Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F16038g5.435ON79279241660.0
Kwal_55.214225.435ON78280214800.0
SAKL0G02552g5.435ON8343416643e-74
ZYRO0F10054g5.435ON6606835358e-58
NDAI0B056805.435ON8567334252e-42
KLLA0E02201g5.435ON8353313272e-30
Ecym_47615.435ON7983353092e-28
AER402C5.435ON8693353084e-28
NCAS0F033905.435ON8612632942e-26
CAGL0A02838g5.435ON8282302889e-26
KAFR0E038305.435ON8452912763e-24
Smik_4.6355.435ON8632152746e-24
YDR369C (XRS2)5.435ON8542102649e-23
Suva_2.5415.435ON8692402522e-21
Skud_4.6385.435ON8432892424e-20
TBLA0A028205.435ON9253312164e-17
TDEL0E019005.435ON7622392075e-16
Kpol_1016.55.435ON8121511986e-15
KNAG0C049005.435ON7691101942e-14
TPHA0J025905.435ON7752071753e-12
KLTH0F03454gna 1ON34771780.97
Skud_13.1842.583ON520159743.4
TDEL0A017902.405ON675143717.9
KAFR0K004607.28ON769112718.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F16038g
         (792 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...  1609   0.0  
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   574   0.0  
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   260   3e-74
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   210   8e-58
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   168   2e-42
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...   130   2e-30
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...   123   2e-28
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...   123   4e-28
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   117   2e-26
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   115   9e-26
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   110   3e-24
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   110   6e-24
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   106   9e-23
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   101   2e-21
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...    98   4e-20
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...    88   4e-17
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...    84   5e-16
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....    81   6e-15
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...    79   2e-14
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...    72   3e-12
KLTH0F03454g Chr6 (301123..302166) [1044 bp, 347 aa] {ON} conser...    35   0.97 
Skud_13.184 Chr13 complement(315391..316953) [1563 bp, 520 aa] {...    33   3.4  
TDEL0A01790 Chr1 (321579..323606) [2028 bp, 675 aa] {ON} Anc_2.4...    32   7.9  
KAFR0K00460 Chr11 complement(94825..97134) [2310 bp, 769 aa] {ON...    32   8.2  

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score = 1609 bits (4166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 780/792 (98%), Positives = 780/792 (98%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60
           MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60

Query: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLAIT 120
           LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLAIT
Sbjct: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLAIT 120

Query: 121 ESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFVSQF 180
           ESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFVSQF
Sbjct: 121 ESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFVSQF 180

Query: 181 ADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGNLWL 240
           ADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGNLWL
Sbjct: 181 ADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGNLWL 240

Query: 241 CGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLKNKARSLGFKT 300
           CGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLKNKARSLGFKT
Sbjct: 241 CGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLKNKARSLGFKT 300

Query: 301 RDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIAGSQVLADIVADAPNLRNKRKRA 360
           RDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIAGSQVLADIVADAPNLRNKRKRA
Sbjct: 301 RDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIAGSQVLADIVADAPNLRNKRKRA 360

Query: 361 NRQIQPLNXXXXXXXXXXXXQKLEQVSTPAKEQNLELQEGLGVHTNPEVHPLSKKPREEK 420
           NRQIQPLN            QKLEQVSTPAKEQNLELQEGLGVHTNPEVHPLSKKPREEK
Sbjct: 361 NRQIQPLNSLAFFGGGSSLSQKLEQVSTPAKEQNLELQEGLGVHTNPEVHPLSKKPREEK 420

Query: 421 NTLHSAGNNSTTTFSETPIHQEDVQIGSEPLNHSAAHSVISKEDESTHTDERNKTLVNSA 480
           NTLHSAGNNSTTTFSETPIHQEDVQIGSEPLNHSAAHSVISKEDESTHTDERNKTLVNSA
Sbjct: 421 NTLHSAGNNSTTTFSETPIHQEDVQIGSEPLNHSAAHSVISKEDESTHTDERNKTLVNSA 480

Query: 481 KDARTVTFPSIHKNELKSSRTLSNEAKVEGNISHADTEVQAIKRPRSLIQAFQEAKQHEV 540
           KDARTVTFPSIHKNELKSSRTLSNEAKVEGNISHADTEVQAIKRPRSLIQAFQEAKQHEV
Sbjct: 481 KDARTVTFPSIHKNELKSSRTLSNEAKVEGNISHADTEVQAIKRPRSLIQAFQEAKQHEV 540

Query: 541 HRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENSNQRILTNPQWARRKN 600
           HRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENSNQRILTNPQWARRKN
Sbjct: 541 HRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENSNQRILTNPQWARRKN 600

Query: 601 FKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYDGTRNNSADDGFGDACQQH 660
           FKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYDGTRNNSADDGFGDACQQH
Sbjct: 601 FKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYDGTRNNSADDGFGDACQQH 660

Query: 661 AAAEQSNLTASPGNLALLGVEVENGPAFAFQSQRAANSQANSLFNETDNRRVEERSPERN 720
           AAAEQSNLTASPGNLALLGVEVENGPAFAFQSQRAANSQANSLFNETDNRRVEERSPERN
Sbjct: 661 AAAEQSNLTASPGNLALLGVEVENGPAFAFQSQRAANSQANSLFNETDNRRVEERSPERN 720

Query: 721 QELFVVDEDDSQPQVACYSNNVSQVPSRLEDADQSLQPDERRVPRVASLRNTVQHESDDS 780
           QELFVVDEDDSQPQVACYSNNVSQVPSRLEDADQSLQPDERRVPRVASLRNTVQHESDDS
Sbjct: 721 QELFVVDEDDSQPQVACYSNNVSQVPSRLEDADQSLQPDERRVPRVASLRNTVQHESDDS 780

Query: 781 DDEPQFRFQSRR 792
           DDEPQFRFQSRR
Sbjct: 781 DDEPQFRFQSRR 792

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/802 (42%), Positives = 478/802 (59%), Gaps = 31/802 (3%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60
           MWILRYQY+   G ++ VSCCLK+G QY +GRS K+PLQIK DKSISR HV+LEV Q+  
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60

Query: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLAIT 120
           + +   GKLTK+ G +VK  Q L+F AD+ V  EMGA P+K TV  + + WKIPHDL+++
Sbjct: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS 120

Query: 121 ESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFVSQF 180
           +SL  HL+ +DIQVTNSL+S TS+QIIK+  KS  NCLF+L+K IPI+ E FIGDFV+Q 
Sbjct: 121 QSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFVTQI 180

Query: 181 ADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGNLWL 240
            D   DFD++W+++ ++NA F   + +   F  ++F+VTN++ FAI+K IIDAGSG LWL
Sbjct: 181 NDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSGTLWL 240

Query: 241 CGDVSNLGTFIEKQIKSENVVILIHLIE-EAPALASEQNNSMHIQEAKLLKNKARSLGFK 299
           C D+SNL  FI+ +I S+NV++L+HL   ++   ++EQ++ + +QEAKLLKNKA++LGF+
Sbjct: 241 CDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKNKAQNLGFR 300

