP +
Sbjct: 283 EITKLGLAHPALRLYWNPLY 302

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  123 bits (308), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 138/275 (50%), Gaps = 36/275 (13%)

Query: 14  LNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD----- 68
           L+ G +IP L LGT+   K    N    A+K GYRH D A +  NE+ VG  I       
Sbjct: 9   LSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQED 68

Query: 69  -SGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRL-GLDYVDLYMMHWPVAFRSEQVKH 124
                RE++F TTKLW +Q  ++  K A+ + L+++  L Y+DL ++H P++   ++++ 
Sbjct: 69  PKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKRLE- 127

Query: 125 TNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGN 184
                                   T++ MQE    G   ++GV+N+    L++L+   G 
Sbjct: 128 ------------------------TYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEGL 163

Query: 185 KIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVE 244
           K  P  +Q+E  P+  + ++  +C+   I++E Y+PL + G  L D  +V+ +++++   
Sbjct: 164 KYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL-THGYKLKDPQLVK-VAEEVGKN 221

Query: 245 PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
             Q+L+ W LQ G+  L K+    R+  NL  +D 
Sbjct: 222 TGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDF 256

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  122 bits (306), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 154/313 (49%), Gaps = 51/313 (16%)

Query: 14  LNTGAQIP---LLGLGT-WRSTKENGYNAT--------LAAIKAGYRHIDIAAVCMNEQV 61
           LN G +IP   ++G GT W  T+EN    +         A    G  HID A +      
Sbjct: 10  LNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYPE 69

Query: 62  VGRAIRDSGVPREELFVTTKLWCTQHR---DPKTALSQSLKRLGLDYVDLYMMHWPVAFR 118
           +G+A+R++  PR E+++T K + T  +   +P       LK LG+DY+DLY++H P    
Sbjct: 70  LGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSP---- 124

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
                      I + ++       G+   + W+ ++EL  +GK   +GV+NF+   L+++
Sbjct: 125 ----------FITEGRN-------GFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERI 167

Query: 179 IDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLG------SEGAPLL 229
           +     +I P  +Q+E   FL QN+   + +F K+N+IL+EAYSPLG       E   L 
Sbjct: 168 LKIA--EIKPQVNQIEYSAFL-QNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADSLP 224

Query: 230 DEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLH--TFDIPEGDLRRI 287
               + E+++K     AQ+L+ W  +RG   +  S  P R+    H  TFD+   ++ +I
Sbjct: 225 FYKYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVEKI 284

Query: 288 NELAQERGTKRIH 300
            EL  +    R++
Sbjct: 285 TELGLKHEALRLY 297

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  122 bits (305), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 147/313 (46%), Gaps = 65/313 (20%)

Query: 15  NTGAQIPLLGLGT---WRSTKENG----------YNATLAAIKAGYRHIDIAAVCMNEQV 61
            T   IP+LG GT   WR  K  G           +  + A+  G+ HID A   +  + 
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 62  VGRAIRDSGVPREELFVTTK--------LWCTQHRDPKTALSQSLKRLGLDYVDLYMMHW 113
           VG A+R S +PR++LF+T K        L C+    P  A  + L+ LG+ Y DLYM+H 
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCS---GPIQAAKKGLEALGIKYFDLYMLH- 128

Query: 114 PVAFRSEQVKHTNYMLIPKRKDGQPDV---DEGWDYVKTWELMQELPATGKTNALGVANF 170
                                  +PD+   + G D  + W  ++EL   G   A+GV+NF
Sbjct: 129 -----------------------RPDITKENAGIDLQEAWRQVEELYEAGIAKAIGVSNF 165

Query: 171 SVSQLKKLIDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLG----S 223
            +  LK++      + +P   Q+E HP+L QN+   ++ +C+  +I++EAYSPL     +
Sbjct: 166 PLETLKQM--ESYCRYLPMVHQVEFHPYL-QNQSPGVVEWCQNKHIVVEAYSPLAPLFRA 222

Query: 224 EGAPLLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT--FDIPE 281
              PL D  ++  + KK      Q+++ W + RG   L  S    RI   L T  F++ +
Sbjct: 223 RPGPLDD--ILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEK 280

Query: 282 GDLRRINELAQER 294
            D+  INE+  ++
Sbjct: 281 SDVELINEVGSKK 293

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  119 bits (299), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 139/276 (50%), Gaps = 36/276 (13%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD---- 68
           KL++G  +P LGLGT+   +         A+KAGYRH+D A +  NE+ VG  +      
Sbjct: 11  KLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLKE 70

Query: 69  --SGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRSEQVK 123
                 R ++F TTKLW +Q  + + K A+ + L ++  L Y+D+ ++H P++    +  
Sbjct: 71  DPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLSGTRRR-- 128

Query: 124 HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183
                                  ++T++ MQE    G   ++GV+N+    + +L+    
Sbjct: 129 -----------------------LETYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWEE 165

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
            K  P  +Q+E  P++ +  +  +CK   +++EA+SPL + G  +    VVR +++++  
Sbjct: 166 LKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL-THGYKIKHPNVVR-VAEEVGR 223

