Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F15994g5.437ON39039021010.0
Kwal_55.214155.437ON38937512551e-172
SAKL0G02596g5.437ON4003778351e-108
KAFR0E038205.437ON3963595854e-71
Suva_2.5425.437ON4423535807e-70
Skud_4.6395.437ON4423715721e-68
NDAI0B056905.437ON4233835701e-68
YDR370C5.437ON4423755492e-65
TDEL0B021805.437ON4183605463e-65
AER404C5.437ON3863525356e-64
Smik_4.6365.437ON4463735328e-63
ZYRO0F10098g5.437ON3733635102e-60
NCAS0F034005.437ON4153755011e-58
CAGL0A02860g5.437ON4023704888e-57
KLLA0E02245g5.437ON4033664592e-52
KNAG0C048905.437ON4053944102e-45
Kpol_1016.45.437ON4133224052e-44
TBLA0A028005.437ON4533143582e-37
TPHA0J026005.437ON4413503045e-30
NDAI0I032603.570ON3771991408e-09
KLLA0E12893g3.570ON3842511311e-07
YGL246C (RAI1)3.570ON3873101292e-07
Smik_7.153.570ON3873101292e-07
SAKL0F00726g3.570ON3831771283e-07
Kwal_47.192763.570ON3861771283e-07
NCAS0E002403.570ON3802041265e-07
Skud_7.213.570ON3892041256e-07
KLTH0G00660g3.570ON3832951203e-06
TPHA0G036503.570ON3772621193e-06
KAFR0J001603.570ON3802851176e-06
Suva_7.153.570ON3892031177e-06
ZYRO0E09592g3.570ON3801731062e-04
KNAG0D029703.570ON3861361025e-04
TBLA0E001803.570ON3782361008e-04
TDEL0D063803.570ON378235990.001
CAGL0C01925g3.570ON400231980.002
Ecym_26003.570ON384135890.015
Kpol_380.83.570ON379240880.023
AFR263C3.570ON376272760.58
KLTH0B08756g5.51ON102346722.2
AFR262CsingletonON775153694.8
ABR165W7.503ON63971686.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F15994g
         (390 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   813   0.0  
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   488   e-172
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   326   e-108
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   229   4e-71
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   228   7e-70
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   224   1e-68
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   224   1e-68
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   216   2e-65
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   214   3e-65
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   210   6e-64
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   209   8e-63
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   201   2e-60
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   197   1e-58
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   192   8e-57
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   181   2e-52
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   162   2e-45
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   160   2e-44
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   142   2e-37
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   121   5e-30
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     59   8e-09
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    55   1e-07
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    54   2e-07
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    54   2e-07
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    54   3e-07
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    54   3e-07
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    53   5e-07
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    53   6e-07
KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON...    51   3e-06
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    50   3e-06
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    50   6e-06
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    50   7e-06
ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} simila...    45   2e-04
KNAG0D02970 Chr4 (535257..536417) [1161 bp, 386 aa] {ON} Anc_3.5...    44   5e-04
TBLA0E00180 Chr5 complement(23463..24599) [1137 bp, 378 aa] {ON}...    43   8e-04
TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON} Anc_3...    43   0.001
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    42   0.002
Ecym_2600 Chr2 (1167583..1168737) [1155 bp, 384 aa] {ON} similar...    39   0.015
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    39   0.023
AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON} S...    34   0.58 
KLTH0B08756g Chr2 complement(708976..712047) [3072 bp, 1023 aa] ...    32   2.2  
AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON} S...    31   4.8  
ABR165W Chr2 (711762..713681) [1920 bp, 639 aa] {ON} Syntenic ho...    31   6.9  

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/390 (100%), Positives = 390/390 (100%)

Query: 1   MQKLFEKLSLEDLPDEACVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFEL 60
           MQKLFEKLSLEDLPDEACVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFEL
Sbjct: 1   MQKLFEKLSLEDLPDEACVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFEL 60

Query: 61  GRKQSAPHLKKDLGLFTITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNK 120
           GRKQSAPHLKKDLGLFTITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNK
Sbjct: 61  GRKQSAPHLKKDLGLFTITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNK 120

Query: 121 WEGDHGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKD 180
           WEGDHGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKD
Sbjct: 121 WEGDHGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKD 180