Query: 300 TRDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIAGSQVLADI-VADAPNLRNKRK 358
             DVNDIV AVL ++   LL+RVP      +   G  +  +   + I  AD P   NKRK
Sbjct: 301 IHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNKSVIKSADTPKPSNKRK 360

Query: 359 RANRQIQPLNXXXXXXXXXXXXQKLEQVSTPAKEQNLELQEGLGVHTNPEVHPLSKKPRE 418
           R NRQ+ PL+             K      P  E+  E  +      N        +P  
Sbjct: 361 RTNRQVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQ------NTTTEFAEGEPSP 414

Query: 419 EKNTLHSAGNNSTTTFSETPIHQEDVQIGSEPLNHSAAHSVI-----SKEDESTHTDERN 473
           +K  + +         SE  + +  VQ  S+  +  +A + I      K    T      
Sbjct: 415 KKARIGALRKPDIPNVSEERVKEPVVQTRSKRASERSADTSILVQANPKRSRKTLQASEG 474

Query: 474 KTLVNSAKDARTVTFPSIHKNELKSSRTLSNEAKVEGNISHADTEVQAIKRPRSLIQAFQ 533
            T++ +  ++  +    + K +   S +L NEA      +    E    KRP S  QA +
Sbjct: 475 HTILENDNNSLNIESGPLPKTK---STSLGNEAAQAQADAVQTREA---KRPVSFAQAVK 528

Query: 534 EAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENSNQRILTNP 593
           E K HEV RL+K++ +V SEELTEEAINKLD LA VE  DLMR   E           + 
Sbjct: 529 ETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVETKDLMRADREYAVCGQSG--GSE 586

Query: 594 QWARRKNFKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYDGTRNNSADDGF 653
           QWA RKNFKKFVKLWPS SSR+SPD+ T+A+RN+A+LITR+YV L PY+G   N+ DD F
Sbjct: 587 QWAGRKNFKKFVKLWPSRSSRNSPDSATNALRNRAHLITREYVPLRPYEGQNANNQDDSF 646

Query: 654 GDACQQHAAAEQSNLTASP-GNLALLGVEVENGPAFAFQSQRAANSQA-NSLFNETDNRR 711
               Q     E +  +  P  +  +LGVEV++ PAF F+SQ+  ++   +    + +   
Sbjct: 647 LKNSQDDLQEEATCPSIPPVSSTTILGVEVDDEPAFLFRSQQEDDAYGPDGGLGQRNQHT 706

Query: 712 VEERSPERNQELFVVDEDDSQ-PQVACYSNNVSQVPSRLEDADQSLQPDERRVPRVASLR 770
             ++   R+QELFV DE+DSQ   V  Y++ V    SR     +  QP+    P +++ +
Sbjct: 707 SVDKDSNRDQELFVFDEEDSQRDHVDTYTDAVQ---SRSASGARYQQPE----PSISASK 759

Query: 771 NTVQHESDDSDDEPQFRFQSRR 792
           N    +SD+SDDEP+F+FQSR+
Sbjct: 760 NCAPQDSDESDDEPRFQFQSRK 781

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  260 bits (664), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 135/341 (39%), Positives = 208/341 (60%), Gaps = 13/341 (3%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60
           MWILRY+Y  E G+   +SCCLK+G  Y +GRS KSPL IK DKSISRKH+QL+V + ++
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVNKENE 60

Query: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLAIT 120
           L +LN GKLT +  + + +DQ L F     + LE+G  P+  T+ ++  +WK+ HDL   
Sbjct: 61  LNLLNTGKLTTLNAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN 120

Query: 121 ESLKNH-LSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFVSQ 179
              K    + Y I VT +++++T++QIIK++Q ++ NCLF+LVK I I+ E F+ DF S 
Sbjct: 121 SMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQSH 180

Query: 180 FADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGNLW 239
              T  D+D  W+ +  K+  F    T  + F+ ++ +V ++  + ++K  I+   G L 
Sbjct: 181 LYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAGGELL 240

Query: 240 LCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQE--AKL--LKNKARS 295
            C ++     FI++   S++V+IL H+ E    L +++N+++ + E   KL  LK  A S
Sbjct: 241 YCENMEKFEQFIQEAAHSKDVIILKHITE--ANLTNDKNSNIDMSEDARKLEELKAAAES 298

Query: 296 LGFKTRDVNDIVDAVLKNDILSLLDRVP------QEKALEE 330
           LG+K  DVND+VDAVLK D   LL+++P       EK LEE
Sbjct: 299 LGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEE 339

 Score =  124 bits (312), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 107/306 (34%), Positives = 150/306 (49%), Gaps = 35/306 (11%)

Query: 501 TLSNEAKVEGN--ISHADTEVQAIKRPRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEE 558
           TLSNE ++  N  ++H      +     +L++A Q+ K  EV RLK  +  +   ELTE 
Sbjct: 550 TLSNETRIPPNTLLTHEGVHNHST----ALVEAIQDTKSREVSRLKNTLIQIDKNELTEN 605

Query: 559 AINKLDNLASVEKVDLMRRPSEVPEN-SNQRILTNPQWARRKNFKKFVKLWPSHSSRSSP 617
           AIN L NLA VEK DL+R+ SE     S+   L    W  RKNFKKF+K+ P  S R + 
Sbjct: 606 AINSLSNLAIVEKKDLIRKNSERGHCISSDTCL----WEGRKNFKKFIKVQPRRSQRETF 661

Query: 618 D-NITDAVRNKAYLITRDYVSLCPYDGTRNNSADDGFGDACQQHAAAEQSNLTASPGNLA 676
           D +  + V+N A+LITR+YV L  +D       DD F      H+A E   + A P  + 
Sbjct: 662 DSDGKNIVKNSAFLITREYVPLKKFDPNEKEQIDDTF---FLNHSANEGP-IPAQPRRID 717

Query: 677 LLG--VEVENGPAFAFQSQRAANSQANSLFNET-DNRRVEERSPERNQ-ELFVVDEDDSQ 732
                 + E GP F F+  ++ +   +     T  N  +E +   R++  LFV DEDD Q
Sbjct: 718 ETSNFTDDEEGPVFNFKRTKSKDPSISPRKEHTLTNGDIEMKETSRSENRLFVTDEDDFQ 777

Query: 733 P------QVACYSNNVSQVPSRLEDADQSLQPDERRVPRVASLRNTVQHESDDSDDEPQF 786
                   +     ++S  P R+ D   S   +  R+PR           SDD DDEP+F
Sbjct: 778 SLNITDNSIEAPERSISN-PLRVNDKPSS-GGNTSRLPRFT-------EASDDDDDEPRF 828

Query: 787 RFQSRR 792
           RF SRR
Sbjct: 829 RFSSRR 834

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  210 bits (535), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 190/683 (27%), Positives = 309/683 (45%), Gaps = 88/683 (12%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVR-QNS 59
           MWILRYQY  E G+   VSCCL+ G  Y +GRS K+ L IK DKSISR+HV +    ++ 
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60

