Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F16016g5.436ON48448425260.0
Kwal_55.214185.436ON48448417880.0
SAKL0G02574g5.436ON48448013670.0
AER403C5.436ON48046510731e-142
KLLA0E02223g5.436ON48047110391e-137
Ecym_47605.436ON47847710041e-131
ZYRO0F10076g5.436ON4824769411e-122
TDEL0E018905.436ON4744728761e-112
Kpol_1062.285.436ON4654854081e-43
TPHA0E017505.436ON4594703352e-33
TBLA0A028105.436ON4814762479e-22
Ecym_33422.304ON4952231661e-11
KNAG0H019402.304ON4562801652e-11
KAFR0H032502.304ON4623041632e-11
SAKL0E07194g2.304ON4951731535e-10
YNL026W (SAM50)2.304ON4841321526e-10
CAGL0M06853g2.304ON4665141509e-10
Kwal_27.114562.304ON4962251501e-09
Kpol_1003.512.304ON4782051472e-09
Smik_14.3042.304ON5001321472e-09
TDEL0G023402.304ON4942231463e-09
NDAI0G007102.304ON4912421437e-09
TBLA0B060602.304ON5032171383e-08
AGR392C2.304ON4951321365e-08
KLTH0G10824g2.304ON4952511341e-07
KLLA0E08735g2.304ON4922251341e-07
Skud_14.3022.304ON4841311303e-07
Suva_14.3192.304ON4841331294e-07
NCAS0G038602.304ON4611621232e-06
NCAS0G037502.304ON4611621232e-06
ZYRO0A02310g2.304ON4921501223e-06
TPHA0G008302.304ON4781341108e-05
NDAI0A022007.300ON1118108723.2
KAFR0E002801.520ON193124685.1
KNAG0D006506.291ON339106687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F16016g
         (484 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   977   0.0  
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   693   0.0  
SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   531   0.0  
AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...   417   e-142
KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   404   e-137
Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...   391   e-131
ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   367   e-122
TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    342   e-112
Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   161   1e-43
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436    133   2e-33
TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436    100   9e-22
Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar t...    69   1e-11
KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.3...    68   2e-11
KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.3...    67   2e-11
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    64   5e-10
YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}  SAM50Esse...    63   6e-10
CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} simil...    62   9e-10
Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {...    62   1e-09
Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON} (1170...    61   2e-09
Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026...    61   2e-09
TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.3...    61   3e-09
NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {O...    60   7e-09
TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON} Anc_2...    58   3e-08
AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}...    57   5e-08
KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} simila...    56   1e-07
KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} simila...    56   1e-07
Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026...    55   3e-07
Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026...    54   4e-07
NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {O...    52   2e-06
NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON}               52   2e-06
ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} simila...    52   3e-06
TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.3...    47   8e-05
NDAI0A02200 Chr1 (495754..499110) [3357 bp, 1118 aa] {ON} Anc_7....    32   3.2  
KAFR0E00280 Chr5 (57515..58096) [582 bp, 193 aa] {ON} Anc_1.520 ...    31   5.1  
KNAG0D00650 Chr4 (95192..96211) [1020 bp, 339 aa] {ON} Anc_6.291...    31   7.8  

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/484 (100%), Positives = 484/484 (100%)

Query: 1   MDLSDFSKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPL 60
           MDLSDFSKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPL
Sbjct: 1   MDLSDFSKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPL 60

Query: 61  QTLDQSLSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIA 120
           QTLDQSLSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIA
Sbjct: 61  QTLDQSLSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIA 120

Query: 121 RIRLTPINLNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKV 180
           RIRLTPINLNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKV
Sbjct: 121 RIRLTPINLNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKV 180

Query: 181 LEAKLLIPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKT 240
           LEAKLLIPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKT
Sbjct: 181 LEAKLLIPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKT 240

Query: 241 GLAPVLYNGFSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGL 300
           GLAPVLYNGFSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGL
Sbjct: 241 GLAPVLYNGFSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGL 300

Query: 301 KFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSA 360
           KFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSA
Sbjct: 301 KFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSA 360

Query: 361 GKSSSLVHHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQ 420
           GKSSSLVHHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQ
Sbjct: 361 GKSSSLVHHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQ 420

Query: 421 FFFNAGDVQNKKPTQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVS 480
           FFFNAGDVQNKKPTQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVS
Sbjct: 421 FFFNAGDVQNKKPTQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVS 480

Query: 481 LSLY 484
           LSLY
Sbjct: 481 LSLY 484

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/484 (68%), Positives = 399/484 (82%)

Query: 1   MDLSDFSKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPL 60
           M L  FS+ LQ+ +E  ++Q+SSLKPLYFTSISVDG+    PLS+  YNSVLEPVL QPL
Sbjct: 1   MTLPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPL 60

Query: 61  QTLDQSLSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIA 120
           QTL+QSL+NF EIKKKLIYTG+F DVKISLD + S + L+ L +D +K  +LE P+PTIA
Sbjct: 61  QTLEQSLANFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIA 120

Query: 121 RIRLTPINLNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKV 180
           RI L P+  N+   TS T DT+ S+G RYS +N  GKAE++TLQ ++ Y PF++T  EK 
Sbjct: 121 RILLKPLEFNKLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKT 180

Query: 181 LEAKLLIPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKT 240
           L+AK+++PLQKNPSVKAVFD NYANIDL+GQPF+EK+DQHRQ+QVSVNVGVQKQW+  K 
Sbjct: 181 LDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKM 240

Query: 241 GLAPVLYNGFSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGL 300
            L+PV YNGFSVVARNL +V  EAS AIRQF+APF+KNSFVSQL++DNRKFFGLFPASG+
Sbjct: 241 NLSPVFYNGFSVVARNLHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGV 300

Query: 301 KFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSA 360
           K ++NNEYVLS+ F+K +G  ++ +EGF+K A+  EA R+FF NKIINSL++ACGGI   
Sbjct: 301 KIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPT 360

Query: 361 GKSSSLVHHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQ 420
           G S+SLVHH+DKFYLGG++SLKGFERN+VGQHGG  FYKL +ASSFKLP TP  SPLRLQ
Sbjct: 361 GNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQ 420

Query: 421 FFFNAGDVQNKKPTQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVS 480
           FF NAG+V N+KPT  SCAASSG+SLLYKS LANMDLTYA PL+NR QD+ KPGFSFGVS
Sbjct: 421 FFLNAGEVSNEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVS 480

Query: 481 LSLY 484
           LSLY
Sbjct: 481 LSLY 484

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/480 (54%), Positives = 340/480 (70%), Gaps = 4/480 (0%)

Query: 7   SKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQS 66
           S E QK  +   + +S+ KPLY TS+SVDGDN  +PLS+ +Y S+L+PVL QPLQ +D +
Sbjct: 7   STEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNA 66

Query: 67  LSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTP 126
           ++NF+EIKKKL +TGLF+DVKI+LDN+VS      L +++ K Y +E+P+PT+A+I L P
Sbjct: 67  MNNFSEIKKKLFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIP 126