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
              Q+L+ W LQ G+  L KS++  R++ NL  +D 
Sbjct: 224 NTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVYDF 259

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  119 bits (298), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 141/276 (51%), Gaps = 36/276 (13%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRD---- 68
           KL++G  +P +GLGT+   +         A+K+GYRH+D A +  NE  VG+ I+     
Sbjct: 18  KLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEE 77

Query: 69  --SGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRSEQVK 123
                 R+++F TTKLW +Q  + + K A+ + ++++  L Y+DL ++H P++    +  
Sbjct: 78  DPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRR-- 135

Query: 124 HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183
                                  ++T++ MQE    G   ++GV+N+    + +L+    
Sbjct: 136 -----------------------LETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKE 172

Query: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243
            K  P  +Q+E  P++ +  +  +CK   +++EA+SPL + G   L  P V  ++K+   
Sbjct: 173 LKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL-THGYK-LKHPDVLLVAKETGT 230

Query: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
           +  ++L+ W LQ G+  L KS++  R++ N+  +D 
Sbjct: 231 DAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDF 266

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  118 bits (295), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 95/307 (30%), Positives = 143/307 (46%), Gaps = 49/307 (15%)

Query: 10  ATAKLNTGAQIP---LLGLGT-WRSTKENGYNATLAAIKA--------GYRHIDIAAVCM 57
           A   LN G ++P   ++G GT W   KE  +  +   I+         G  HID A +  
Sbjct: 6   AFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEMYG 65

Query: 58  NEQVVGRAIRDSGVPREELFVTTK--LWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPV 115
               +  A+R +  PR E+F+T K  L     +DP   L  SLK   LDYVDLY++H P 
Sbjct: 66  TYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYLLHSP- 124

Query: 116 AFRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQL 175
                         + K K G     EG      W  M++L   GK   +GV+NFSV  L
Sbjct: 125 -------------FVAKEKPGL--TLEG-----AWRQMEQLYKDGKAKNIGVSNFSVEDL 164

Query: 176 KKLIDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLGSEGAPLLDEP 232
           K+++     +I P  +Q+E HPFL QN+   +L FC+  NI +EA++PLG       ++ 
Sbjct: 165 KRVLSVA--EIKPQVNQIEFHPFL-QNQTPGILKFCQDENIELEAFTPLGPLQVKTQEDE 221

Query: 233 ------VVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRI--EANLHTFDIPEGDL 284
                  +  +S K     AQ+++ W  +RG   +  S+   RI    NL  FD+ + ++
Sbjct: 222 NDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLEDEEV 281

Query: 285 RRINELA 291
            +I  L 
Sbjct: 282 TKITRLG 288

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  117 bits (292), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 92/304 (30%), Positives = 145/304 (47%), Gaps = 47/304 (15%)

Query: 15  NTGAQIPLLGLGT---WRSTKENG-----YNATLA-----AIKAGYRHIDIAAVCMNEQV 61
            +G ++P++G G+   WR  K  G     +   LA     AIKAG+ HID A        
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 62  VGRAIRDSGVPREELFVTTKL--WC---TQHRDPKTALSQSLKRLGLDYVDLYMMHWPVA 116
           VG  I +SGVPRE+L+VT K   W     + + P  +L  SL ++ + YVDLY++H P  
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVHVPFI 131

Query: 117 FRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLK 176
                                P+   G D  + W  M+E+   G    +GV+NF V  L 
Sbjct: 132 --------------------NPET-AGIDLKEAWRQMEEIYDRGWAKNIGVSNFDVESL- 169

Query: 177 KLIDSPGNKIVPAASQLETHPFLPQNK--MLSFCKKNNILMEAYSPLG--SEGAPLLDEP 232
           + I + G K  P  +Q+E   ++ Q    ++S+CKK+ I +E YSPL   ++G P   + 
Sbjct: 170 EYIRTIG-KYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGKPGPLDD 228

Query: 233 VVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFD--IPEGDLRRINEL 290
           ++  ++KK      Q+L+ W +Q G   +  S    RI+ +L  FD  +   D   I E+
Sbjct: 229 ILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFTSITEV 288

Query: 291 AQER 294
            + +
Sbjct: 289 GKTK 292

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  114 bits (285), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 89/315 (28%), Positives = 155/315 (49%), Gaps = 53/315 (16%)

Query: 9   TATAKLNTGAQIP---LLGLGT--WRSTKENGYNATL------AAIKAGYRHIDIAAVCM 57
           T+   LN G +IP   ++G GT  ++   E+ Y+  L      A    G  HID A +  
Sbjct: 5   TSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQ 64

Query: 58  NEQVVGRAIRDSGVPREELFVTTKLWCTQH--RDPKTALSQSLKRLGLDYVDLYMMHWPV 115
               VG A+R+S  PR+E+F+T K    +    +PK  L  +L+++GL+YVDLY++H+P+
Sbjct: 65  THAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFPI 124

Query: 116 AFRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQL 175
                        + PK  D   +        + W++M++L   G    +GV+NF V  L
Sbjct: 125 -------------IDPKLYDFTLE--------EAWKMMEDLYNEGLAKNIGVSNFRVEDL 163