Query: 181 DGIYSSESNIRRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFN 240
           DGIYSSESNIRRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFN
Sbjct: 181 DGIYSSESNIRRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFN 240

Query: 241 PAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYT 300
           PAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYT
Sbjct: 241 PAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYT 300

Query: 301 RQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTL 360
           RQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTL
Sbjct: 301 RQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTL 360

Query: 361 TKQLELRLRKIETPSTAKESPKPKPAHAQS 390
           TKQLELRLRKIETPSTAKESPKPKPAHAQS
Sbjct: 361 TKQLELRLRKIETPSTAKESPKPKPAHAQS 390

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  488 bits (1255), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 221/375 (58%), Positives = 292/375 (77%), Gaps = 1/375 (0%)

Query: 5   FEKLSLEDLPDEACVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQ 64
            + LSL+D  +E   +C+ F+ A I+ FP   L FFDEV+E+ T+TH +D+D+F L  K 
Sbjct: 5   LQDLSLQDRTEEVHANCKNFQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLLDDKL 64

Query: 65  SAPHLKKDLGLFTITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGD 124
             P L +DL  FT + KLA    Y+GHDLL+H+D++ P+TP QLEDM+GV  FL +W+  
Sbjct: 65  GMPELVQDLCEFTESGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQL 124

Query: 125 HGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDDGIY 184
           HG+ +   +DFTIVCSRHNLIDLIM PFSDEDVH  +++ NGYL++ PD Q+QK D GI+
Sbjct: 125 HGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLNLSPDAQYQKTDQGIH 184

Query: 185 SSESNIRRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKR 244
           S ++ I++ICYTGFELE+L+T T     +S+FYSLV+GK+   IKLL KAEMDCFN + R
Sbjct: 185 SGDTKIKKICYTGFELENLITATSKPDVRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTR 244

Query: 245 SYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQEL 304
           SYTEIKC++GLKVKS +HRRKLLRMWVQTSLVPST+LL+G+RDPYYHQL+SFECYTR +L
Sbjct: 245 SYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQL 304

Query: 305 YQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQL 364
           Y+KFNN+ L++++K YNYNA ISVQWFRH++++LCQ I P++EK   E V+F+LTL K L
Sbjct: 305 YRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNL 364

Query: 365 ELRLRKI-ETPSTAK 378
            ++LRK+ ETP+  K
Sbjct: 365 TIKLRKMPETPAPTK 379

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  326 bits (835), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 248/377 (65%), Gaps = 9/377 (2%)

Query: 5   FEKLSLEDLPDEACVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQ 64
             KLSL+    +   +C+GF  +++SHFP+ P  FF E +EIGT T  + S K+    K 
Sbjct: 12  ISKLSLQH-GSQNTANCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKL 70

Query: 65  SAPHLKKDLG--LFTITKKLAKTNS-YVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKW 121
               LK D+   +    K  +K  + Y+G+DLL  ++D+ PL+ ++L +M G+  F+  W
Sbjct: 71  GLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNW 130

Query: 122 EGDHGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDD 181
           E  +GK Y S + FTIV +RH+LIDLIM PFS E+ +  V +++G L I  DK   K D 
Sbjct: 131 EEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSLEEANLIVTHLDGLLIISSDKSKPKVDS 190

Query: 182 GIYSSESNIRRICYTGFELEDLVTETQPGAPK--SAFYSLVQGKISKNIKLLFKAEMDCF 239
           GI S ++ +R++CYTGFELE+LVT+ +  +P   + FYS+V+ K+++ + LL +AEMD +
Sbjct: 191 GIRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSY 250

Query: 240 NPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECY 299
           NP   +Y E+KC+   ++K++ HRRKLLRMW+QT LVP TDLL+G RDPYY+QL + + Y
Sbjct: 251 NPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPY 310

Query: 300 TRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLT 359
           TR E+Y+KF+ RNL+  +K YN+N+ ++VQW  H++ ++ + +   +   P +  SFKLT
Sbjct: 311 TRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQ--SFKLT 368

Query: 360 LTKQLELRLRKI-ETPS 375
           LT+ L+L L K+  TP+
Sbjct: 369 LTRDLQLSLTKLANTPA 385

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  229 bits (585), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 125/359 (34%), Positives = 208/359 (57%), Gaps = 19/359 (5%)