Query: 127 INLNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLL 186
              N+  LTS T D LSSMGGR S IN  GKAE L LQ  + Y PF    +EK L+ K L
Sbjct: 127 ALYNKLCLTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFL 186

Query: 187 IPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVL 246
           +PLQKNPS+KAV D NYA IDL  QPF+   DQH+Q+Q S N+GVQK W+  KTG AP+L
Sbjct: 187 LPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPIL 246

Query: 247 YNGFSVVARNLDEVRKEA--SEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSI 304
           +NG S V RNL      A  SE+I+QF+  F+K+SFVSQ+  D RKF GLFP SG +F++
Sbjct: 247 FNGVSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNL 306

Query: 305 NNEYVLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSS 364
            NEYVL+++F K     V Q   FDK  + +E H ++  N+I +SL+ +CG I   G  +
Sbjct: 307 VNEYVLTQAFSKNK--TVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKA 364

Query: 365 SLVHHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFN 424
           ++VH +D+FYLGG+ SLKGFE N+VG  GG  FY+LG+ SS++LPN  ANSPLR Q FFN
Sbjct: 365 AIVHTMDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFN 424

Query: 425 AGDVQNKKPTQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSLY 484
           AGD  NK+    S AA++G SL+YK++LANMDLTYA PLT R QD+ KPGFSFGV LS +
Sbjct: 425 AGDSLNKRELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score =  417 bits (1073), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 216/465 (46%), Positives = 307/465 (66%), Gaps = 10/465 (2%)

Query: 21  RSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAEIKKKLIYT 80
           +S  KPLY TS+ V+ D    PLS+ V  S+L PVL +PLQ+L  +L++   I+K L+YT
Sbjct: 21  KSQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLMYT 79

Query: 81  GLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTPINLNRASLTSFTGD 140
           GL++D+ I+LD++ S    Q L     K Y +E+P+P  A +++ P    R SL + T D
Sbjct: 80  GLYQDISITLDHDKSRLVNQFLSNIAPKEYDIELPLPVKALVKVLPAPYQRLSLVTTTRD 139

Query: 141 TLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPLQKNPSVKAVFD 200
           + +S GGR + +N FG AEV +LQ  + Y PF    D+K+++ + L+P Q NPS+KAVFD
Sbjct: 140 SYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAVFD 199

Query: 201 ANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNGFSVVARNLDEV 260
            NYA +DL  QP+I + DQH+Q+Q+  N+G+QKQW++ K   +P  + G S+V RNL  +
Sbjct: 200 VNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLS-KRLYSPTAFAGVSIVGRNLHGI 258

Query: 261 R-KEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESFDKKAG 319
           +   AS  +  +    +K SFV+Q L  NRK  G FP  G+KF+  NE VLS++    AG
Sbjct: 259 QLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTV---AG 315

Query: 320 TAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSS-LVHHIDKFYLGGM 378
           T   Q E F+K  V +E H +F  N +  SL+L+CG + S  +++  +VH +D+FYLGG+
Sbjct: 316 TP--QEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGL 373

Query: 379 SSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDV-QNKKPTQFS 437
           SSLKGF RNSVG  GG LFY+L L SS  LP TP +SPLRLQ FFNAGDV   ++     
Sbjct: 374 SSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQIPED 433

Query: 438 CAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLS 482
            AA++G+SL+Y+S +AN+DLTYA PLT+R  D+ KPGFSFGV+++
Sbjct: 434 VAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIA 478

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  404 bits (1039), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 212/471 (45%), Positives = 299/471 (63%), Gaps = 18/471 (3%)

Query: 25  KPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAEIKKKLIYTGLFR 84
           K +YFT ++VDGDN  SP+S+ +Y S+   +L  PLQ +D +  +  +I+KKL++TGLF+
Sbjct: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76

Query: 85  DVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTPINLNRASLTSFTGDTLSS 144
             +I+LD++V     + L +++ K   +E+PIPTIA+++L P   N+ SL++ T DT SS
Sbjct: 77  SAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSS 136

Query: 145 MGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPLQKNPSVKAVFDANYA 204
            G R   IN FG AE ++LQG + Y PF    DE++L AKL +P  KNPSVKA   AN+ 
Sbjct: 137 AGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYANHT 196

Query: 205 NIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNGFSVVARNLDEVRK-- 262
            +DL  QPFI + D+H+Q Q  ++ G++K ++          +NG ++VARN+       
Sbjct: 197 YLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFADAL 256

Query: 263 EASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESFDKKAGTAV 322
             S++I+QF   F K+SF+S+L  D+R+F+  FP SG +  + +EY+LS+ F       +
Sbjct: 257 AVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSK--PL 314

Query: 323 SQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFS-AGKSSSLVHHIDKFYLGGMSSL 381
                FDKL+V +E HR FF  K++ SL L  G IF    KS  LVH +D FYLGG  SL
Sbjct: 315 PHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSL 374

Query: 382 KGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDVQN--------KKP 433
           KGFERN VG  GG  FYKLG++SSFKLPNTP +SPLRLQ F N GDV N        +KP
Sbjct: 375 KGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKP 434

Query: 434 TQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSLY 484
                A S+G+SL+Y +S AN+DL+Y+ PL  R  DI KPG +FG+ LS +
Sbjct: 435 -----ALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score =  391 bits (1004), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/477 (46%), Positives = 311/477 (65%), Gaps = 19/477 (3%)

Query: 13  GSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAE 72
           G E+++ +  + KPL+ TS+ V+ D   SPLSN+++ S+L+PVL QP Q L  +LS    
Sbjct: 12  GHEAALAKVQT-KPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGT 69

Query: 73  IKKKLIYTGLFRDVKISLDNEVS---SDELQSL-PKDLVKGYALEMPIPTIARIRLTPIN 128
           I+KKL+YTGL+ DV I+LD + S   SD L+ + PK+    Y LE+P+P  A+I+L P  
Sbjct: 70  IEKKLMYTGLYDDVNITLDQDKSQYISDYLEEVAPKE----YGLELPVPIKAQIQLVPAF 125

Query: 129 LNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIP 188
               SL + T D+ ++ G   S +N F +AE + LQG+L   PF    DEK+L  K L+P
Sbjct: 126 YQPLSLVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVP 185

Query: 189 LQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYN 248
           LQK PS+KAVFD NYA +DL  Q ++ + DQH+Q Q+  N+G+Q+Q ++      P++Y+
Sbjct: 186 LQKLPSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYS 245

Query: 249 GFSVVARNLDEVRK-EASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNE 307
           G S++ RNL +++K E S +I  +     K S+V Q+L +N+KF G  P SG KF++ NE
Sbjct: 246 GISILGRNLLDLKKTEVSSSINSW-VESSKVSYVFQILQNNKKFLGTLPISGWKFNLFNE 304

Query: 308 YVLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSL- 366
            VL ++    AG    Q  GF K+A  +E + +F  N II SL+L+ G IF     S L 
Sbjct: 305 AVLGQTV---AGE--KQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELK 359

Query: 367 VHHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAG 426
           VH +D+FYLGG+SSLKGF+RNSVG  GG  FYK+   SSF +P TP  SPLRLQ F NAG
Sbjct: 360 VHIMDQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAG 419