Query: 60  KLEVLNAGKLTKIGGDNVKMDQMLEFGADQ-SVALEMGAGPVKGTVTYEPAIWKIPHDLA 118
           +L+++N GK+T +    +KM + + FG    +V +E+G  P+K  + +  +IW +P    
Sbjct: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQG-- 118

Query: 119 ITESLKNHLSLYD--IQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDF 176
              S  +H +L +  I+V +S  S+ ++ +I E Q+++   L+ LVK+IP+M   F+   
Sbjct: 119 ---SRSDHSALEELGIEVLSSELSRANLIVIDE-QQNYSRWLYGLVKRIPLMNLEFLNVV 174

Query: 177 VSQFADTQIDFDAKWEQITLKNA-PFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGS 235
             + +  + +FD+ W +I    +  +   + +    + L F+   +         I+A  
Sbjct: 175 SQKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSL--AIEAAG 232

Query: 236 GNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLKNKARS 295
           G       V  L   ++++    NVVIL   +  A  LA                     
Sbjct: 233 GKYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAEELA--------------------P 272

Query: 296 LGFKTRDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIAGSQVLADIVADAPNLRN 355
           LG KT  V D+V+A+LK+++ SL           +N   G +A  +  A++  + P    
Sbjct: 273 LG-KTFTVQDVVEAILKDEVNSL-----------KNGVIGEVA-KRPEAEVPMEKP--VT 317

Query: 356 KRKRANR-QIQPLNXXXXXXXXXXXXQKLEQVSTPAKEQNLELQEGLGVHTNPEVHPLSK 414
           K++R NR +++PL+            +   + +     Q  E                SK
Sbjct: 318 KKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEE----------------SK 361

Query: 415 KPREEKNTLHSAGNNSTTTFSETPIHQEDVQIGSEPLNHSAAHSVISKEDESTHTDERNK 474
            PR+ ++    +  +      E P          +  N  +      K  E +  DE  K
Sbjct: 362 DPRKLEDPKEESKESKEVLQPEVP----------KEFNEYSKEEPGQKSYEESKADENEK 411

Query: 475 TLVNSAKDARTVTFPSIHKNELKSSRTLSNEAKVEGNISHADTEVQAIKRPRSLIQAFQE 534
           +L  + +    VT P        S+    N A+     + +D           +IQ  Q+
Sbjct: 412 SLEETVEPTLQVTEPPP-----TSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQD 466

Query: 535 AKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKVD-LMRRPSEVPENSNQRILTNP 593
            K HEV RL   +  VG EELTE+AIN+L NL  V++ D LMRR    P   +     NP
Sbjct: 467 TKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVDRNDNLMRRRDRSPTVDSH----NP 522

Query: 594 QWARRKNFKKFVKLWPSHSSR--SSPDNITDAVRNKAYLITRDYVSLCPY-DGTRNNSAD 650
            W  RKNFK FVK+WP +  +  +S +  +D +RN+A+L+TR YV    Y  G  +  A 
Sbjct: 523 NWNNRKNFKNFVKVWPKYGGQDSTSREGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQ 582

Query: 651 DGFGDACQQHAAAEQSNLTASPG 673
           +   D  +    A+      +PG
Sbjct: 583 EDLYDFPEPQPEAQSVPQVEAPG 605

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  168 bits (425), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 186/733 (25%), Positives = 322/733 (43%), Gaps = 125/733 (17%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60
           MWILRYQY  E G   +VS CL++   Y +GRS K+PL IK DKSISR+H+ ++   + +
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60

Query: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALE--MGAGPVKGTVTYEPAIWKIPHDLA 118
           L ++N GKLT +    + +D+ L F    +  L+  +G  PV   + ++P    IP+   
Sbjct: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPN--- 117

Query: 119 ITESLKNHLSLYDIQVTNSLTSKTS-VQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFV 177
           + E  +  L+ Y I+VT+ +  + S +  +      +   L AL   IP+    ++ +  
Sbjct: 118 MYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVS 177

Query: 178 SQFADTQIDFDAKWEQI----TLKNAPFLELQTKDA-AFKGLNFVVT---------NQKT 223
           +      I FD   ++I    +LK  P   L       F+   F++T           K+
Sbjct: 178 NMLRPDNITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLNKSSVSEHADKS 237

Query: 224 FAIYKSIIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHI 283
           F + KS+   G G   +  D + L   + K + +    I+I        +  E N    I
Sbjct: 238 FILRKSLQLIG-GEEEIIKDPTELQNSVTKILSTSGKNIVI--------VTDEDNGKRMI 288

Query: 284 QEAKLLKNKARSLGFKTRDVNDIVDAVLKNDILSLLDRV-------PQEKALEENSA-GG 335
                       + F+ R+V DI D+ +KND   L   +       P+   + EN     
Sbjct: 289 ------------MNFECRNVKDIFDSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMV 336

Query: 336 SIAGSQVLADIVADAPNLRN---------------KRKRANRQIQPLNXXXXXXXXXXXX 380
            I    + A I  ++ + +N               KR+ A ++++PL             
Sbjct: 337 EIQEPPIEAAITEESTSSKNLKHTPPEPVTTHIVKKRRLARKRVKPLESLDFFVGGSTTG 396

Query: 381 QKLEQVSTPAKEQNLELQEGLGVHTNPEVHPL----------SKKPREEKNTLHSAGNN- 429
              E  ST  +++ +E +        P+V P+          +K   E    ++S G + 
Sbjct: 397 TPFETSSTTLQQEIIEPKV-------PDVAPILNEQIQQSQVNKSINEPAKDIYSIGGSD 449

Query: 430 ----STTTFSETPIHQEDV--QIGSEPLNH--SAAHSVISKEDESTHTDERNKTLVNSAK 481
               +  T++    H ++   QI   P  H   + H   +++++ +++ E++  +     
Sbjct: 450 RKETAALTYATIDKHMQEPTQQIDDIPSQHIDISPHGNSNEQEKRSNSSEKSPMITQQVN 509

Query: 482 DARTVTFPSIHKNELKSSRTLSNEAKVEGNISHADTEVQAIKRPRSLIQAFQEAKQHEVH 541
           D          K+E  S+       K E +  +++T       P+S+++  Q+ K  EV 
Sbjct: 510 D---------EKDEKISNAKALKIGKREDSKRYSET------TPKSMVETIQDIKNREVT 554

Query: 542 RLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENSNQRI-----------L 590
           RL+ ++A V +EELTE+AIN+  NLA VE    + R +E  +N+N+             +
Sbjct: 555 RLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNKSTNSVVRHDSPDNI 614

Query: 591 TNPQWARRKNFKKFVKLWPSH------SSRSSPDN-ITDAVRNKAYLITRDYVSLCPYDG 643
            N    RR NFK+FVK++P +      S+    DN  +D +RN A+LITR+YV L  Y  
Sbjct: 615 MNVLEGRR-NFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFLITRNYVPLKQYSK 673

Query: 644 TRN-NSADDGFGD 655
             + +   +GF D
Sbjct: 674 YDDSHGGKNGFND 686