Query: 176 KKLIDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPL-------GSEG 225
           ++L  S    I P  +Q+E + +L QN+   +  +C KNNI +EA+ PL         + 
Sbjct: 164 EQL--SKSWVIKPQINQIEFNAYL-QNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKDL 220

Query: 226 APLLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDIPEGD 283
            PL     V+++++K      Q+++ W  QR    +  S  P R+    ++ +F++ + +
Sbjct: 221 LPL----YVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDE 276

Query: 284 LRRINELAQERGTKR 298
           +  I +L  +  T R
Sbjct: 277 VEFITKLGSQHDTIR 291

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  114 bits (285), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 88/304 (28%), Positives = 144/304 (47%), Gaps = 49/304 (16%)

Query: 16  TGAQIPLLGLGT---WRSTKENG-----YNATLA-----AIKAGYRHIDIAAVCMNEQVV 62
           +G  +P +G G+   WR  K +G     Y   LA     AI+ G+ HID A      + V
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 63  GRAIRDSGVPREELFVTTKL--WCTQHRD---PKTALSQSLKRLGLDYVDLYMMHWP-VA 116
           G  I ++ VPRE L++T K   W  + R    P  +L+ SLK + LDYVDLYM+H P + 
Sbjct: 74  GTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIHVPNIT 133

Query: 117 FRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLK 176
            ++                       G D  + W  M+E+        +GV+NF V  L+
Sbjct: 134 TKT----------------------AGIDLKEAWLQMEEIYTRKMARNIGVSNFDVESLE 171

Query: 177 KLIDSPGNKIVPAASQLETHPFLPQNK--MLSFCKKNNILMEAYSPLG--SEGAPLLDEP 232
            +      K  P  +Q+E   ++ Q    +L +C++NNI++E YSPL   ++G P   + 
Sbjct: 172 YI--KSFAKYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKPGPLDE 229

Query: 233 VVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFD--IPEGDLRRINEL 290
           ++  I+ K      Q+L+ W  Q G  V+  +    R+  +L+ FD  + + D  +I  +
Sbjct: 230 ILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQITNV 289

Query: 291 AQER 294
            +E+
Sbjct: 290 GREK 293

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  113 bits (282), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 94/321 (29%), Positives = 153/321 (47%), Gaps = 66/321 (20%)

Query: 14  LNTGAQIP---LLGLGT-WRSTK-ENG-----------YNATLAAIKAGYRHIDIAAVCM 57
           LN G +IP   ++G GT W   K E+G           Y  TL  I     HID A +  
Sbjct: 10  LNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGI----IHIDAAEMYN 65

Query: 58  NEQVVGRAIRDSGVPREELFVTTKLWCTQHR---DPKTALSQSLKRLGLDYVDLYMMHWP 114
               V +A++ +   R+E+F+T K +    +   +P   L++SLK L LDYVDLY++H P
Sbjct: 66  TYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYLLHSP 125

Query: 115 VAFRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQ 174
              +                        G+   + W+ M++L   GK   +GV+NFSV  
Sbjct: 126 FITKESC---------------------GYTMEEAWKQMEKLYKDGKAKNIGVSNFSVDD 164

Query: 175 LKKLIDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLGSEGAPLLDE 231
           LK+++     +I P  +Q+E + FL QN+   ++ FC+ ++IL+EAYSPLG    PL  +
Sbjct: 165 LKRILKI--CEIKPQINQIEFNAFL-QNQTPGIVKFCQDHDILVEAYSPLG----PLRKK 217

Query: 232 PV----------VREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIE--ANLHTFDI 279
           P           + E++KK      Q+L+ W  +R    +  S    RI+   +L +FD+
Sbjct: 218 PTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSFDL 277

Query: 280 PEGDLRRINELAQERGTKRIH 300
              ++ +I +L       R++
Sbjct: 278 TSEEVEKITKLGLAHEPSRLY 298

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  108 bits (269), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 90/315 (28%), Positives = 150/315 (47%), Gaps = 58/315 (18%)

Query: 14  LNTGAQI---PLLGLGT-WRS-------TKENGYNATLAAIKAGYRHIDIAAVCMNEQVV 62
           LN G +I    ++G GT W++       + E    A  A    G  H+D A        +
Sbjct: 10  LNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRTYPEL 69

Query: 63  GRAIRDSGVPREELFVTTKLWCTQH--RDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
            +A+++S  PR E+F+T K         +P  AL+ +L  LGLDYVDLY++H+P      
Sbjct: 70  NKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGLDYVDLYVLHFP------ 123

Query: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180
                     P+ KD    ++  W        M+ L   GK   +GV+NFS+  L++++ 
Sbjct: 124 -------EFDPEYKD--LSIETAW--------MELLYKEGKAKNIGVSNFSIEHLERVMK 166

Query: 181 SPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYSPLGSEGAPLLDEP----- 232
               K  P  +Q+E + FL QN+   ++ +C++N   +EAYSPL    APL  +P     
Sbjct: 167 IADVK--PQVNQIEFNAFL-QNQTPGIVKYCQQNGFQLEAYSPL----APLQRKPKNFNE 219