Query: 427 DVQN-KKPTQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLS 482
           DV N ++      A ++G+SL+Y+S LA++DLTYA PL+ R QD+ KPGFSFGVS++
Sbjct: 420 DVFNSERGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIA 476

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  367 bits (941), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 197/476 (41%), Positives = 286/476 (60%), Gaps = 3/476 (0%)

Query: 10  LQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSN 69
           +    E   +  +  KPLY + I +DGDNGSSPLS+++  ++    L QPLQ+++ S++ 
Sbjct: 9   IHTAHEHINLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINI 68

Query: 70  FAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTPINL 129
           F +I+KKL++TGLF DV I+LD +  +  L  L K++ + Y +E P+ T A++ L   + 
Sbjct: 69  FEDIRKKLLFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDY 128

Query: 130 NRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPL 189
           N  S T+   D   S+ G  +  N  G+A+   L+    + P  S +D K       +PL
Sbjct: 129 NTISGTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPL 188

Query: 190 QKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNG 249
            K PSV+A+ +A      L  +PF+   D+H Q+Q +V  G QK+W+   +   P+LY G
Sbjct: 189 VKVPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTG 248

Query: 250 FSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYV 309
            SVV RNL+E +  ASE    F  PF K SFV+    D R+F G FP SG +F +NNEYV
Sbjct: 249 VSVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYV 308

Query: 310 LSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSLVHH 369
           +S+S  + +   ++ +  F+K A   E H + + +KI  S +L  GGI+  G  +  VH 
Sbjct: 309 ISQS--QGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHP 366

Query: 370 IDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDVQ 429
           +D+F LGG++SLKGF  N VG  G   FYKLGL+ S KL NTP  SPLRLQ+FFN G+  
Sbjct: 367 LDRFQLGGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNAS 426

Query: 430 NKKPTQF-SCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSLY 484
           +   T F S AA++G+SL+YK+  A +DLTYA PLT+R QD+ KPG S GVSL+ +
Sbjct: 427 SDYKTIFNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  342 bits (876), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/472 (40%), Positives = 280/472 (59%), Gaps = 7/472 (1%)

Query: 16  SSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAEIKK 75
           +S +Q S  KPLY + IS+DGDN  SPLS +VY ++L+  L  P+Q +  SL  F +I++
Sbjct: 7   ASDIQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRR 66

Query: 76  KLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTPINL--NRAS 133
           KL+ TGL++DV+I+L+ +  +   +   KD  K Y +E P+ T ARI L P  +  + A 
Sbjct: 67  KLLCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAG 126

Query: 134 LTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPLQKNP 193
            TS   D+ S    R S +N  G+A+  +    L Y P  S ++ K L+    +PL KNP
Sbjct: 127 TTSLVDDSASVAISR-SYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNP 185

Query: 194 SVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNGFSVV 253
           SV+A  + +   ++   + +I + D H + Q S++ G+QK+W+  +T   P  Y G +  
Sbjct: 186 SVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITST 245

Query: 254 ARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSES 313
            R++  +  +AS+    +   F K S  S+   D RK++G FP SG +  +NNEYV+S++
Sbjct: 246 NRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQT 305

Query: 314 FDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSLVHHIDKF 373
             K +   + Q + F K     + H + + NK+ NSL+L  GGI    + +  VH +DK+
Sbjct: 306 --KGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTE-VHPMDKW 362

Query: 374 YLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDVQNKKP 433
           YLGG+ S+KGF+ N VG  G   FYK+ L +S KL NTP +SPLRL FF N G+  N   
Sbjct: 363 YLGGLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLN 422

Query: 434 TQF-SCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSLY 484
           T   S AA++G+SL YK+  ANMDLTYA PLT+R QDI KPGFSFGV+ S +
Sbjct: 423 TATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  161 bits (408), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 133/485 (27%), Positives = 230/485 (47%), Gaps = 33/485 (6%)

Query: 6   FSKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQ 65
           F +EL+       +  S  KPLY + +SV+ D+   PLS++   +VLE V+  P+Q +D 
Sbjct: 4   FHEELKNEFVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDT 63

Query: 66  SLSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLT 125
           +L +F +IK+ L++TGL+ DV ++L  +     L    K +     +E  +PT A IRL 
Sbjct: 64  ALGSFIDIKRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLK 123

Query: 126 PINLNRASLTSFTGDTLSSMGGRYSVINNF-GKAEVLTLQGKLAYQPFQSTFDEKVLEAK 184
           P +L     T+FT  +       + +  NF G A+   +     Y    +++ +K  + +
Sbjct: 124 PNDLVTNLQTTFTTTSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGE 183

Query: 185 LLIPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQK-QVSVNVGVQKQWVNIKTGLA 243
            ++P  K PS++ V   + +          E +  H Q+   +   G+QK W+       
Sbjct: 184 FILPFTKVPSLRTVLSVDVS----------EDKVSHLQRLNCNYKAGIQKLWLKDDLNTF 233

Query: 244 PVLYNGFSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFS 303
           PV Y+G S+V        +   +       P  ++ +++    D+ K+ G FP SG   +
Sbjct: 234 PVFYSGLSIVNNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLN 293

Query: 304 INNEYVLS--ESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAG 361
           + NEYVLS  +S +K   T +++ E       +FE + +   +++I ++ +  G  F   
Sbjct: 294 LKNEYVLSQLDSDNKPINTNINRFEA------NFEKYVSILNSRVITTVLMNGGFQFPID 347

Query: 362 KSSSLVHHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQF 421
           +S+         ++G     +      +  +   + +K G  SSFKLPNT  +SPLRLQ 
Sbjct: 348 ESTRST------FVGESWDKRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQI 401

Query: 422 FFNAGDVQNK---KPTQFS-CAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSF 477
              +   +NK       F  CAA +GVSL+YK+   NM L+Y  PL          GFSF
Sbjct: 402 ---SALTENKFKGLANYFDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSF 458

Query: 478 GVSLS 482
            ++++
Sbjct: 459 DIAIT 463

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score =  133 bits (335), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 119/470 (25%), Positives = 225/470 (47%), Gaps = 30/470 (6%)

Query: 22  SSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAEIKKKLIYTG 81
           S  KP+Y T + V        LS+T Y ++L  V+  P++++      F  I+  LI +G
Sbjct: 9   SDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSG 68

Query: 82  LFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTPINLN--RASLTSFTG 139
           L+++V + LD +  +  L    K   +   +E  +P  A + +TP+ L   +  +T  T 
Sbjct: 69  LYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTS 128

Query: 140 DTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPLQKNPSVKAVF 199
           +T +S+      IN FG ++  T++        +S  D+K ++AK  +PL +N S++ + 
Sbjct: 129 NTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLRNSSIRTIL 188

Query: 200 DANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNGFSVVAR--NL 257
           ++  +         I K      KQ  +N+G+ K  +       P+ Y+G ++  +   L
Sbjct: 189 ESKCS---------IAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTTL 239

Query: 258 DEVRKEASEA--IRQFDAPFVKN-SFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESF 314
             +  E SE   I       + + S  S+ + D+R +   FP+ G  F + +++VL+E+ 
Sbjct: 240 GPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLNET- 298