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 92/331 (27%), Positives = 161/331 (48%), Gaps = 28/331 (8%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60
           MWI+ + + DE     +V   L+ G +Y +GRS K   +I+ DKSISR H+ ++    S 
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKF-DGSD 59

Query: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLAIT 120
           L + N GKLTK   + + +D+ +    +Q+  + +G  P+   V Y    WKIPH L + 
Sbjct: 60  LIITNKGKLTKFNEEIIPLDETIVV-HNQNTVINIGGMPIDVNVRYFYEEWKIPHRLELN 118

Query: 121 ESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFI---GDFV 177
           E+ K+ +S + ++++ S + KT+ QI  +   S+  CLFAL+K +P++   F+   G  +
Sbjct: 119 ET-KSLVSDFGVKLSESFSKKTTTQICSD-SSSYSGCLFALLKGVPVVSIEFLNQMGKLL 176

Query: 178 SQFADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGN 237
            Q     +DF + ++ +  ++  F   +        +  +V  QK +   +  I+ G G+
Sbjct: 177 QQ--GNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGD 234

Query: 238 LWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLKNKARSL- 296
             L  + S L  F+             H  E A  L S  +  M+ +  KLL+   +S+ 
Sbjct: 235 AKLLANSSELDKFLSTN----------H--EPAVVLGSSISQKMNSESTKLLEEFDKSIA 282

Query: 297 ------GFKTRDVNDIVDAVLKNDILSLLDR 321
                 G K  ++N  V+ +L+N I  L  R
Sbjct: 283 ETSLRHGVKLLNINQFVNILLENKINGLKKR 313

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 73/132 (55%), Gaps = 10/132 (7%)

Query: 512 ISHADTEVQAIKRPRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEK 571
           ++  +T++Q ++   ++I A  E KQ EV RL++ + +V   ELTE A+    + A +  
Sbjct: 579 VARLETDLQ-VRSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINT 637

Query: 572 VDLMRRP-SEVPENSNQRILTNPQWARRKNFKKFVKLWPSHSSRSSPDNITDAVRNKAYL 630
           + +  R  + +P ++      N +W  RKNFKKF K WPS+  R++    +D   N+   
Sbjct: 638 IQIKPRVLASIPISNG-----NTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQ--- 689

Query: 631 ITRDYVSLCPYD 642
           I R+Y+++  YD
Sbjct: 690 IGREYITMRKYD 701

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score =  123 bits (309), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 96/335 (28%), Positives = 167/335 (49%), Gaps = 15/335 (4%)

Query: 1   MWILRYQYIDETGSEI--RVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQN 58
           MWI + QY ++   +    +S  +K    Y+VGR+ KS L I  ++ +SR H+QL+  +N
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59

Query: 59  SKLEVLNAGKLTKIGGDNVKMDQMLEFGADQS-VALEMGAGPVKGTVTYEPAIWKIPHDL 117
             +E+   G   KIG   ++     EF   QS + LE+G+  ++  + +    +K+P DL
Sbjct: 60  I-IEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDL 118

Query: 118 AITE-SLKNHLSLYDIQVTNSLTSKTSVQIIK--EHQKSHGNCLFALVKKIPIMCEGFIG 174
            I   +L        I++  SL+ +TS QI++  + QK +   LFALVK +P++  GF+ 
Sbjct: 119 EINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLK 178

Query: 175 DFVSQFADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAG 234
              S      + F++K +++  + + F E        KGL F+V  +  F I K  I+ G
Sbjct: 179 GISSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVG 238

Query: 235 SGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLKNKAR 294
            G ++ C    +    +   I S  V+++      +PA+ +++    +I     L  KA 
Sbjct: 239 GGTVYNCITFEDF-VKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNI-----LLEKAH 292

Query: 295 SLGFKTRDVNDIVDAVLKNDI-LSLLDRVPQEKAL 328
           S+GFK  D  ++  AVL N+   +L+D    +K L
Sbjct: 293 SIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRL 327

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 127/274 (46%), Gaps = 24/274 (8%)

Query: 502 LSNEAKVEGNISHADTEVQAIKRPRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAIN 561
           +SNE K   N    D+ + + +   S++ A +E K+ EV R+K  + ++G +ELTEEAI 
Sbjct: 501 MSNEQKYHLNAESKDSTL-STQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAIC 559

Query: 562 KLDNLASVEKVDLMRRPSEVPENSNQRILTNPQWARRKNFKKFVKLWPSHSSRSSPDNIT 621
           KL  LA VE VD++R+     ++ + +  TN +   R+NFK+FVK+WP++ +++   +  
Sbjct: 560 KLSTLAVVESVDMLRK----TQSRHMKTETNKRHHVRRNFKRFVKVWPAYLNKAICQDPM 615

Query: 622 DAVRNKAYLITRDYVSLCPYDGTRNNSADDGFGDACQQHAAAEQSN------LTASP--G 673
            A R       R  V L  Y+    N   D   D      ++E+ N       T+ P   
Sbjct: 616 GAQRYS----NRQCVPLKVYEPMNKNELTD---DQLVDENSSEEKNDIMNETFTSDPLDH 668

Query: 674 NLALLGVEVENGPAFAFQS---QRAANSQANSLFNETDNRRVEER-SPERNQELFVVDED 729
           N+ +    +       +QS   Q  +N +    F+   N    E  +      LFVV+++
Sbjct: 669 NIQMASKSIPRHHDSIYQSKYEQVLSNPELEFSFSTIRNSNSSESVTNNPGNSLFVVEDE 728

Query: 730 DSQPQVACYSNNVSQVPSRLEDADQSLQPDERRV 763
                   Y N  +   +R E +D S+Q    R+
Sbjct: 729 SDDNTAVTYHNLSATSATRTEGSDVSIQARTSRI 762

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score =  123 bits (308), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 94/335 (28%), Positives = 162/335 (48%), Gaps = 29/335 (8%)

Query: 1   MWILR--YQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQN 58
           MW+ +  YQ   + G+   +SC L    +++VGR+ KS L I+ +K +SR H++LEV  +
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEV-ID 58

Query: 59  SKLEVLNAGKLTKIGGDNVKMDQMLEFGADQS-VALEMGAGPVKGTVTYEPAIWKIPH-- 115
             + +L  G   K+GG++     +L FG  QS V LE+G+  V+  + +    +K+P+  
Sbjct: 59  DHVNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTL 118

Query: 116 ---DLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQ--KSHGNCLFALVKKIPIMCE 170
              D A+ E +K       I+V  S +  T+  II+ H+  + +   LFALVK IPI+  
Sbjct: 119 LQEDPALLEVIKG----LGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHL 174

Query: 171 GFIGDFVSQFADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSI 230
            F+  F +       DFD +   I  ++  F     K A   GL+F+V  +  F + K  
Sbjct: 175 EFLKQFTALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYT 234

Query: 231 IDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLK 290
           ++ G G +  C D+++L   + K I           I  A AL  +   S  +++    +
Sbjct: 235 LEIGGGTVHFCHDINDLSACL-KTIP----------INGALALKYDHGISAEVKKVDDTR 283