Query: 233 -----VVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRI--EANLHTFDIPEGDLR 285
                 + E+S K     +++L+ W  +RG   +  S    RI    NL +FD+ + ++ 
Sbjct: 220 LPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTDEEVD 279

Query: 286 RINELAQERGTKRIH 300
           +I +L  E+   R++
Sbjct: 280 KITKLGLEQPALRLY 294

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  102 bits (254), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 134/269 (49%), Gaps = 40/269 (14%)

Query: 46  GYRHIDIAAVCMNEQVVGRAIRDSGVPREELFVTTKLWCTQHR---DPKTALSQSLKRLG 102
           G+ HI  A    N  ++  A++ S  PR E+++T K +C+Q +    P  AL +SL RLG
Sbjct: 54  GFLHIMTAEFYPNNGLLSAALKASQKPRHEIWITDK-YCSQCKLSSSPIEALERSLDRLG 112

Query: 103 LDYVDLYMMHWPVAFRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKT 162
            DYVDLY++H P                    D  P+   G    K W+ M+ L  TGK 
Sbjct: 113 FDYVDLYLIHNPCL------------------DSSPN---GISLEKAWKQMELLYKTGKV 151

Query: 163 NALGVANFSVSQLKKLIDSPGNKIVPAASQLETHPFLPQNK---MLSFCKKNNILMEAYS 219
             +GV+NF +  L++L D+   +I P  +++E H FL QN+   +  + K +++L+  YS
Sbjct: 152 KNIGVSNFRIEDLERLKDA---EIKPQVNEIEFHAFL-QNQTPNIYEYAKTHDLLLCGYS 207

Query: 220 ---PLGSEGAPLLDEPVVREI---SKKLHVEPAQLLVSWGLQRG-HAVLVKSKTPSRIEA 272
              PL ++    +D P  R I   ++K +   AQ+L+ W    G   V+  +K     EA
Sbjct: 208 PLFPLETKTEDFMDFPFYRYIIGLAEKYNKTEAQILLHWMNCLGVLPVITNTKVKWYKEA 267

Query: 273 -NLHTFDIPEGDLRRINELAQERGTKRIH 300
            ++ +F++   +L  I EL ++    R H
Sbjct: 268 SDIISFELTSEELDMITELGKKHKPHRKH 296

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 66.6 bits (161), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 53/90 (58%), Gaps = 6/90 (6%)

Query: 13  KLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIR----D 68
           KLN G QIP++G G +   KE+  +   +A+K GYRHID A +  N++   + +R    +
Sbjct: 14  KLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVRKYLDE 73

Query: 69  SGVPREELFVTTKLWCTQ--HRDPKTALSQ 96
           +G  RE ++ TTKLW +Q    + K AL +
Sbjct: 74  TGEARENIWFTTKLWDSQFGREETKKALQE 103

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 82/179 (45%), Gaps = 31/179 (17%)

Query: 50  IDIAAVCMNEQV---VGRAIRDSGVPREELFVTTKLWCTQHRDPKTAL--SQSLKRLGLD 104
           IDIAA  + +Q    VG A+  +  P+ E+F+T K           A+    +LK++ ++
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKISVE 66

Query: 105 YVDLYMMHWPVAFRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNA 164
           YVD++ +H P  F+                  Q +V    D + T  L +    + K N 
Sbjct: 67  YVDMHFLHSPFVFK------------------QANVLNLKDAMHTDHLRR----SNKANN 104

Query: 165 LGVANFSVSQLKKLIDSPGNKIVPAASQLETHPFLPQNK--MLSFCKKNNILMEAYSPL 221
            G ++ +V +L++++ +   +  P  +Q++    L      +   C++N+ILM  YS L
Sbjct: 105 RGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTL 161

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/331 (20%), Positives = 132/331 (39%), Gaps = 55/331 (16%)

Query: 15  NTGAQI-PLL------GLGTW----RSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ--- 60
           NTG ++ PL+      G  TW    +  KE  +     A   G R  D A V  N Q   
Sbjct: 11  NTGLKVSPLIIGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEI 70

Query: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120
           ++G  +R   +PRE + + TKL      +           + L+ V++  +     F S 
Sbjct: 71  ILGEFLRKYNIPRETVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSS 130

Query: 121 QV---KHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANF---SVSQ 174
           +    +   Y+ I +   G PD      + +T   + ++   G T  +G +       ++
Sbjct: 131 RASVKRLGTYIDILQIHRGDPDTP----FEETMGALNDVVIEGLTRYVGASLMLATEFAE 186

Query: 175 LKKLIDSPG-NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPL---------GSE 224
           ++ + +  G  K V + S         + +++ F K++NI +  +SPL         G+E
Sbjct: 187 MQFVAEKHGWFKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPLNRGLLCRPLGTE 246

Query: 225 GAPLLDEPVVR-------------------EISKKLHVEPAQLLVSWGLQRGHAVLVKSK 265
                 + V++                   ++S K ++  + + ++W LQ+G   +V   
Sbjct: 247 TTRSNSDSVIKTKNLKNYTDWEASIINRVEKLSIKKNIPMSAISLAWVLQKGCFPIVGFS 306