Query: 315 DKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSLVHHIDKFY 374
                  + +N     + + FE H +   ++I +S  +  G +    +S+    +  +F+
Sbjct: 299 -NSISNEIKKN--ISNINMSFEKHISTLNDQITSSF-IFDGHVGVPLQSTFANLNSGEFW 354

Query: 375 LGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDVQNKKPT 434
                  K   +N +     K+ +K+GL SSF++PN P  SP+R Q     G  ++K+  
Sbjct: 355 DNEKEIFKTLCQNDI-----KVSHKVGLVSSFRVPNIPITSPIRFQLSV-LGINKSKRMA 408

Query: 435 QF--SCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLS 482
           ++  + +A +GVSL+YK   + M L+Y  PL   G D +  G SF V+++
Sbjct: 409 EYLKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVT 457

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score = 99.8 bits (247), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 126/476 (26%), Positives = 202/476 (42%), Gaps = 28/476 (5%)

Query: 22  SSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAEIKKKLIYTG 81
           +S KPLY + +++   N    +S++   S+L PVL  PLQ L  +L  F  I+ KL  T 
Sbjct: 19  NSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTD 78

Query: 82  LFRDVKISLD-NEVSSDELQSLPKDL-VKGYALEMPIPTIARIRLTPIN-LNRASLTSFT 138
           LF DVKISLD N+ +S ++++L  D+ V    ++ PIP  A I + P   L   + T   
Sbjct: 79  LFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNYTWTI 138

Query: 139 GDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPLQKNPSVKAV 198
            +  S      + IN+  +A+   +     Y    + +     +     PL    SVK+V
Sbjct: 139 SNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFTSVKSV 198

Query: 199 FDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQK-----QWVNIKTGLAPVLYNGFSVV 253
                + I L  +P  + +D     Q  V  G +K     + V +K+     LY G ++ 
Sbjct: 199 -----SGISL-FKPLQQSKD---YIQYLVESGFRKDMRFPEEVGVKSS---NLYTGLAIN 246

Query: 254 ARNLDEVRKEA---SEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVL 310
               DE        ++ I +    + K S +S+   D+R F    P  G  F+I  EYVL
Sbjct: 247 GAIKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYYEYVL 306

Query: 311 SESFD-KKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSLVHH 369
           +   D KK    +       +  ++FE +   F + I+ SL +  G   S   S ++ + 
Sbjct: 307 NGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGT--SIKPSINMFNW 364

Query: 370 IDKFYLGGMSSLKGF-ERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDV 428
             K        +  + E     ++ G  FY + L +S  L +    SPLR Q        
Sbjct: 365 ETKRREANEFPVPSYLEERPHEKNDGIAFYNVCLNASVPLFSKCKFSPLRFQNSIQLERY 424

Query: 429 QNKKP-TQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSL 483
            N  P  Q     +  + L+YKS  A  D+ Y  P+        K GF+   S+S 
Sbjct: 425 NNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISF 480

>Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar to
           Ashbya gossypii AGR392C
          Length = 495

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 99/223 (44%), Gaps = 33/223 (14%)

Query: 277 KNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDFE 336
           KNS    +  D+R    +FP+ G    + NE  L        GT       + K  ++F 
Sbjct: 287 KNSISHAISRDSRDN-AIFPSRGQYIKLFNELSL--------GT-------YWKSILEFT 330

Query: 337 AHRAFFGNKIIN-SLELACGGIFSAGKSSSLVHHIDKFYLGGMSSLKGFERNSVGQH--- 392
             +++     I  S  +  G I +    +  +H  DKF+ GG + ++GF++  +G     
Sbjct: 331 DAKSWLDKDFITMSTTIKGGYIANLNSDNKFIHMKDKFHSGGSNDVRGFQQMGLGPRDIY 390

Query: 393 ---GGKLFYKLGLASSFKLP-NTPANSPLRLQFFFNAGDVQNKKPTQFS------C---A 439
              GG  F   G++   +LP N  +NS  RL +F N G + N   +  S      C   +
Sbjct: 391 DSIGGDTFVAYGISVFSRLPVNKWSNSGFRLHWFLNGGRLINHNNSDLSGVLDQLCMEHS 450

Query: 440 ASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLS 482
            ++G+ +L+K  +A  +L +  PL     D  + GF +G+ LS
Sbjct: 451 IATGIGILFKHPVARFELNFTLPLAAHSSDSVRKGFQYGIGLS 493

>KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.304
           YNL026W
          Length = 456

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 116/280 (41%), Gaps = 41/280 (14%)

Query: 223 KQVSVNVGVQKQWVNIKTGLAPVLYN---GFSVVARNL---DEVRKEASEAIRQFDAPFV 276
           + V  + GV + W N      P  +N    + +V R     D    + SE +   +  FV
Sbjct: 190 RDVGASFGV-RSWYN-----DPKKWNMSFDYELVRRKFLGTDTKETKLSEYLLIQEGSFV 243

Query: 277 KNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDFE 336
           ++   +    DNR      P  G  + INNE             A+     F K  ++  
Sbjct: 244 RSVIKNNFTKDNRDS-PFNPTKGTMYKINNEL-----------GAMDNGSSFWKTVLELN 291

Query: 337 AHRAFFGNKIIN-SLELACGGIFSAGKSSSLVHHIDKFYLGGMSSLKGFERNSVG-QH-- 392
             +++F    I  S  L  G I +   + S +H  DKF  GG + ++ F+ N +G +H  
Sbjct: 292 HVKSWFPRDFITLSTTLRSGYIKNLNPAKSYIHFTDKFQNGGPNDVRNFQLNGIGPRHMH 351

Query: 393 ---GGKLFYKLGLASSFKLP-NTPANSPLRLQFFFNAGDVQNK---------KPTQFSCA 439
              GG  F   G++   K+P     +S  RL ++FN G + N          +      +
Sbjct: 352 HSMGGDAFIAYGVSLFSKIPLKRFQDSNFRLHWYFNGGKLINHNNLPIHTLLRELTLEHS 411

Query: 440 ASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGV 479
            S G  ++ +  +A  +L +  PLT+   D+Q+ GF FG+
Sbjct: 412 TSIGAGIVMRHPMARFELNFGVPLTSHVGDLQRKGFQFGL 451

>KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.304
           YNL026W
          Length = 462

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 130/304 (42%), Gaps = 54/304 (17%)

Query: 208 LNGQPFIE-KRDQHRQKQVSVNVGVQ--------KQWVNIKTGLAPVLYNGFSVVARNLD 258
           +NG PF   K D      V  NVGV+        K W + K      L  G  +V RN +
Sbjct: 176 INGDPFWSSKLDIF---DVWKNVGVKDLGLYMGTKSWFDAKNTWNYDL--GLEMVKRNFN 230

Query: 259 EVRKEASEAIRQF----DAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESF 314
             +  +S+ +  +    +  F K +  S ++ D R      P  G  F INN        
Sbjct: 231 H-KLNSSKVVSDYLLIQEGEFYKTTLRSTMVWDGRNG-KTAPTKGRLFKINN-------- 280