Query: 24  FERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQS--APHLKKDL-----GLF 76
           F+  SI++FP  P +FF   +E+ T   + D   +E         P L KD+     G+ 
Sbjct: 35  FQHRSIAYFPNHPANFFQISREVAT---YHDGRIYEPNETSQDILPLLNKDISKIAQGVS 91

Query: 77  TITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFT 136
            I  +  K   Y+G DL + +++F+ ++  +L+     F ++ KWE  H   Y+    +T
Sbjct: 92  AIDARKYKV-KYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYT 150

Query: 137 IVCSRHNLIDLIMAPF-SDEDVHFNVKYI-NGYLHIFPDKQF-QKKDDGIYSSESNIRRI 193
           IV +RH++++LIM+ F + ++   N  Y+ NG L    D       ++GI++   N+++I
Sbjct: 151 IVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKI 210

Query: 194 CYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIKCTT 253
           CY+GF LEDL+T++Q    K   +S+ + ++  NI LL + EMD +N   ++YTE+KC  
Sbjct: 211 CYSGFALEDLLTKSQ----KEPLFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCYA 266

Query: 254 GLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNL 313
            LK+ S  HR+KLL+ W+QT ++PS+DL+ G+R PY  +L   E Y+R  LY++FNNRNL
Sbjct: 267 PLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNL 326

Query: 314 SLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQLELR-LRKI 371
              KK  N+NANI+V+W  H +K +C+ I+  ++    +A   K+   + + +R L KI
Sbjct: 327 PENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDAPQAFQIKVDTFRNISIRNLSKI 385

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  228 bits (580), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 208/353 (58%), Gaps = 17/353 (4%)

Query: 10  LEDLPDEACVSCRGFERASISHFPAEPL-HFFDEVKEIGTMTHWIDSDKFELGRKQSAPH 68
           LE++ +   V    F   SI +FP +P    F E KE+   T   D+  +   RK   P+
Sbjct: 57  LEEISEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFT---DNQLYVAARKDVIPN 113

Query: 69  LKKDLGLFTITKKLAK---TNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWE-GD 124
           LK+D+     +  L        Y+G DL  + D+  P+T ++L+ ++    ++  W   +
Sbjct: 114 LKEDISHLYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNN 173

Query: 125 HGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNV--KYI-NGYLHIFPDKQFQKK-- 179
            GKP+  G  FT+V +RH+++DL M PF   +   ++   Y+ NG++ +  + ++  K  
Sbjct: 174 SGKPFKIGKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKAS 233

Query: 180 DDGIYSSESNIRRICYTGFELEDLVTETQPGAPKSA----FYSLVQGKISKNIKLLFKAE 235
            +GIYS + NI++IC++GFE E+ +TE    +  SA     +S+V+GK+S++I LL + E
Sbjct: 234 KEGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCE 293

Query: 236 MDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSS 295
           MD FNP  ++ TE+KC   L ++++ HR+KLL+ W+QT L+P++D+++GLRD Y  QL  
Sbjct: 294 MDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLD 353

Query: 296 FECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEK 348
            + Y+R  L++KFN+  L L KK+ NYNA ++V+W +H +K +C  +   + +
Sbjct: 354 IQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISR 406

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  224 bits (572), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/371 (33%), Positives = 204/371 (54%), Gaps = 18/371 (4%)

Query: 18  CVSCRGFERASISHFPAEPL-HFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLF 76
           CV    F   SI     +P    F + KE+   T++     +   RK   P L+  +   
Sbjct: 65  CVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNY---QAYTTARKDLIPSLRDGITEL 121

Query: 77  ---TITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWE-GDHGKPYSSG 132
              ++ +   +   Y+GHDL  + D F P+T ++L+ +S    ++  W+  +HGK +  G
Sbjct: 122 YESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIG 181

Query: 133 SDFTIVCSRHNLIDLIMAPFSDEDVH--FNVKYINGYLHIF---PDKQFQKKDDGIYSSE 187
             FTIV +RH+++DL M  F   +      V Y+   L  F   P   FQ   +GIYSS+
Sbjct: 182 KKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSD 241

Query: 188 SNIRRICYTGFELEDLVTE----TQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAK 243
            N+++ICY+GFE E  VTE    T    PK   +S+V+ K+S++I LL + E+D FNP  
Sbjct: 242 PNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVS 301