Query: 266 TPSRIEANLHTFDI--PEGDLRRINELAQER 294
           +  R+E  +   D+   E +++ + E  Q R
Sbjct: 307 SIERVEEAIDALDVNLTEEEMKYLEEPYQHR 337

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 81/194 (41%), Gaps = 39/194 (20%)

Query: 37  NATLAAIKAGYRHIDIAAVCMNEQVVGRAIRDSGVPREELFVTTKL-----WCTQHRDPK 91
           N  +  +KAG + ID A +  + +   +AI +  +P +   + TK       C    +  
Sbjct: 19  NEIVTVLKAGVKDIDTARIYPDNE---KAIGELQLP-DRFTIHTKASGFSGGCLTRDNIN 74

Query: 92  TALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWE 151
            ++ +SL  LG+  V+ +++H P                    D +  ++E      T +
Sbjct: 75  KSIEESLSLLGVPSVETFLLHSP--------------------DPEIPLEE------TLD 108

Query: 152 LMQELPATGKTNALGVANFSVSQLKKLIDSPGNK--IVPAASQLETHPFLPQ--NKMLSF 207
            +  L   GK    G++NFS   +K++ D   +K  ++P   Q   +       N +   
Sbjct: 109 AINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNALSRAIVNDLFPL 168

Query: 208 CKKNNILMEAYSPL 221
            K+ +I + AYSP+
Sbjct: 169 LKELHISLYAYSPI 182

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 36.6 bits (83), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 85/224 (37%), Gaps = 61/224 (27%)

Query: 32  KENGYNATLAAIKAGYRHIDIAAVC---MNEQVVGRAIRDSGVPREELFVTTKLWC---- 84
           KE  +     A   G R  D A V    M+E ++G  +R   +PRE + + TK++     
Sbjct: 39  KEEIFGILKHAYDRGLRTYDTADVYSNGMSETILGEFLRTYNIPRETVVIMTKVFFPVDD 98

Query: 85  --------------------TQHRDPK---TALSQSLKRLGLDYVDLYMMHWPVAFRSEQ 121
                                QH   K    A+  S+KRLG  Y+D+Y +H         
Sbjct: 99  KMDISSNRTKTEEENLQLINQQHLSRKHILNAVKNSVKRLG-TYIDVYQIH--------- 148

Query: 122 VKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANF---SVSQLKKL 178
                      R D +   +E      T   + ++   G    LG ++      ++++ +
Sbjct: 149 -----------RCDHETPFEE------TMRALNDVVEQGDVRYLGASSMLAVEFAEMQFI 191

Query: 179 IDSPG-NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPL 221
            +  G +K V   S         + +M+ FCK++ I +  +SP+
Sbjct: 192 AEKHGWHKFVNMQSCYNLVYREDEREMIPFCKRHGIALTPWSPI 235

>YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putative
           aryl-alcohol dehydrogenase; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; mutational analysis has not
           yet revealed a physiological role
          Length = 363

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 21/90 (23%)

Query: 44  KAGYRHIDIAAVCMNEQV---VGRAIRDSGVPREELFVTTKL----------------WC 84
           +AG   ID A  C NEQ    +G  I+   + R+++ + TK                 +C
Sbjct: 61  EAGGNFIDAANNCQNEQSEEWIGEWIQSRRL-RDQIVIATKFIKSDKKYKAGESNTANYC 119

Query: 85  TQH-RDPKTALSQSLKRLGLDYVDLYMMHW 113
             H R    ++  SL++L  D++D+  +HW
Sbjct: 120 GNHKRSLHVSVRDSLRKLQTDWIDILYVHW 149

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 104/248 (41%), Gaps = 35/248 (14%)

Query: 15  NTGAQIP--LLGLGTWRSTK---------ENGYNATLAAIKAGYRHIDIA---AVCMNEQ 60
           NTG +I   + G  T+ + K         E+ Y     A   G R  D A   A  ++E 
Sbjct: 11  NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 61  VVGRAIRDSGVPREELFVTTKLWC----TQHRDPKTALSQSLKRLGLDYVD---LYMMHW 113
           ++G  ++   +PRE + + TK++     T   +P   L  + + L L  V+   L   H 
Sbjct: 71  ILGSFLKHYNIPRETVVIMTKVFYRVDDTIELNPTDLLFGNNEELNLRLVNQKGLSRKHI 130

Query: 114 PVAFRSEQVKHTNYMLIPK--RKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANF- 170
             A ++   +   Y+ + +  R D +   +E      T   + ++   G    +G ++  
Sbjct: 131 LEAAKNSVRRLGTYIDVYQIHRCDHETPFEE------TMRALNDVVEQGYARYIGASSML 184

Query: 171 --SVSQLKKLIDSPG-NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPL--GSEG 225
               ++ + + +  G +K V   +         + +ML FCKKNN+ +  +SPL  G   
Sbjct: 185 GTEFAEYQFIAEKHGWHKFVNMQTCYNLLYREDEREMLPFCKKNNVAITPWSPLQMGFLA 244