Query: 315 DKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKII---NSLELACGGIFSAGKSSSLVHHID 371
           D   GT    N  F +   +F   +++  +  I   N+++      +    S   +H  D
Sbjct: 281 DLGFGT---NNLQFWRHVTEFNLVKSWLKDDFITMSNTIKFG----YIKNLSQDYIHFTD 333

Query: 372 KFYLGGMSSLKGFERNSVG-QH-----GGKLFYKLGLASSFKLP-NTPANSPLRLQFFFN 424
           KF  GG + ++ F+   +G +H     GG  F   G++   KLP     +S  RL +FFN
Sbjct: 334 KFQNGGPNDIRSFQSMGIGPRHNSYSLGGDAFLSYGVSIFSKLPIQKFHDSNFRLHWFFN 393

Query: 425 AGDVQNK-KPTQFSC--------AASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGF 475
            G + N    + ++C        + S+GV ++ +  +A  ++ +A P+T+   D+ + GF
Sbjct: 394 GGKLINHDNASIWNCMQNLTIENSTSAGVGVVLRHPMARFEMNFAVPITDHQDDLTRKGF 453

Query: 476 SFGV 479
            FG+
Sbjct: 454 QFGL 457

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 77/173 (44%), Gaps = 17/173 (9%)

Query: 328 FDKLAVDFEAHRAFFGNKIINSLELACGGIFSA-GKSSSLVHHIDKFYLGGMSSLKGFER 386
           F K  ++F    ++F N  I       GG  S     S  +H  DKF+ GG + ++GF+ 
Sbjct: 322 FWKTTLEFSQTNSWFTNDFITMTGTLKGGYISNFHPKSQPLHMGDKFHNGGSNDVRGFQA 381

Query: 387 NSVG------QHGGKLFYKLGLASSFKLP-NTPANSPLRLQFFFNAGDVQNKKPTQFS-C 438
             +G        GG  F   G++   +LP      S  RL +F N G + N   T  S C
Sbjct: 382 MGLGPKDLYDSMGGDAFVAYGVSLFSRLPVRRWYESNFRLHWFVNGGRLINHNNTNLSSC 441

Query: 439 --------AASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSL 483
                   + S+GV L++K  +A  +L +  P++    D  + GF +G+ L+ 
Sbjct: 442 IKSLAQEHSTSTGVGLVFKHPVARFELNFTVPISAHSSDSVRKGFQYGIGLTF 494

>YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}
           SAM50Essential component of the Sorting and Assembly
           Machinery (SAM or TOB complex) of the mitochondrial
           outer membrane, which binds precursors of beta-barrel
           proteins and facilitates their outer membrane insertion;
           homologous to bacterial Omp85
          Length = 484

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 63/132 (47%), Gaps = 16/132 (12%)

Query: 367 VHHIDKFYLGGMSSLKGFERNSVGQH------GGKLFYKLGLASSFKLPNTPAN-SPLRL 419
           VH  DKF  GG S ++GF+   +G        GG  F   GL+   +LP      S  RL
Sbjct: 351 VHICDKFQSGGPSDIRGFQTFGLGPRDLYDAVGGDAFVSYGLSVFSRLPWKKVEKSNFRL 410

Query: 420 QFFFNAGDVQNKKPTQF-SC--------AASSGVSLLYKSSLANMDLTYAFPLTNRGQDI 470
            +FFN G + N   T   +C        + S+G+ L+ +  +A  +L +  P+T    D+
Sbjct: 411 HWFFNGGKLVNHDNTSLGNCIGQLSKEHSTSTGIGLVLRHPMARFELNFTLPITAHENDL 470

Query: 471 QKPGFSFGVSLS 482
            + GF FG+ L+
Sbjct: 471 IRKGFQFGLGLA 482

>CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026w
          Length = 466

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 122/514 (23%), Positives = 196/514 (38%), Gaps = 93/514 (18%)

Query: 4   SDFSKELQK--GSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVY--NSVLEPVLVQP 59
           ++   ELQ+    ++ ++ R+   P+  T +  +G     P +   Y  N++L+      
Sbjct: 11  AELQAELQRFQNFQNGLLNRNLNTPVSVTKVITNGTETIKPQTLQTYLDNTILQAT---- 66

Query: 60  LQTLDQSLSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTI 119
             TL Q + N   +  KL+  GL +DV        S++E    P       + E PIP I
Sbjct: 67  --TLKQLVKNADFLSAKLVQHGLAQDVY----QNFSTNEKVMSP-------SAENPIPII 113

Query: 120 ARIRLTPINLNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEK 179
             I      LN   +  F   T +++G      NN G       +G L +Q      + +
Sbjct: 114 DVIS----QLNILPVKKFVAKTGTNVG------NNEG-------EGYLEFQLRNVFGNGE 156

Query: 180 VLEAKLLIPLQKNPSVKAVFDAN---YANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWV 236
            L   +L    KN S+ A F      Y  +DLN    I K  ++      +++      +
Sbjct: 157 SLRLDMLRGTAKNSSMLASFVKPINPYHVLDLN----IYKHSKNLGNICPLDLHFNGGKM 212

Query: 237 NIKTGLAPV--------LYNGFSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDN 288
           +IK+ L            Y G   V R        AS+ +        K+S      +D 
Sbjct: 213 SIKSELGNTQKRINQEWFYEG---VTRTTKVTSDHASDTLLFQAGTDFKSSIGHTYAIDT 269

Query: 289 RKFFGLFPASGLKFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIIN 348
           R    + P  G  F +NNE  L + +               K   +    +++F N  I 
Sbjct: 270 RDSV-MAPNRGNLFKLNNEVALGKYW---------------KSQFELSKVQSWFKNDFIT 313

Query: 349 SLELACGGIFSAGKSSSLVHHI-DKFYLGGMSSLKGFERNSVGQH------GGKLFYKLG 401
           +     GG            HI DKF  GG + ++ F+   VG        GG  F   G
Sbjct: 314 TTTTLKGGYLGNFHPDKKTLHINDKFMSGGPNDIRSFQSFGVGPKDLQDAIGGDTFLSYG 373

Query: 402 LASSFKLPNTP-ANSPLRLQFFFNAGDVQNK--KPT---------QFSCAASSGVSLLYK 449
           ++   KLP     +S  RL +FFN G + N   KP          Q S +   G+ L  +
Sbjct: 374 VSIFSKLPIKKFEDSHFRLHWFFNGGKLINHQNKPVIDTLHDLSRQHSTSVGCGIVL--R 431

Query: 450 SSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSL 483
             +A  +L ++ PLT   +D  + GF FG+ +S 
Sbjct: 432 HPVARFELNFSLPLTVSTEDSLRKGFQFGLGMSF 465

>Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {ON}
           YNL026W - 1:1 [contig 27] FULL
          Length = 496

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 94/225 (41%), Gaps = 33/225 (14%)

Query: 276 VKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDF 335
           +KNS    +  D R    +FP +G    I+NE  L++               F K + +F
Sbjct: 287 IKNSLCHSIFWDTRDK-PIFPLAGSFLKISNEIALNK---------------FWKSSFEF 330