Query: 244 RSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQE 303
           R+ TE+KC   L + ++ HR+KLL+ W+QT L+P++D++IGLRD +  QL   + Y+R  
Sbjct: 302 RTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDS 361

Query: 304 LYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEK-TPTEAVSFKLTLTK 362
           LY+KFN+  L   KK+ N+NA ++V+W  H +K +C+ +   +     T   SF++++  
Sbjct: 362 LYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDA 421

Query: 363 QLELRLRKIET 373
              + + K+ T
Sbjct: 422 NGTIAITKLNT 432

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  224 bits (570), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 121/383 (31%), Positives = 211/383 (55%), Gaps = 43/383 (11%)

Query: 22  RGFERASISHFPAEPLHFFDEVKEIG-------------TMTHWIDSDKFELGRKQSAPH 68
           + F+  SIS +P  P  FF+  K++               +   ++    +L     + +
Sbjct: 42  KQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPSCSLN 101

Query: 69  LKKDLGLFTITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKP 128
             +DL L            Y+G DL + Y+ F P+ P++L+ +   F+++  WE  +   
Sbjct: 102 EARDLKL-----------PYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHD 150

Query: 129 YSSGSDFTIVCSRHNLIDLIMAPFSD---EDVHFNVKYINGY--LHIFPDKQFQKKDDGI 183
           Y  G+ FTIV +RH+++++ M  F+    +D   NV Y  G   + +F     +K D GI
Sbjct: 151 YQLGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGI 210

Query: 184 YSSESNIRRICYTGFELEDLVTE------------TQPGAPKSAFYSLVQGKISKNIKLL 231
           YS +  +R+I Y+GF LEDL+T             T  G  K+ F ++++ K++ +I LL
Sbjct: 211 YSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVF-AIIENKLNDDISLL 269

Query: 232 FKAEMDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYH 291
            + EMD +NP  + +TE+KC   LK+ +  HRRKLL+ WVQT ++P++D+LIG+RDP + 
Sbjct: 270 LRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFG 329

Query: 292 QLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTP- 350
           +L+  E ++R  LY++ NNRNL   K   NYNA I+VQW +H +K +C+ +   ++KT  
Sbjct: 330 ELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRL 389

Query: 351 TEAVSFKLTLTKQLELRLRKIET 373
             + SF++ +     ++++K+++
Sbjct: 390 NTSQSFQIRINASRAIQIKKLKS 412

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  216 bits (549), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 125/375 (33%), Positives = 209/375 (55%), Gaps = 18/375 (4%)

Query: 14  PDEACVSCRGFERASISHFPAEP-LHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKD 72
           P   C+    F    + +F  +P    F E KE+   T   +   + + RK   P+LK+ 
Sbjct: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFT---NGRAYTILRKDLIPNLKES 117

Query: 73  LGLF---TITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDH-GKP 128
           +      ++ +   +   Y+GHDL  + D+F P+T ++L+ +S  F ++  W  D+ GK 
Sbjct: 118 IAELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKD 177

Query: 129 YSSGSDFTIVCSRHNLIDLIMAPFS--DEDVHFNVKYINGYLHIF---PDKQFQKKDDGI 183
           +  G  FT+V +RH+++DL M  F+  +      V Y+   L  F     K  Q   +GI
Sbjct: 178 FKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGI 237

Query: 184 YSSESNIRRICYTGFELEDLVTETQPGA----PKSAFYSLVQGKISKNIKLLFKAEMDCF 239
           YS++ N+++ICY+GFE E+ VTE    A     K   +SLV+ K+S+ I LL + EMD F
Sbjct: 238 YSNDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAF 297

Query: 240 NPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECY 299
           NP   + TE+KC   L + ++ HRRKLL+ WVQT L+P++D++IGLRD +  QL   + Y
Sbjct: 298 NPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWY 357

Query: 300 TRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYV-EKTPTEAVSFKL 358
           +R  L +KFN+  L   KK+ NYNA I+V+W  + ++ +C+ +   + + + T+  SF++
Sbjct: 358 SRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEI 417

Query: 359 TLTKQLELRLRKIET 373
            +     + + K++T
Sbjct: 418 GIDTNNAIVITKLKT 432

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  214 bits (546), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 122/360 (33%), Positives = 197/360 (54%), Gaps = 8/360 (2%)