Query: 291 --NKARSLGFKTRDVNDIVDAVLKNDILSLLDRVP 323
                 S G +   V+++  A+L + +  LL + P
Sbjct: 284 YCEVLHSHGIQLFTVHELTKAILYDKLAQLLSKRP 318

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 135/299 (45%), Gaps = 58/299 (19%)

Query: 526 RSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENS 585
           ++++ A ++ K+ EV+R++  + ++G EELTE+AI +L +LA V+ VD++R+     +++
Sbjct: 597 QNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQ-----QHT 651

Query: 586 NQRILTNPQWARRKNFKKFVKLWPSHSSR-SSPDNITDAVRNKAYLITRDYVSLCPY--- 641
              + ++P    RKN+K F K+WP + +R +SP+      RN   +  R Y+ L  Y   
Sbjct: 652 VDTVGSSPLTFARKNYKNFKKVWPKYMNRKNSPE-----TRNATAISNRKYLPLELYETD 706

Query: 642 --------DGT----RNNSADDGFGDACQQHAAAEQSNLTASPGNL----ALLGVEVENG 685
                   DG     ++N +            A+ +     +PG+L    ALLG +    
Sbjct: 707 LQSRTLFEDGAPPRQKDNISRSTSTSGLSNDLASNRGKDHPAPGSLFSNHALLGND---- 762

Query: 686 PAFAFQSQRAANSQANSLFNETDNRRVEERSP--------ERNQELFVVDEDDSQPQVAC 737
                      N+    +FN +   R +  SP          +  LFVVD D+++     
Sbjct: 763 -----------NAGPEPIFNFSSRSREDTNSPTASPAPNLTHDNTLFVVD-DENEDGDGM 810

Query: 738 YSNNVSQVPSRLEDA-DQSLQPD---ERRVPRVASLRNTVQHESDDSDDEPQFRFQSRR 792
              +++Q  SR   A  +  +PD    R   R  + R +      D D EP F F+  R
Sbjct: 811 ADTSIAQRVSRERHATTKPAEPDTAEPRHTRRKHAPRPSAAAADSDEDGEPTFAFKRAR 869

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 131/263 (49%), Gaps = 25/263 (9%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60
           MW+LRYQY  E GS  ++S C++K   Y +GRS K+ L IK DKSISR+H+ L+    + 
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60

Query: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLA-I 119
           + ++N GKLT IG   + + Q L FG   S+++++G  PV   + +  + W IP+ L   
Sbjct: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLTQF 120

Query: 120 TESLKNHLSLYDIQVTNSLT--SKTSVQIIKEHQKSHGNC-LFALVKKIPIMCEGFIGDF 176
            E+LK+    + + V   +    KT + +I +     G   L+  +K IP+    F    
Sbjct: 121 HETLKD----FGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTA 176

Query: 177 VSQFADTQIDFDAKWEQI-----TLKNAPFLELQTKDAAFKGLNFVV-------TNQKTF 224
               +    DFD  W ++     TL  + ++ L+ +   F+  N+V+       TN+   
Sbjct: 177 CEILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFE--NYVILILFDNETNKDAV 234

Query: 225 AIYKSIIDAGSGNLWLCGDVSNL 247
              K+ ++ G     +  D S+L
Sbjct: 235 KTLKTALNLGGA---IVNDFSDL 254

 Score =  116 bits (291), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 141/272 (51%), Gaps = 28/272 (10%)

Query: 503 SNEAKVEGNISHADTEVQAIKRPRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINK 562
           S +A V  +    + +  +++ P+S +QA QE K  EV RLK  M ++ ++ELTE AIN+
Sbjct: 516 STQALVSNHKEKKNLKSNSLEEPKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQ 575

Query: 563 LDNLASVE-KVDLMRRPSE-------VPENSNQRILTNPQWARRKNFKKFVKLWPSHSSR 614
           L +L  VE    L+R+ +          E+S++   T  +W+RRKNFKKFVK++P +  +
Sbjct: 576 LGSLVIVEPNQSLIRKKASRCECRTPTGEDSDK---TAREWSRRKNFKKFVKIYPKYMKK 632

Query: 615 SSPDNITDAVRNKAYLITRDYVSLCPYDGTRNNSADDGFGDACQQHAAAEQSNLTASPGN 674
            +  + TD +RN A+LITR+YV +  + G  NN  +D   +   +H   E+ N+    G+
Sbjct: 633 DTESDTTDLIRNNAFLITRNYVPMKKFTGQYNNVPND--DEDMYEHHDYERENIENGDGD 690

Query: 675 LALLGVEVENGPAFAF---------QSQRAANSQANSLFNETDN---RR--VEERSPERN 720
           LA+  V  +  P+            QS R  ++Q +   +E  +   RR     +    N
Sbjct: 691 LAIPPVVNDFIPSSQLSQRRLQIDSQSARIKDTQPDFSDDEGQSFSFRRSMANAKKTTAN 750

Query: 721 QELFVVDEDD-SQPQVACYSNNVSQVPSRLED 751
             LFVVDEDD     +  +  NV  V  RL++
Sbjct: 751 NGLFVVDEDDLDSINIPNHQENVDSVAVRLDE 782

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  115 bits (288), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 121/230 (52%), Gaps = 10/230 (4%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60
           MW+LRY Y++ETG   +VSCC+++  QY +GRS K+ L IK DKSISR+HV L+   +  
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 61  -LEVLNAGKLTKIGGDNVKMDQMLEFGADQS-VALEMGAGPVKGTVTYEPAIWKIPHDLA 118
            +E+ N GKLTK     +  ++++ + AD++ + + +G  PVK  ++    ++ IP+ L+
Sbjct: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120

Query: 119 ITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFVS 178
                   L +  I V N+  + TS+  + +        LFA    I I   G + +  +
Sbjct: 121 QFRETLETLGI-QISVDNANVNSTSLITVGDFGYRE---LFAACNDINIYSSGLLTEICN 176

Query: 179 QFADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYK 228
           +  +   +FDA+W  +       L+L+   + F G    +  +  F +YK
Sbjct: 177 KLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGG----IRGKFFFLLYK 222

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 85/291 (29%), Positives = 141/291 (48%), Gaps = 23/291 (7%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60
           MWILRY+   E G+  +VSCCL+K   Y +GRS K+PL IK DKSISR+H+ +    N++
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 61  -----LEVLNAGKLTKIGGDNVKMDQMLEFGAD--QSVALEMGAGPVKGTVTYEPAIWKI 113
                L V+N GKLT I  + +K D+   F  +   +V +++G  PV   +++ P  W +
Sbjct: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFWDL 120

Query: 114 PHDLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFI 173
             D    E   N + +   Q+ +S     S+ +I + + +    +FAL+K+   + +  +
Sbjct: 121 SKDFLQFEKSINSMGIC-TQMQSSNVRDISL-VINDEKSNWSRIMFALLKQNCTLVKPVL 178

Query: 174 GDFVSQ--FADTQIDFDAKWEQI--TLKN---APFLELQTKDA--AFKGLNFVVT---NQ 221
              V     AD Q +FD  W Q+  +  N    P   ++  D   AF+ + F      + 
Sbjct: 179 LSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSISH 238