Query: 336 EAHRAFFGNKIINSLELACGG-IFSAGKSSSLVHHIDKFYLGGMSSLKGFERNSVG---- 390
              R++  N    +     GG I +    +  +H  DKF+ GG + ++ F+   +G    
Sbjct: 331 SNVRSWCNNDFFTASGTVKGGYINNFHPQTKPLHVSDKFHNGGSNDVRSFQLMGLGPKDL 390

Query: 391 --QHGGKLFYKLGLASSFKLP-NTPANSPLRLQFFFNAGDVQNKKPTQFSCA-------- 439
               GG  F   G++   +LP    + S  RL  FFN   + N   T F  +        
Sbjct: 391 YDSMGGDAFVSYGVSIFSRLPIKRWSESNFRLHAFFNGARLINTNGTPFKSSLSTLASEH 450

Query: 440 -ASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSL 483
             S+GV L++   +A  +L +  PLT    D  + GF +G+ LS 
Sbjct: 451 STSTGVGLVFGHPVARFELNFCVPLTAHSSDSIRKGFQYGIGLSF 495

>Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON}
           (117089..118525) [1437 nt, 479 aa]
          Length = 478

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 88/205 (42%), Gaps = 32/205 (15%)

Query: 296 PASGLKFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSL-ELAC 354
           P  G    I+NE  L++ F               K  ++F + ++++ +     +     
Sbjct: 288 PNKGNLLKISNELALNQYF---------------KSQMEFSSSKSWYQDNFFTLMGTYKF 332

Query: 355 GGIFSAGKSSSLVHHIDKFYLGGMSSLKGFERNSVGQH------GGKLFYKLGLASSFKL 408
           G I     +   +H  DKF+LGG + ++GF+   +G        GG +F   G++   KL
Sbjct: 333 GWITKIDDNDKPLHISDKFHLGGSNDVRGFQLMGLGPKQINDAIGGDMFSAYGISLFSKL 392

Query: 409 P-NTPANSPLRLQFFFNAGDVQNKKPTQFSCAASS---------GVSLLYKSSLANMDLT 458
           P    ++S  RL  FFN G + N+    F     S         G  +++K  +A  +L 
Sbjct: 393 PFKKFSDSNFRLHAFFNGGKLVNQNTNTFDRNLQSLFKENSLAIGTGIIFKHPVARFELN 452

Query: 459 YAFPLTNRGQDIQKPGFSFGVSLSL 483
           +  PLT+   D  + GF +G+ +S 
Sbjct: 453 FTLPLTSYSTDHVRKGFQYGIGMSF 477

>Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026W
           (REAL)
          Length = 500

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 63/132 (47%), Gaps = 16/132 (12%)

Query: 367 VHHIDKFYLGGMSSLKGFERNSVGQH------GGKLFYKLGLASSFKLPNTPAN-SPLRL 419
           VH  DKF  GG + ++ F+   +G        GG  F   G++   +LP      S  RL
Sbjct: 367 VHICDKFQSGGPNDIRSFQTFGLGPRDLYDAIGGDAFVSYGVSMFSRLPWKKVEKSNFRL 426

Query: 420 QFFFNAGDVQNKKPTQFS-C--------AASSGVSLLYKSSLANMDLTYAFPLTNRGQDI 470
            +FFN G + N   T  S C        + S+G+ L+ +  LA  +L ++ P+T    D+
Sbjct: 427 HWFFNGGKLINHDNTSLSNCIGQLSREHSTSTGIGLVLRHPLARFELNFSLPITAHENDL 486

Query: 471 QKPGFSFGVSLS 482
            + GF FG+ L+
Sbjct: 487 MRKGFQFGLGLA 498

>TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.304
           YNL026W
          Length = 494

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 94/223 (42%), Gaps = 31/223 (13%)

Query: 276 VKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDF 335
           +K S    L +DNR    + P+ G    + NE  + + +  K    VSQN  +  L  DF
Sbjct: 285 IKCSLGHTLAIDNRDN-PIAPSRGSLLKLTNELAIGQFW--KGQIEVSQNNSW--LKDDF 339

Query: 336 EAHRAFFGNKIINSLELACGGIFSAGKSSSLVHHIDKFYLGGMSSLKGFERNSVGQH--- 392
                     + +   L  G I +   S   ++  DKF+ GG + ++ F    +G     
Sbjct: 340 ----------LGSCCTLRSGYIQNLSSSRKPINTFDKFHNGGANDIRSFHIMGLGPKDLY 389

Query: 393 ---GGKLFYKLGLASSFKLP-NTPANSPLRLQFFFNAGDVQNKKPTQFS---------CA 439
              GG  F   G++   +LP    ++S  RL +FFN G + N     F+          +
Sbjct: 390 DSIGGDAFVAYGVSFFSRLPIKRWSHSNFRLHWFFNGGKLINHNNAPFTNILEQLASEHS 449

Query: 440 ASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLS 482
            S G  +L +  +A  +L +  PLT    D  + GF +G+ +S
Sbjct: 450 TSVGFGILLRHQVARFELNFTLPLTCHSGDALRKGFQYGIGIS 492

>NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {ON}
           Anc_2.304
          Length = 491

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 106/242 (43%), Gaps = 47/242 (19%)

Query: 277 KNSFVSQLLVDNRKFFGL----FPASGLKFSINNEYVLSESFDKKAGTAVSQNEG-FDKL 331
           KNS  S  + D+R    L    FP++G  F   NE         ++ TA   N G F K 
Sbjct: 261 KNSLGSNFVWDSRNNSVLDPNAFPSNGQLFKWFNELNF---IGNRSSTA---NGGPFWKN 314

Query: 332 AVDFEAHRAFFGNKIINSLELACGGIFSAG-------------KSSSLVHHIDKFYLGGM 378
            ++F   R++  N  I    + C   F  G              SSS +H  DKF  GG 
Sbjct: 315 QLEFTQIRSWLPNDFI---TMNC--TFRTGYIKQLLTKNEVQKGSSSFLHISDKFQNGGP 369

Query: 379 SSLKGFERNSVGQH------GGKLFYKLGLASSFKLP-NTPANSPLRLQFFFNAGDVQNK 431
           + ++ F+   +G        GG  F   G++   KLP    + S  RL +F N G + N 
Sbjct: 370 NDIRSFQTMGLGPKDIFNSIGGDAFVSYGISIFSKLPIKDWSKSNFRLHWFLNGGKLINH 429

Query: 432 KPTQFS-C--------AASSGVSLLYKSSLANMDLTYAFPLT-NRGQDIQKPGFSFGVSL 481
                + C        + S+GV +L +  +A  +L ++ PLT ++G D++K GF FGV L
Sbjct: 430 NGMSINNCFTDLSRQHSISTGVGILLRHPMARFELNFSVPLTIHQGDDVRK-GFQFGVGL 488

Query: 482 SL 483
           S 
Sbjct: 489 SF 490

>TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON}
           Anc_2.304 YNL026W
          Length = 503

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 91/217 (41%), Gaps = 33/217 (15%)