Query: 226 APLLDEPV 233
            P+ ++ V
Sbjct: 245 RPITEKSV 252

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 20/124 (16%)

Query: 31  TKENGYNATLAAIKAGYRHIDIAAVCMNEQ--------VVGRAIRDSGVPREELFVTTKL 82
           +KE  +    A  +AG   ID A    NEQ        +V R +RD  V   +     K 
Sbjct: 51  SKERAFELLDAFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKLRDQIVIATKFTTDYKK 110

Query: 83  W----------CTQH-RDPKTALSQSLKRLGLDYVDLYMMHWPVAFRS-EQVKHTNYMLI 130
           +          C  H R    ++  SL++L  D++D+  +HW     S E+V  + ++L+
Sbjct: 111 YDVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHWWDYMSSIEEVMDSLHILV 170

Query: 131 PKRK 134
            + +
Sbjct: 171 QQAR 174

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 52/123 (42%), Gaps = 20/123 (16%)

Query: 32  KENGYNATLAAIKAGYRHIDIAAVCMNEQ--------VVGRAIRDSGVPREELFVTTKLW 83
           KE  +    A  +AG   ID A    NEQ        +V R +RD  V   +     K +
Sbjct: 52  KERAFELLDAFFEAGGNFIDTANNYQNEQSEAWIGEWMVSRKLRDQIVIATKFTTDYKKY 111

Query: 84  ----------CTQHRDP-KTALSQSLKRLGLDYVDLYMMHWPVAFRS-EQVKHTNYMLIP 131
                     C  H+     ++  SL++L  D++D+  +HW     S E+V  + ++L+ 
Sbjct: 112 EVGKGRSANFCGNHKHSLHVSVRDSLRKLQTDWIDILYVHWWDYMSSIEEVMDSLHILVQ 171

Query: 132 KRK 134
           + K
Sbjct: 172 QGK 174

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 51/279 (18%), Positives = 109/279 (39%), Gaps = 54/279 (19%)

Query: 46  GYRHIDIAAVCMN---EQVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLG 102
           G R  D A V  N   E+++G  ++   + RE + + +K++     D    L Q  K + 
Sbjct: 53  GLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIFFPV--DESLDLHQGSK-VD 109

Query: 103 LDYVDLYM----------MHWPVAFRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWEL 152
            +Y+DL +          +   VA   E++     +L   R D +  ++E          
Sbjct: 110 QEYIDLQLSFQQGLNRKHIMAGVANSVERLGTYIDILQIHRLDKEASMEE------IMRS 163

Query: 153 MQELPATGKTNALGVANFSVSQLKKL-IDSPGN---KIVPAASQLETHPFLPQNKMLSFC 208
           + ++  +G+   +G ++   ++  +L   +  N   + +   S         +N+++ FC
Sbjct: 164 LNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYYNVLNREDENELIPFC 223

Query: 209 KKNNILMEAYSP---------LGSEGAPLLDEP-------------------VVREISKK 240
           KK+ + +  +SP             G  +L +P                   VV  I+KK
Sbjct: 224 KKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDESDKEIIGVVEAIAKK 283

Query: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
             +  A + ++W L +G   +    +  R++  +   D+
Sbjct: 284 KGISMAMVSMAWILNKGANAIAGLNSIERVDEAIRAIDV 322

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 86/213 (40%), Gaps = 54/213 (25%)

Query: 58  NEQVVGRAIRD--SGVPREELFVTTKL-------WCTQHRDPKTALSQSLKRLGLDYVDL 108
           +E + G+A+++     PREE F+ TK+       +     + + ++ +S +RL  DY+DL
Sbjct: 67  SEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVRFSVKRSCERLHTDYLDL 126

Query: 109 YMMHWPVAFRSEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQE---LPATGKTNAL 165
             +H                          D+ E  +Y K WE ++E   L   G    +
Sbjct: 127 VYLH--------------------------DI-EYVEYDKIWEALRELRKLKDEGVIRHI 159

Query: 166 GVANFSVSQLKKLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEG 225
           G++ + V  L  L  S     VP           P + +LS+C   N+ +++   L  EG
Sbjct: 160 GISGYPVDLL--LYVSKTCCGVPEIG--------PLDAVLSYC---NLTLQSVV-LEKEG 205

Query: 226 APLLDEPVVREISKKLHVEPAQLLVSWGLQRGH 258
                E  ++ +S    V    LL S G  + H
Sbjct: 206 DRFFKESNIKVVSNG-SVVCMSLLRSKGTIKDH 237

>Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]
           {ON} complement(243219..244247) [1029 nt, 343 aa]
          Length = 342

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 86/202 (42%), Gaps = 24/202 (11%)

Query: 46  GYRHIDIAAVCMN---EQVVGRAIRDSGVPREELFVTTKL-WCTQHRDPKTALSQSLKRL 101
           G R  D A V  N   E ++G  ++   +PRE + + +KL + T  +     L +  + L
Sbjct: 53  GMRTFDTANVYSNGLSETLLGEFLKHYNIPRETVVIMSKLNFATDDKVSFETLKERSEEL 112