Query: 222 KTFAIYKSIIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPA 272
                 K+ +    GN        +L T+I  +  + N++  I L +E PA
Sbjct: 239 DDLLYLKATVSELQGNFKSFDTADDLVTYI--KTVNHNLLKCIALKQEDPA 287

 Score = 99.8 bits (247), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 73/131 (55%), Gaps = 10/131 (7%)

Query: 523 KRPRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVP 582
           K P + I+A Q  K  EV R++  + DV   EL+EEAINKL NL  VE    + R     
Sbjct: 577 KSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRERRAD 636

Query: 583 ENSNQRILTNPQWARRKNFKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYD 642
           +N +     N  W  R+NFKKF K+WP H       +  D++RN A+LI R+YV L PYD
Sbjct: 637 KNDS----VNDMWKGRRNFKKFNKVWPQHR------DGYDSLRNNAFLIIRNYVELKPYD 686

Query: 643 GTRNNSADDGF 653
           G RN++    F
Sbjct: 687 GKRNDNDSSDF 697

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 106/215 (49%), Gaps = 29/215 (13%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNS- 59
           MW++RYQ I E G+   +SCCL+    Y +GRS K+PL IK DKSISR+H+ L+ + NS 
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 60  ------KLEVLNAGKLTKIGGDNVKMDQML---EFGADQSVALEMGAGPVKGTVTYEPAI 110
                  L ++N GKLT I    +K+ +       G   S  +E+GA P++  V ++  +
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 111 WKIPHDLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNC---LFALVKKIPI 167
           W IP  LA     +  LS + I    S+    +  +I ++  S  N    L AL + IP+
Sbjct: 121 WNIPSHLA---QFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPL 177

Query: 168 --------MCEGFIGDFVSQFADTQIDFDAKWEQI 194
                   +C   +   +     T + FD +W  I
Sbjct: 178 KKSQLLVKLCNTLLSASI-----TDLTFDERWNDI 207

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 73/131 (55%), Gaps = 16/131 (12%)

Query: 525 PRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVE-KVDLMRR------ 577
           P S +QA Q+ K+ EV R+K  + ++  +EL+EEAIN+L+ LA VE   DL+R+      
Sbjct: 552 PHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRL 611

Query: 578 ---PSEVPENSNQRILTNPQWARRKNFKKFVKLWPSHSS-RSSPDNIT---DAVRNKAYL 630
               S   +  N  I    +W RRKNFK FVK WP   + +    N T   D +R  A+L
Sbjct: 612 NTVSSSTEKGGNGVI--RQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFL 669

Query: 631 ITRDYVSLCPY 641
           ITR+YV L  Y
Sbjct: 670 ITRNYVPLKKY 680

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 102/210 (48%), Gaps = 19/210 (9%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQN-- 58
           MW++RYQ   E GS   +SCCL+    Y +GRS K+PL IK DKSISR+H+  +   N  
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 59  -----SKLEVLNAGKLTKIGGDNVKMDQMLEFGAD---QSVALEMGAGPVKGTVTYEPAI 110
                S L ++N GKLT +    +K+ +     A    +S  +E+G  P++    +   +
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 111 WKIPHDLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNC---LFALVKKIPI 167
           W IP  L      +  LS Y I    S+    +  +I ++ KS  N    L+ALV  IP+
Sbjct: 121 WNIPPHLT---QFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPM 177

Query: 168 MCEGFIGDFVSQF---ADTQIDFDAKWEQI 194
               F+ +  +     + T + FD  W  +
Sbjct: 178 KKSRFLMELCNTLLPTSKTNLKFDEMWNDM 207

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 115/240 (47%), Gaps = 26/240 (10%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQN-- 58
           MW++RYQ I E GS   +SCCL+    Y +GRS K+ L IK DKSISR+HV  +   N  
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 59  -----SKLEVLNAGKLTKIGGDNVKMDQMLEFGADQ---SVALEMGAGPVKGTVTYEPAI 110
                +KL ++N GKLT I    +K+ +       +      +E+G  P++    +   I
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 111 WKIPHDLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNC---LFALVKKIPI 167
           W IP +LA  +++   LS + I    S+   ++  +I +   ++ +    L+ALV  IP+
Sbjct: 121 WNIPSNLAQFQTI---LSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIPL 177

Query: 168 MCEGFIGDFVSQFADTQI---DFDAKWEQITLKNAPFLELQTKDAA-----FKGLNFVVT 219
                + D  +    + +    FD  W  +   N P  ++   D +     F  L+ V+T
Sbjct: 178 KKSQLLVDLCNSLLSSSVMNLKFDETWNNMV--NKPLFKVFDYDPSVLFSKFMRLDNVIT 235

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 75/129 (58%), Gaps = 12/129 (9%)

Query: 525 PRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKV-DLMRRPSEVPE 583
           P S ++A Q+ K  EV R+K  + ++  +EL+EEAIN+L+NLA VE   +L+R P  V  
Sbjct: 573 PHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGS 632

Query: 584 N-------SNQRILTNPQWARRKNFKKFVKLWPSHSSRSSPDNI----TDAVRNKAYLIT 632
           N        +++     +W +RKNFK F K+WP+  +    D      +D +R+ A+LIT
Sbjct: 633 NRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLIT 692

Query: 633 RDYVSLCPY 641
           R+YV L  Y
Sbjct: 693 RNYVPLKKY 701

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 88/289 (30%), Positives = 134/289 (46%), Gaps = 45/289 (15%)

Query: 525 PRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVE-KVDLMRRPSEVPE 583
           P S ++A QE K  EV R K  +  +  +EL+EE IN+L NLA VE   DL+R+P  +  
Sbjct: 548 PLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGT 607

Query: 584 NS-------NQRILTNPQWARRKNFKKFVKLWP-----SHSSRSSPDNITDAVRNKAYLI 631
           NS       N+  +   +W  RKNFK F+K+WP     +  ++    N +D +R+ A+LI
Sbjct: 608 NSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQN-SDFIRSAAFLI 666

Query: 632 TRDYVSLCPYDGTRNNSADDGFGDACQQH-AAAEQSNLTASPGNLALLGVEVENGPAFAF 690
           TR+YV L  Y  ++NN A +  G   +      E  NL ++       GV      A   
Sbjct: 667 TRNYVPLRKY--SKNNKATECNGKENEDMLGLIEMENLVSN------TGVSGNTSSAVIQ 718

Query: 691 QSQRAANSQANSLFNETDN-------RRVEERSPERNQELFVVDEDDSQPQV-----ACY 738
           Q  R  N+  N   ++  N       R  +   P +N+ LFV ++DD    V      C 
Sbjct: 719 QGPRTQNTFINEDISDEGNQQSFSFSRHSDIAQPAKNK-LFVTEDDDKNNMVNDSENGCE 777

Query: 739 SNNVSQVPSRLEDADQSLQPDERRVPRVASLRNTVQHES----DDSDDE 783
              + ++  R  + D+  + + R     A L     HES    D++DDE
Sbjct: 778 LITLKKIGLRPSNFDEPSKGNRRSRSTAAGL-----HESCEAFDENDDE 821