Query: 300 LKFSINNEYV----LSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGN-KIINS----- 349
           L F   N+++     S +FD +    VS      KL  +F   R F  N +I+ +     
Sbjct: 286 LLFQAGNDFISKLGYSCTFDSRDHPIVSSRGTLIKLGNEFAPDRFFKTNLEIVKNKSFFR 345

Query: 350 ---LELAC----GGIFSAGKSSSLVHHIDKFYLGGMSSLKGFERNSVGQH------GGKL 396
              + +AC    G I +   +S  +H  DKF  GG + ++GF+   +G        GG  
Sbjct: 346 DDFITMACTFKTGYIHNFFPNSKAIHRNDKFQNGGANDIRGFQFMGLGPKDRFDSVGGDA 405

Query: 397 FYKLGLASSFKLPNTP-ANSPLRLQFFFNAGDVQNKKPTQF---------SCAASSGVSL 446
           F   G +   K+P     +S  R  +F N G + N                 + S G+ +
Sbjct: 406 FISYGFSVMNKIPIWKFYDSNFRFHWFVNGGKLINSNGKGLLNTFNDLSKQNSMSVGMGI 465

Query: 447 LYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSL 483
           +++  +A  +L +A P+     DI + GF +G+ LS 
Sbjct: 466 VFRHPMARFELNFAIPVVTHSGDITRKGFQYGIGLSF 502

>AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL026W
           (SAM50)
          Length = 495

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 58/132 (43%), Gaps = 16/132 (12%)

Query: 367 VHHIDKFYLGGMSSLKGFERNSVGQH------GGKLFYKLGLASSFKLP-NTPANSPLRL 419
           +H  DKF+ GG + ++GF+   +G        GG  F   GL+   +LP    A S  RL
Sbjct: 362 IHIRDKFHCGGANDVRGFQLMGLGPKDAQDSLGGDAFLTYGLSLFSRLPVQRWAGSDFRL 421

Query: 420 QFFFNAGDVQNKKPTQF---------SCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDI 470
            +F N G + +                 + S G  LL++  +A  +L +  PL     D 
Sbjct: 422 HWFLNGGRLLSHNGASLLDVGTTLLEEHSISCGTGLLFQHPVARFELNFTLPLATHSSDT 481

Query: 471 QKPGFSFGVSLS 482
            + GF +G+ +S
Sbjct: 482 ARKGFQYGIGVS 493

>KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 495

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 104/251 (41%), Gaps = 32/251 (12%)

Query: 249 GFSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEY 308
           G   + R+       +S+++       VKNS    +  D R    +FP +G  + + NE 
Sbjct: 260 GVESLWRSTQATSTHSSDSLLLLAGDEVKNSLSHSVFWDTRDR-PIFPLAGSFYKLTNE- 317

Query: 309 VLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSLVH 368
            LS S   K     S+ + + K    F A     G  I N         FSA K    +H
Sbjct: 318 -LSPSKYWKCFFEASKVKSWRKNDF-FTASFTLKGGYINN---------FSASKP---LH 363

Query: 369 HIDKFYLGGMSSLKGFERNSVGQH------GGKLFYKLGLASSFKLP-NTPANSPLRLQF 421
             DKF+ GG + ++ F+   +G        GG  F   G++   +LP    ++S  RL  
Sbjct: 364 ISDKFHNGGSNDVRSFQLMGLGPKDLHDSLGGDAFVSYGVSLFSRLPFKRWSDSNFRLHA 423

Query: 422 FFNAGDVQNKKPTQF-SC--------AASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQK 472
           FFN   + N    Q  +C        + S+G+ L+    +A  +L +  PLT    D  +
Sbjct: 424 FFNGARLINTNGDQLKNCISSLAREHSTSTGIGLVLGHPVARFELNFGIPLTAHTSDSAR 483

Query: 473 PGFSFGVSLSL 483
            GF +G+ LS 
Sbjct: 484 KGFQYGIGLSF 494

>KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 95/225 (42%), Gaps = 33/225 (14%)

Query: 276 VKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDF 335
           VK+S V  +  D R    + P+SG  +   NE  L +               F K  +++
Sbjct: 283 VKHSVVHSITRDTRDNI-IAPSSGQMWKFINEVSLGK---------------FWKTNLEY 326

Query: 336 EAHRAFFG-NKIINSLELACGGIFSAGKSSSLVHHIDKFYLGGMSSLKGFERNSVGQH-- 392
              +++F  N I  S  +  G I +    +  +H  DKFY GG + ++ F+   +G    
Sbjct: 327 NFTKSWFNRNFITMSSTVKAGYIHNFHAKTYPLHLADKFYNGGSNDVRSFQLMGLGPKDI 386

Query: 393 ----GGKLFYKLGLASSFKLP-NTPANSPLRLQFFFNAGDVQNKKPTQFS---------C 438
               GG      GL+   +LP     +S  RL  FFN G + N+     +          
Sbjct: 387 YDYVGGDTSLSYGLSLFSRLPFKRFYDSNFRLHLFFNGGRLINRNNANTTDTLMQMLSQH 446

Query: 439 AASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSL 483
           + S+G  L+++  +A  +L +  P+T    D  + GF +G+ +S 
Sbjct: 447 SLSTGFGLVFRHPVARFELNFTVPITAHTSDATRKGFQYGIGISF 491

>Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 16/131 (12%)

Query: 367 VHHIDKFYLGGMSSLKGFERNSVGQH------GGKLFYKLGLASSFKLPNTPAN-SPLRL 419
           +H  DKF  GG + ++ F+   +G        GG  F   G++   +LP      S  RL
Sbjct: 351 IHICDKFQSGGPNDIRSFQTFGLGPRDLYDTIGGDAFVSYGVSVFSRLPWEKVKKSNFRL 410

Query: 420 QFFFNAGDVQNKKPTQFS-C--------AASSGVSLLYKSSLANMDLTYAFPLTNRGQDI 470
            +FFN G + N      S C        + S+G+ L+ +  +A  +L ++ P+     D+
Sbjct: 411 HWFFNGGKLINHDNMSLSNCMGRLSKEHSTSTGLGLVLRHPMARFELNFSLPIAAHENDL 470

Query: 471 QKPGFSFGVSL 481
            + GF FG+ L
Sbjct: 471 MRKGFQFGLGL 481

>Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 60/133 (45%), Gaps = 16/133 (12%)

Query: 367 VHHIDKFYLGGMSSLKGFERNSVGQH------GGKLFYKLGLASSFKLPNTPAN-SPLRL 419
           VH  DKF  GG + ++ F+   +G        GG  F   G++   +LP      S  RL
Sbjct: 351 VHICDKFQNGGPNDIRSFQTFGLGPRDLYDAIGGDAFVSYGVSVFSRLPWKKVQKSNFRL 410

Query: 420 QFFFNAGDVQNKKPTQFS-C--------AASSGVSLLYKSSLANMDLTYAFPLTNRGQDI 470
            +FFN G + N      S C        + S+G+ L+ +  +A  +L ++ P+     D+
Sbjct: 411 HWFFNGGKLINHDNMSLSNCIGQLSKEHSTSTGIGLVLRHPMARFELNFSLPIAAHENDL 470