Query: 102 GLDYVDLYMMHWP--VAFRSEQVK----HTNYMLIPKRKDGQPDVDEGWDYVKTWELMQE 155
            L +V++  +     +A   E V+    + + + I +     P       Y +T   + +
Sbjct: 113 NLHFVNMSGLSRKNIMASAKESVRRLGTYIDVLQIHRADRDTP-------YEETMRALND 165

Query: 156 LPATGKTNALGVANFSVSQLKKLIDSPGN----KIVPAASQLETHPFLPQNKMLSFCKKN 211
           L  +G T  +G ++   ++  ++  +       K + + S         + +++ F K++
Sbjct: 166 LVESGITRYIGASSMLATEFAEMQFTAEKYGWFKFINSQSCYNLLYREDERELMPFAKRH 225

Query: 212 NILMEAYSPLGSEGAPLLDEPV 233
           NI +  +SPL      LL  PV
Sbjct: 226 NIALTPWSPLQR---GLLTRPV 244

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 22/124 (17%)

Query: 32  KENGYNATLAAIKAGYRHIDIAAVCMNEQV---VGRAIRDSGVPREELFVTTKL------ 82
           KE  +    A  +AG   +D A    NEQ    +G  ++   V R+++ + TK       
Sbjct: 52  KEQAFELLDAFYEAGGNCVDTANSYQNEQSETWIGEWMKLRKV-RDQIVICTKYTGDYKK 110

Query: 83  ----------WCTQHRDP-KTALSQSLKRLGLDYVDLYMMHWPVAFRS-EQVKHTNYMLI 130
                     +C  HR     ++  SL++L  D++D+  +HW     S E+V  + ++L+
Sbjct: 111 YEAGDGKSANYCGNHRRSLHVSVRDSLRKLQTDWIDILYIHWWDYMSSIEEVMDSLHILV 170

Query: 131 PKRK 134
            + K
Sbjct: 171 QQGK 174

>SAKL0H11770g Chr8 complement(1004615..1005880) [1266 bp, 421 aa]
           {ON} conserved hypothetical protein
          Length = 421

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 52/130 (40%), Gaps = 14/130 (10%)

Query: 9   TATAKLNTGAQIPLLGLGTWRSTKENGY----------NATLAAIKAGYRHIDIAAVCMN 58
           TAT+ +    +I    +G + ST  N            NA+L A+    +H     +  N
Sbjct: 275 TATSDVYWTGEILAKAMGDYVSTVSNNTAKYCSTQQEDNASLEAMVRAAKH---GIIDYN 331

Query: 59  EQVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFR 118
             V+ R+I D   P   L  T   + T       AL  +L   GL +V   + +W   ++
Sbjct: 332 RIVISRSISDFERPPTGLNATEFFFNTSQGGSAAAL-DNLYIAGLPFVQDVLANWDSLYK 390

Query: 119 SEQVKHTNYM 128
             +   TNY+
Sbjct: 391 DNKFAPTNYI 400

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 68/168 (40%), Gaps = 36/168 (21%)

Query: 64  RAIRDSGVPREELFVTTKLWCTQH----RDP-KTALSQSLKRLGLDYVDLYMMHWPVAFR 118
           ++I D G+  ++L + TK    +     RD    ++ QS   L +D V++Y +H P    
Sbjct: 48  KSIGDLGIA-DDLVIDTKARSFEEGALTRDGIFESIKQSFDELKVDSVEIYYLHAP---- 102

Query: 119 SEQVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178
                           D    ++E      T + + EL   GK    G++N++   +KK+
Sbjct: 103 ----------------DPITPIEE------TIDAINELYKQGKFKKFGLSNYTPDDVKKI 140

Query: 179 ID--SPGNKIVPAASQLETHPFLP--QNKMLSFCKKNNILMEAYSPLG 222
            +     N ++P   Q   + F    +  +    +K  I   AYSP+ 
Sbjct: 141 YEYAKSKNYVLPTVFQGNYNAFSRSIEKDLFPVLRKYGISFYAYSPIA 188

>NCAS0E01780 Chr5 (346617..350048) [3432 bp, 1143 aa] {ON} Anc_7.201
           YIL026C
          Length = 1143

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%)

Query: 227 PLLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRR 286
           P + E + RE  K+++     LLV+W LQ+ + ++  +   S +EA +HT       +  
Sbjct: 828 PFMFERLGRETIKEVNFNGLVLLVTWQLQKWNKIIETTPNDSIVEAPMHTIKSIAMIIET 887

Query: 287 INEL 290
           INE+
Sbjct: 888 INEV 891

>KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 28/46 (60%)

Query: 234 VREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
           V E++KK +V  A +  +W +Q+G A ++   + +R++ N+   D+
Sbjct: 277 VEEMAKKKNVSMAVIATAWVIQKGCAPILGMSSIARVDDNIKALDV 322

>TBLA0I01450 Chr9 (315841..317922) [2082 bp, 693 aa] {ON} Anc_2.529
           YKL029C
          Length = 693

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 11/74 (14%)