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 107/237 (45%), Gaps = 21/237 (8%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQN-- 58
           MW++RYQ   E G    +SCCL+    Y +GRS K+ L IK DKSISR+H+  +   N  
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 59  -----SKLEVLNAGKLTKIGGDNVKM-DQMLEFGADQS--VALEMGAGPVKGTVTYEPAI 110
                S L ++N GKLT I    +K+ ++ + +  + S    +E+G  P    V +   I
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 111 WKIPHDLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNC---LFALVKKIPI 167
           W IP  L      +  LS + I   +S+       +I +   S  N    L+ALV  IP+
Sbjct: 121 WNIPSHLT---EFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPL 177

Query: 168 MCEGFIGDFVSQFADTQI---DFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQ 221
                + D         +    FD  W+ +   N+P   +   DA+     F+  N+
Sbjct: 178 KKLRLLVDVCKTLLPASVRNLKFDEMWKDVL--NSPEFNVFNFDASVLSSKFMKLNR 232

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 85/331 (25%), Positives = 143/331 (43%), Gaps = 35/331 (10%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEV--RQN 58
           MWI+ Y Y     +   VSCCLK+   Y +GRS KSPL +K DKSISR+HV        N
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 59  SKLEVLNAGKLTKIGGDNVKMDQMLEFGAD--QSVALEMGAGPVKGTVTYEPAIWKIPHD 116
           ++L +LN GKLT++    +   + L F AD      +E+GA PV     +   ++ IP +
Sbjct: 61  NQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120

Query: 117 LAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKS-------HGNCLFALVKKIPIMC 169
               ES    L  Y   +        ++  + + +          G   ++LV K  I+ 
Sbjct: 121 FQQFES---QLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIILK 177

Query: 170 EGFIGDFVS----QFADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFA 225
             F+   ++          IDF    +   +++   + L++      G+  +V N  T  
Sbjct: 178 SSFLTSLLNLLNPNVTTFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTTD 237

Query: 226 IYKSIIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIE---EAPALASEQNNSMH 282
           +   I            +V NL T     I +E+  I I+ ++   E   +    +NS H
Sbjct: 238 LIYFI---------AAMEVINLPT-----ITTEDDTIFINTVKSHSEERLILLTTSNSRH 283

Query: 283 IQEAKLLKNKARSLGFKTRDVNDIVDAVLKN 313
           I+  K+   K    G K +++N ++  + K+
Sbjct: 284 IETIKVHTFKDFYQGIKNQNINHLIQVIKKD 314

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 143/334 (42%), Gaps = 65/334 (19%)

Query: 519 VQAIKR---PRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVE-KVDL 574
           V  +KR   P + I A Q+AK  E  RL      +  EELTEEAINK  NLA VE  VD+
Sbjct: 597 VSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDI 656

Query: 575 MRRPSEVPENSNQRILTNPQWARRKNFKKFVKLWPSHSSRSSP--DN-ITDAVRNKAYLI 631
           +   SE  +N+      +P+W  RKNFK FVK  P +  ++ P  DN +   +RN A+L+
Sbjct: 657 VI--SEGKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLL 714

Query: 632 TRDYVSLCPYDGTRNNSADDGFGDACQQHAAAEQSNLTASPGNLALLGVEVENGPA---- 687
            R+YV +  +      +    F +   +++  +   L   P N A +    +   +    
Sbjct: 715 AREYVPMQEFKMNNQGNRIQEFPEFPVEYSPQQAEQL---PSNGASMNTITQTFSSDDLE 771

Query: 688 -----FAFQSQRAAN------------SQANSLF---NETDNRRVE-----ERSPERNQ- 721
                F+F      +            ++ NSLF   ++ D+  +      E SP+ N  
Sbjct: 772 TLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFDTETSPDHNLV 831

Query: 722 ---ELFVVDEDDSQPQVACYSNN---------------VSQVPSRLEDADQSLQP---DE 760
                 +V  DD+ P ++   NN               +    S +   +++      + 
Sbjct: 832 ANLARNMVSIDDTHPNISIDQNNDLGIEISMSGNDDNHIRSTSSNMNSLNRNHSTKLHNS 891

Query: 761 RRVPRVASLRN--TVQHESDDSDDEPQFRFQSRR 792
           R +P   S ++   ++   DD DD P+F+F  +R
Sbjct: 892 RSLPSNNSRQSFRVMEGSEDDDDDAPKFKFSRKR 925

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 106/239 (44%), Gaps = 38/239 (15%)

Query: 528 LIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENSNQ 587
           L+   ++AK  EV RLK  +  V ++ELTE+AIN+L +LA V+  D + R  ++      
Sbjct: 518 LVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETS 577

Query: 588 RILTNPQWARRKNFKKFVKLWPSHSSRSSPDNI----TDAVRNKAYLITRDYVSLCPYDG 643
           R   +P W  RKNFK FVK+   +  +   +N     +D +RN  YL+TR YV    Y  
Sbjct: 578 RNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTK 637

Query: 644 TRNNSADDGFGDACQQHAAAEQSNLTASPGNLALLGVEVENGPAFAFQSQRAANSQANSL 703
             +    D F +A +Q         T+   ++  +  + E+   F F    +     N  
Sbjct: 638 ESSKEMQD-FPEASEQ---------TSRQFSVPQVIDDPEDAEPFTFTRHTSGTPANNG- 686

Query: 704 FNETDNRRVEERSPERNQELFVVDEDDSQPQVACYSNNVSQVPSRLEDADQSLQPDERR 762
                              LFVVDEDDSQ  V       ++   R E+A Q + P  RR
Sbjct: 687 -------------------LFVVDEDDSQNDVVL----AARESIRPEEAVQLVDPSPRR 722

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 80/151 (52%), Gaps = 12/151 (7%)

Query: 514 HADTEVQAIKRPR-SLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVE-K 571
           +  T  + I+RP   L+ A Q+ K+ E  R+K ++ ++   ELTEEAINK  +L  V+  
Sbjct: 509 YKHTSDERIERPSVDLVHAIQDIKERETLRVKTSIVEIKENELTEEAINKFSDLTVVDIN 568

Query: 572 VDLMRRPS---EVPENSNQRILTNPQWARRKNFKKFVKLWP----SHSSRSSPDNITDAV 624
             L +  S     P NSNQ    N  W+ +KNFKKFVK+ P    S  +    D+ +  +
Sbjct: 569 TRLFKDKSLDINKPANSNQ---NNMDWSGKKNFKKFVKMVPKYKRSQGNGQHADSCSTFI 625

Query: 625 RNKAYLITRDYVSLCPYDGTRNNSADDGFGD 655
           RN A LITR++V +  Y    NNS  +   D
Sbjct: 626 RNSAMLITRNFVPMKQYSKLDNNSNSNEMTD 656