Query: 17  ACVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLF 76
            C+    FE + + +FP +   FF+  +E+ T  +     K +  +K   P L+    L 
Sbjct: 48  VCIPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMK-DSSKKPLYPCLQMFAALI 106

Query: 77  TITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDH-GKPYSSGSDF 135
              +       Y+G DL + ++ ++PL  ++L+     FE++ KWE     K ++SG   
Sbjct: 107 AENRGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGK-V 165

Query: 136 TIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDDGIYSSESNIRRICY 195
           TI+  RH+++DL+MA F D++V      I     IF   + +++ +G+ S  S  R+ICY
Sbjct: 166 TIISPRHHVVDLVMALFHDDEVSIICTNIGKGKLIFSGDRSKEERNGLNSKNSMTRKICY 225

Query: 196 TGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIKCTTGL 255
           +GF LED +T T        FYS+V+GKI++ + LL + EMD +NP    YTE+KC T L
Sbjct: 226 SGFALEDKLT-TSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKL 284

Query: 256 KVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSL 315
            V+   HRRKLL+ WVQ  L+P +DL+IG RD    QL     Y+R  LY+KFNN +++ 
Sbjct: 285 NVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIAR 344

Query: 316 LKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAV----SFKLTLTKQLELRLRKI 371
             K  N+NANI+V+W  H ++ +C  +      +P +      SFK+ + K   + ++K+
Sbjct: 345 NNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKL 404

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  210 bits (535), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 194/352 (55%), Gaps = 15/352 (4%)

Query: 19  VSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLFTI 78
           ++ RG ER+         +  F E +E+GT   +     ++L  K++ P L  ++  +  
Sbjct: 35  ITRRGKERS---------IRIFSESREVGTA--FRQGLVYDLDDKKNLPLLNDEICEYIS 83

Query: 79  TKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIV 138
            +  +K   YVG DL    + F P+T  +L  + G+ +F+ KWE D+   Y+S S FTIV
Sbjct: 84  HRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTIV 143

Query: 139 CSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDDGIYSSESNIRRICYTGF 198
             RH+++D++M PF +E          G   I       ++  GI S  S  R+ICYTGF
Sbjct: 144 SPRHHILDILMIPFGNERCRLVFTAHRGLFVI--TLAPSQRPTGINSPSSATRKICYTGF 201

Query: 199 ELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIKCTTGLKVK 258
           ELE L+T T  G  + +FYS ++ K+  +I +L + EMD +NP ++ YTEIK +    V+
Sbjct: 202 ELERLLTATS-GTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDFNVR 260

Query: 259 SAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSLLKK 318
           +  H  KLL++W QT+L+PSTD+L+G RDP  H L +   Y+  ++ +K   R+ +    
Sbjct: 261 NVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTRSHP 320

Query: 319 KY-NYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQLELRLR 369
            Y N+N  ++  W  + ++ +C+ ++  V+ T +   SF + + K L++++R
Sbjct: 321 SYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMKIR 372

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  209 bits (532), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 122/373 (32%), Positives = 200/373 (53%), Gaps = 24/373 (6%)

Query: 19  VSCRGFERASISHFPAEP-LHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLF- 76
           VS   F  + +  FPA+P    F E KE+   T   +   +   RK   P+LK D+    
Sbjct: 66  VSYTSFSHSGMHKFPAKPPRDIFHESKEVALFT---NGQAYTTVRKDILPNLKGDIAELC 122

Query: 77  --TITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWE-GDHGKPYSSGS 133
             ++     +   Y+GHDL  +   F P+T ++L+ +     ++  W   +HG+ +  G 
Sbjct: 123 ERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGR 182

Query: 134 DFTIVCSRHNLIDLIMAPFS--DEDVHFNVKYINGYLHIFPDKQ---FQKKDDGIYSSES 188
            FT+V +RH+++D+ M  F   ++       Y+   L  F   Q    +   +GIYSS+ 
Sbjct: 183 KFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDP 242

Query: 189 NIRRICYTGFELEDLVTETQPGA----PKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKR 244
           N+++ICY+GFE E+ VTE    A     K   +S+V+ K+S+ I LL + EMD FNP   
Sbjct: 243 NMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSG 302

Query: 245 SYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQEL 304
           + TE+KC   L + ++ HRRKLL+ W+QT L P++D++IGLRD +  QL   + Y+R  L
Sbjct: 303 ANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSL 362