Query: 209 KKNNILMEAYSPLGSEGAPLLDEPVVREISK--------KLHVEPAQLLVSWGLQRGHAV 260
           KKNN+ M   +P+G +   L DEP +  ++K        +  +E  QLL S  L +G A 
Sbjct: 66  KKNNVEM---TPIGIKAQKLFDEPRISRVTKLQIKDMPIECPLESFQLLNSPFLNKGSAF 122

Query: 261 LVKSKTPSRIEANL 274
             + +    +EA L
Sbjct: 123 TFEERKAFNLEALL 136

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 55/124 (44%), Gaps = 22/124 (17%)

Query: 32  KENGYNATLAAIKAGYRHIDIAAVCMNEQV---VGRAIRDSGVPREELFVTTKL------ 82
           KE  +    A  +AG   ID A    NE+    +G  ++   + R+++ + TK       
Sbjct: 6   KEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGDYKK 64

Query: 83  ----------WCTQHRDP-KTALSQSLKRLGLDYVDLYMMHWPVAFRS-EQVKHTNYMLI 130
                     +C  H+     ++  SL++L  D++D+  +HW     S E+V  + ++L+
Sbjct: 65  YEVGGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHWWDYMSSIEEVMDSLHILV 124

Query: 131 PKRK 134
            + K
Sbjct: 125 QQGK 128

>TDEL0D05140 Chr4 complement(931425..932339) [915 bp, 304 aa] {ON}
           Anc_3.110 YBR151W
          Length = 304

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 13/70 (18%)

Query: 83  WCTQHRDPKTALSQSLKRLGLDYVDLYMMH-------------WPVAFRSEQVKHTNYML 129
           WC  H D   +L+ ++  L  D +D+ +M              W    +S++V  T   L
Sbjct: 103 WCENHSDEGKSLTCAVSSLAKDIMDIEVMRGTKNNVLVLPHFIWINDLKSDKVDETLSDL 162

Query: 130 IPKRKDGQPD 139
           +PK  D + D
Sbjct: 163 VPKLLDKKQD 172

>NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 45/107 (42%), Gaps = 28/107 (26%)

Query: 201 QNKMLSFCKKNNILMEAYSP---------LGSEGAPLLDEPV------------------ 233
           +  ++ +C+K+NI +  +SP         +G E      + +                  
Sbjct: 217 ERDLMQYCEKHNIALTPWSPNHQGLLTRPIGVESERSTTDKIINGWNMKDLKPSEIEIIN 276

Query: 234 -VREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDI 279
            V E+SKK +V  A +  +W L +G A +V   + SR++  +   D+
Sbjct: 277 RVEELSKKKNVSMAVISTAWVLSKGCAPIVGMSSISRVDEVITALDV 323

>TBLA0D01260 Chr4 (313649..316387) [2739 bp, 912 aa] {ON} Anc_8.702
           YPL176C
          Length = 912

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 57/139 (41%), Gaps = 20/139 (14%)

Query: 107 DLYMMHWPVAFRSEQVKHTNYMLIPKRKD-GQPDVDEGWDYVKTWELMQELPATGKT--- 162
           DL++   P+ FR  Q K TN M   KR + G+    +G  Y      + ++  TG T   
Sbjct: 595 DLHIETHPLLFRLFQGKQTNAMEKAKRNEHGKNSEVDGESYFHVQSELHDIYVTGVTSYG 654

Query: 163 -------NALGVANFSVSQLKKLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILM 215
                  N + V  FS  Q+K        K VP  + L+T  F     +L   +   I+ 
Sbjct: 655 DWTPFLANGIPVTIFSHPQIKA-------KDVPVDTSLDT--FEQLQAILQEKESREIVK 705

Query: 216 EAYSPLGSEGAPLLDEPVV 234
           +    +      L+DEP++
Sbjct: 706 DLVVYILETTLKLIDEPII 724

>TBLA0C02560 Chr3 (604893..612629) [7737 bp, 2578 aa] {ON} Anc_3.443
            YPR117W
          Length = 2578

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 48/111 (43%), Gaps = 7/111 (6%)

Query: 170  FSVSQLKKLIDSPGNKIVPAASQLETHPFL---PQNKMLSF---CKKNNILMEAYSPLGS 223
            FSVS   K++    +  VP+A   +    +   P ++   F      N IL ++  PL  
Sbjct: 1644 FSVSSFHKVLAQRLDLSVPSAPNFDRKSNILEGPNSEWYDFEDYVDLNQILPDSTVPLSL 1703

Query: 224  EGAPLLDEPVVREISKKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANL 274
            E  PLL  P +    ++++ E   +   +G +  H+ L+    P R +  L
Sbjct: 1704 EAIPLLYSPRISYF-RQINDEGYNVKYPFGEEPSHSCLIDKNHPERTQERL 1753

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,554,716
Number of extensions: 1373638
Number of successful extensions: 3513
Number of sequences better than 10.0: 141
Number of HSP's gapped: 3242
Number of HSP's successfully gapped: 143
Length of query: 309
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 200
Effective length of database: 40,982,805
Effective search space: 8196561000
Effective search space used: 8196561000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)