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 63/109 (57%), Gaps = 2/109 (1%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEV-RQNS 59
           MW+LRYQY  + GS  ++SCC++    Y +GRS K+ L ++ DKSISR+ + ++  R   
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 60  KLEVLNAGKLTKIGGDNVKMDQMLEFGADQS-VALEMGAGPVKGTVTYE 107
            + V N GK+T +    +   + L F +    V +++G  P+   +++E
Sbjct: 61  CIMVKNLGKVTMVEERYLSDGETLSFQSKNDLVTMKIGTTPIVVNLSWE 109

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 3/110 (2%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKS-PLQIKGDKSISRKHVQLEVRQNS 59
           MWILRY Y  E    + VSCCL++   Y +GRS K+  L IK DKSISR+H+  +   + 
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60

Query: 60  KLEVLNAGKLTKIGGDNVKMDQM--LEFGADQSVALEMGAGPVKGTVTYE 107
            ++++N GKLT I    +K  +   +   A +   +++G+ PV   + +E
Sbjct: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWE 110

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 82/157 (52%), Gaps = 27/157 (17%)

Query: 496 LKSSRTLSNEAKVEGNISHADTEVQAIKRPR--------SLIQAFQEAKQHEVHRLKKNM 547
           LK+SR  S     E      DTEV    RPR        SL++  Q  K +E  RL+  +
Sbjct: 510 LKASREASKIVGPESLAPSRDTEVL---RPRPAKPRNSSSLVETIQSVKDNETRRLQCTL 566

Query: 548 ADVGSEELTEEAINKLDNLASVE-KVDLMR-RPSEVPENSNQRILTNPQWARRKNFKKFV 605
             V   ELT+EAI    N+A VE  V+++R +P+ V E+S +        + R NFKKF+
Sbjct: 567 TPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMVTESSIR--------SDRPNFKKFM 618

Query: 606 KLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYD 642
           K+WP     +      D++RN AYLITRDYV +  Y+
Sbjct: 619 KVWPKARKGN------DSLRNNAYLITRDYVPMKAYN 649

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 102/207 (49%), Gaps = 23/207 (11%)

Query: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVR---- 56
           M ILRY+ +   G    VSCCL    +Y +GRS K+   IK DKSISR+HV L  +    
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSD 60

Query: 57  -QNSKLEVLNAGKLTKIGGDNVKMDQMLEFG-ADQSVALEMGAGPVKGTVTYEPAIWKIP 114
            +N  +++ N GK+T I    +  D+ L+F   D+ + + +G  P+   +  +  +    
Sbjct: 61  DKNVIIQIKNFGKVTMIKDKYLSQDETLQFTLIDKKLEVNIGTSPITLEIFNQEVVCNSI 120

Query: 115 HDLAITES---LKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNC---LFALVKKIPIM 168
            D+  ++S   L N   L D  +T  L  +    IIKE+  S+ +    LF+ V  IPI+
Sbjct: 121 EDIQNSDSKLILNNLNILQDDPLT--LKREGPTIIIKEN--SYTDILLELFSNVFGIPIV 176

Query: 169 C-EGFIGDFVSQFADTQIDFDAKWEQI 194
             E   G      A+   DF + W++I
Sbjct: 177 TIEELRG-----IANAN-DFYSYWDKI 197

>KLTH0F03454g Chr6 (301123..302166) [1044 bp, 347 aa] {ON} conserved
           hypothetical protein
          Length = 347

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 229 SIIDAGSGNLW-LCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAK 287
           S++ +GS N +  CG V NL T     +KS +V  L H +++ P+L   +    HI++A+
Sbjct: 151 SMLSSGSTNFFKYCGLVLNLKTLSITAVKSSSVFSLEH-VKQFPSLQELRLVGFHIEDAE 209

Query: 288 LLKNKARSLGF 298
              N   +LG+
Sbjct: 210 AEANPRNNLGY 220

>Skud_13.184 Chr13 complement(315391..316953) [1563 bp, 520 aa] {ON}
           YMR029C (REAL)
          Length = 520

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 62/159 (38%), Gaps = 34/159 (21%)

Query: 112 KIPHDLA---ITESLKNHLSLYDI--------QVTNSLTSKTSVQIIKEHQKSHGNCLFA 160
           KI  DL    I     +H++LYD         QV   L SK+  ++I +         + 
Sbjct: 186 KIHSDLPKIDIISCYGDHMALYDADTKSLEIHQVDTGLNSKSVKKMILKQDSQIAKFFWV 245

Query: 161 LVKKIPIMCEGF------------IGDFVSQFADTQ----------IDFDAKWEQITLKN 198
              +  ++ E F            I D ++ F DT+          IDF  KW  I  +N
Sbjct: 246 SSSEFFVIDESFHLKLFSISNACLISD-LNLFQDTEQSFSYDNIINIDFKNKWLLIVARN 304

Query: 199 APFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGN 237
            P +++   D      N  +T +KT+ I   I D+  GN
Sbjct: 305 KPQIKIWELDNIDIAGNVPITIKKTYVIAHDINDSDEGN 343

>TDEL0A01790 Chr1 (321579..323606) [2028 bp, 675 aa] {ON} Anc_2.405
           YLR035C
          Length = 675

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 57/143 (39%), Gaps = 26/143 (18%)

Query: 580 EVPENSNQRILTNPQWARRKNFKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLC 639
           E+P+ S  RI+++            V L P ++ +   DN  DA     Y+      S C
Sbjct: 5   EIPDTSKWRIISSS-----------VILDPKYAVKELLDNAIDAGATNIYIDVDARTSGC 53

Query: 640 PYDGTRNNSADDGFGD-------ACQQHAAAEQSNLTASPGNLALLGVEVENGPAFAFQS 692
            Y   R    DDG G         C +H+ ++ S+L     NL+ LG     G A    S
Sbjct: 54  NYISVR----DDGSGVNAEDRALMCSKHSTSKISSL-RDLSNLSSLGFR---GQALFSLS 105

Query: 693 QRAANSQANSLFNETDNRRVEER 715
             A    +  +   T+N +V E+
Sbjct: 106 NLANQKGSMQIITRTNNEKVGEK 128

>KAFR0K00460 Chr11 complement(94825..97134) [2310 bp, 769 aa] {ON}
           Anc_7.28 YAL043C
          Length = 769

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 8/112 (7%)

Query: 220 NQKTFAIYKSIIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNN 279
           N++ ++    I +  S   W    ++ L  F+E + +     I I L+ E P+L+S+   
Sbjct: 654 NEEWYSFKLKITNEDSYKTWSIRLLNELIPFLENKHRR----IFIRLMSELPSLSSDH-- 707

Query: 280 SMHIQEAKLLKNKARSLGFKTRDVNDIVDAVLKNDILSLLDRVPQE-KALEE 330
            + I +  L+     SLGF+      +  A +K  I  LLD V QE  +LEE
Sbjct: 708 -VSIMKPILMDPSRSSLGFQALKFLIMFRAPVKPMIKDLLDTVMQEDSSLEE 758

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 83,001,859
Number of extensions: 3734535
Number of successful extensions: 13056
Number of sequences better than 10.0: 206
Number of HSP's gapped: 13719
Number of HSP's successfully gapped: 224
Length of query: 792
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 674
Effective length of database: 39,950,811
Effective search space: 26926846614
Effective search space used: 26926846614
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)