Query: 305 YQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQ----TITPYVEKTPTEAVSFKLTL 360
             KFN+  L   K++ NYNA ++V+W  H +K +C+     I+ Y  K P    SF++++
Sbjct: 363 CMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPE---SFEISI 419

Query: 361 TKQLELRLRKIET 373
                + + K++ 
Sbjct: 420 DSNNTIAITKLKN 432

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  201 bits (510), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 196/363 (53%), Gaps = 17/363 (4%)

Query: 24  FERASISHFPAEPLHFFDEVKEI----GTMTHWIDSDKFELGRKQSAPHLKKDLGLFTIT 79
           F+ +S   FP+EP + F + KE     G   H  DS    +G K     L  D       
Sbjct: 21  FQHSSAFRFPSEPRNLFTKYKEASYYYGGQLH--DSISDSIGLKSPGNKLSHD------- 71

Query: 80  KKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIVC 139
           +  +    ++G DL + ++DF PL+P  L+   G ++++NKWE D+   YS  S F ++ 
Sbjct: 72  RSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFVVIS 131

Query: 140 SRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDDGIYSSESNI-RRICYTGF 198
            RH L++L M  F          ++     +    +  KK     S  + + ++I ++G+
Sbjct: 132 PRHYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNTTMTKKILHSGY 191

Query: 199 ELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIKCTTGLKVK 258
            LEDL+T   P      F+++++ ++  NI L+ + E+D +N    ++TE+KC   L + 
Sbjct: 192 ALEDLLTRG-PRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLNMH 250

Query: 259 SAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSLLKK 318
           +A+HR KLL+ W+Q ++ P  DLLIG+R+ +   L   + +T +ELY+K N+RNL    K
Sbjct: 251 NAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPK 310

Query: 319 KYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQLELRLRKIETPSTAK 378
           ++NYNA+++VQW +H ++ +C+ +   V+++  +   FKLT+ +  +++L K++      
Sbjct: 311 RFNYNADLAVQWCQHCIRSICKLVGENVDRSSPQC--FKLTIDESHKIQLEKLKHVPAHV 368

Query: 379 ESP 381
           E P
Sbjct: 369 ELP 371

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  197 bits (501), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 113/375 (30%), Positives = 194/375 (51%), Gaps = 32/375 (8%)

Query: 24  FERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLF---TITK 80
           F  +SIS FP     F++   ++  + H  +   +   +    PHLK D+      + ++
Sbjct: 31  FSHSSISLFPTCTQPFYESSNQVA-LYH--NHKLYPASQYDIIPHLKNDIAQLPKKSASE 87

Query: 81  KLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIVCS 140
                 SY+G DL + ++ F P++   L+ +     F+  WE      Y  G  F IV +
Sbjct: 88  ARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIVST 147

Query: 141 RHNLIDLIMAPFSD-----------EDVHFNVKYIN---GYLHIFPD--KQFQKKDDGIY 184
           RH+++++ M  F+            +D   NV Y     G L    D        ++GIY
Sbjct: 148 RHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEGIY 207

Query: 185 SSESNIRRICYTGFELEDLVTETQPGAPKS---------AFYSLVQGKISKNIKLLFKAE 235
           S    ++RICY+GF LEDL+TET     K          A +++V+ K+  +I +L + E
Sbjct: 208 SKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVENKLDDDICILLRCE 267

Query: 236 MDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSS 295
           +D FN A++ +TE+KC + LK+ +  HRRKLL+ WVQT ++P +D+LIG+RD  + +L  
Sbjct: 268 LDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELED 327

Query: 296 FECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYV-EKTPTEAV 354
            E Y+R  L  K NNRNL   K  +N+NA ++ QW +H ++ +C+ +   + +K  +   
Sbjct: 328 VEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISNPQ 387

Query: 355 SFKLTLTKQLELRLR 369
            F++ +  +  +R++
Sbjct: 388 GFQIRIDSRRNIRIK 402

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  192 bits (488), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 115/370 (31%), Positives = 190/370 (51%), Gaps = 14/370 (3%)

Query: 15  DEACVSCRGF-ERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDL 73
           D+  V  RG  +R   SH    P  F+D  K +G    + D   +E+ R    P LK  +
Sbjct: 38  DDHTVVIRGNKQRLKTSHHKNMP-QFYDSAKTLGI---FHDHKLYEMNRMDLFPQLKDPI 93