Query: 471 QKPGFSFGVSLSL 483
            + G  FG+ L+ 
Sbjct: 471 MRKGLQFGIGLAF 483

>NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 73/162 (45%), Gaps = 19/162 (11%)

Query: 339 RAFFGNKIIN-SLELACGGIFSAGKSSSLVHHIDKFYLGGMSSLKGFERNSVG--QH--- 392
           +++F N  +  S     G I S   SS  VH  DKF  GG + ++ F+   +G   H   
Sbjct: 301 KSWFDNDFVTMSCNFKTGYIHSL--SSQSVHISDKFQSGGPNDIRSFQSMGLGPKDHMNS 358

Query: 393 -GGKLFYKLGLASSFKLP-NTPANSPLRLQFFFNAGDVQNKKPTQFS-CAA--------S 441
            GG  F   G++   +LP    + S  RL  F N G++ +      + C A        S
Sbjct: 359 IGGDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHSTS 418

Query: 442 SGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSL 483
           +GV ++ +  +A  +L ++ PLT    D  + G  FGV LS 
Sbjct: 419 AGVGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSF 460

>NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 73/162 (45%), Gaps = 19/162 (11%)

Query: 339 RAFFGNKIIN-SLELACGGIFSAGKSSSLVHHIDKFYLGGMSSLKGFERNSVG--QH--- 392
           +++F N  +  S     G I S   SS  VH  DKF  GG + ++ F+   +G   H   
Sbjct: 301 KSWFDNDFVTMSCNFKTGYIHSL--SSQSVHISDKFQSGGPNDIRSFQSMGLGPKDHMNS 358

Query: 393 -GGKLFYKLGLASSFKLP-NTPANSPLRLQFFFNAGDVQNKKPTQFS-CAA--------S 441
            GG  F   G++   +LP    + S  RL  F N G++ +      + C A        S
Sbjct: 359 IGGDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHSTS 418

Query: 442 SGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSL 483
           +GV ++ +  +A  +L ++ PLT    D  + G  FGV LS 
Sbjct: 419 AGVGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSF 460

>ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 67/150 (44%), Gaps = 20/150 (13%)

Query: 352 LACGGIFSAGKSSSLVHHIDKFYLGGMSSLKGFERNSVGQH------GGKLFYKLGLASS 405
           L  G I +   +S  ++  DKF  GG + ++ F+   +G        GG  F   G++  
Sbjct: 344 LKTGYIHNFHPTSQSLNICDKFQNGGGNDVRSFQYMGLGPKDIYDSIGGDAFVSYGVSVF 403

Query: 406 FKLP-NTPANSPLRLQFFFNAG-----------DVQNKKPTQFSCAASSGVSLLYKSSLA 453
            +LP +  ++S  RL +F N G           DV     TQ S   S G  L+ K  +A
Sbjct: 404 TRLPFHKISHSNFRLHWFLNGGKLINHNNSSLQDVIKNLSTQHS--TSIGFGLVLKHPVA 461

Query: 454 NMDLTYAFPLTNRGQDIQKPGFSFGVSLSL 483
             +L +A P+T    D  + GF +G+ LS 
Sbjct: 462 RFELNFALPVTCHTGDCIRKGFQYGIGLSF 491

>TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.304
           YNL026W
          Length = 478

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 61/134 (45%), Gaps = 18/134 (13%)

Query: 367 VHHIDKFYLGGMSSLKGFERNSVGQH------GGKLFYKLGLASSFKLP-NTPANSPLRL 419
           +H  D+F LGG + ++ F+   +G        GG  +   G++    LP  +   S  ++
Sbjct: 343 LHIGDRFQLGGGNDVRSFQPMGLGPKDIYDSIGGNSYTAYGISVFTALPFKSLMTSNFKI 402

Query: 420 QFFFNAGDVQNKKPTQ--FSCAA---------SSGVSLLYKSSLANMDLTYAFPLTNRGQ 468
             F N G + N   +   F+ A          S+GV +++K  +A  +L +  PL     
Sbjct: 403 HTFINGGKLINHNSSNGTFTDAVKDLIKENSLSTGVGIIFKHPVARFELNFTLPLITHKS 462

Query: 469 DIQKPGFSFGVSLS 482
           D+ + GF +G+ +S
Sbjct: 463 DMVRKGFQYGIGIS 476

>NDAI0A02200 Chr1 (495754..499110) [3357 bp, 1118 aa] {ON} Anc_7.300
           YDL185W
          Length = 1118

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 44/108 (40%), Gaps = 14/108 (12%)

Query: 262 KEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYV----LSESFDKK 317
           K +SE      AP V+ + + QLL +N  F  L  + G++    +EYV    +  S+D  
Sbjct: 582 KASSEMTVALGAPLVRGNAIRQLLTENNVFLKLIESFGVRKENGSEYVKAIPMHLSYDD- 640

Query: 318 AGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSS 365
               +   E F    VD   H     N  I      C  I +A KS S
Sbjct: 641 ----IEVREQFIAGLVDSIGHVKRTSNGTIE-----CAAISTAYKSVS 679

>KAFR0E00280 Chr5 (57515..58096) [582 bp, 193 aa] {ON} Anc_1.520
           YJR069C
          Length = 193

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 54/124 (43%), Gaps = 10/124 (8%)

Query: 57  VQPLQTLDQSLSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPI 116
           ++ +Q LD      A+ K+ +   G    V +  D  ++ DEL  LP   +K +   + +
Sbjct: 42  LEEIQELDLKEIALAKCKQAVSMLGPGHAVFVE-DTALTFDELNGLPGAFIKWFVKSLGL 100

Query: 117 PTIARIRLTPINLNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKL------AYQ 170
             I ++ L P   N+ + T+ T    +   G Y V   F K  ++  +G         ++
Sbjct: 101 NKIVKL-LDPFE-NKGA-TAITTIAYADENGEYHVFQGFTKGRIVESRGPTNFGWDSIFE 157

Query: 171 PFQS 174
           PF+S
Sbjct: 158 PFES 161

>KNAG0D00650 Chr4 (95192..96211) [1020 bp, 339 aa] {ON} Anc_6.291
           YPL255W
          Length = 339

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 47/106 (44%), Gaps = 7/106 (6%)

Query: 196 KAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNGFSVVAR 255
           K   DAN +   +   P   KRD  R  Q  V+   +++  N   G  P  Y  + +++ 
Sbjct: 30  KKYRDANVSEEAVRMSP---KRDTRRNLQTGVSSSPKRR-SNSLDGFDPSFYRKYDLLS- 84

Query: 256 NLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLK 301
             D+VR+E S  +R     +  +  ++   ++ ++  G FP S  +
Sbjct: 85  --DDVREEPSAVLRSPIRLYPSDQLMTDTFMNKKRGTGRFPRSARR 128

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,992,522
Number of extensions: 2278637
Number of successful extensions: 6728
Number of sequences better than 10.0: 56
Number of HSP's gapped: 6891
Number of HSP's successfully gapped: 56
Length of query: 484
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 371
Effective length of database: 40,524,141
Effective search space: 15034456311
Effective search space used: 15034456311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)