Query: 74  GLFTITKKLAKTN---SYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYS 130
                +    KT     ++G  L E++D + P+T  +L+       +L+++E  HG+ Y 
Sbjct: 94  AHIAKSTPAEKTQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYG 153

Query: 131 SGSDFTIVCSRHNLIDLIMAPFSDE--DVHFNVKYING-YLHIFPDKQFQKKDD-GIYSS 186
              DF IV +RH++IDL + PFS +  +V+    Y  G  L I  D      D  G+ + 
Sbjct: 154 EDRDFVIVTARHHMIDLAILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTD 213

Query: 187 ESNIRRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSY 246
              +++IC++GF LED++TE+     ++  + +V+ +I+ N +LL + E+D +NP    Y
Sbjct: 214 NPILKKICFSGFALEDILTESANDEERNPTFLIVENEIA-NTRLLMRCEIDAYNPITSHY 272

Query: 247 TEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQ 306
           TE+KC       +  HRRKLL+ W+QT ++P+TD++IG+RD     L    CY R  LY 
Sbjct: 273 TELKCYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYN 332

Query: 307 KFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEK-TPTEAVSFKLTLTKQLE 365
           K  +++L     + NY+  ISV W+R L+  L  TI   ++K    E   F + +     
Sbjct: 333 KLISKSLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCN 392

Query: 366 LRLRKIETPS 375
           +R+   + P+
Sbjct: 393 IRIEHRQNPN 402

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  181 bits (459), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/366 (30%), Positives = 189/366 (51%), Gaps = 29/366 (7%)

Query: 18  CVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLFT 77
            +SC+ F   S+++   +      + KE+   ++ I+            P L+ ++  + 
Sbjct: 41  VLSCKKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYI 100

Query: 78  ITKKL---AKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSD 134
              K    A  +S++G DL + YDD+ PL  N L  +  + E   ++E       +    
Sbjct: 101 KDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEKTLNPEKT---- 156

Query: 135 FTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQF-------QKKDDGIYSSE 187
            T V  RH++ID+IM PF DE +          + + PDK         + K +GI+ + 
Sbjct: 157 -TFVSLRHHIIDIIMCPFLDEPLSL-------LMTVQPDKNILISVDKSKDKPNGIHETR 208

Query: 188 SNI-RRICYTGFELEDLVTETQPGA---PKSAFYSLVQGKISKNIKLLFKAEMDCFNPAK 243
           ++  ++ICYTGF LEDL+ E+           +YS+V G ++  I LL +AEMD  N   
Sbjct: 209 NSFNKKICYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLT 268

Query: 244 RSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQE 303
            +YTEIK +   K+ + +HRRKLLRMW+QT+L+P +DLLIG R+ Y ++L   + Y  Q+
Sbjct: 269 DTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQD 328

Query: 304 LYQKFNNRNLSLLKKK-YNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTK 362
           +Y K NN ++     K Y +N N++  WF+H+ + L Q +    +++   + +FK+ +  
Sbjct: 329 IYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQVLKQNLLLLSQEST--STTFKVQIDT 386

Query: 363 QLELRL 368
            L L +
Sbjct: 387 NLTLSI 392

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  162 bits (410), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/394 (28%), Positives = 195/394 (49%), Gaps = 24/394 (6%)

Query: 5   FEKLSLEDLPDEACVSCRGFERASISHFPAEPLHFFDEVKEIGTMT----HWIDSDKFEL 60
           F +LS+ D   +  V  + F       + ++P H F + KE+   T    +  D +   L
Sbjct: 17  FHRLSIND---QKRVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNL 73

Query: 61  GRKQSAPHLKKDLGLFTITKKLAKTNS----YVGHDLLEHYDDFQ-PLTPNQLEDMSGVF 115
                 P LK+D+     +K   K+ S    Y+G  L   ++D+   ++P+ L+      
Sbjct: 74  ---TILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCL 130

Query: 116 EFLNKW-EGDHG-KPYSSGSDFTIVCSRHNLIDLIMAPFS-DEDVHFNVKYING---YLH 169
           +++N+W  G  G K +       IV  RH+L++L MA F+ D D       + G    L 
Sbjct: 131 DYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVCTVLRGKFIVLS 190

Query: 170 IFPDKQFQKKDDGIYSSESNIRRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIK 229
            F D   + +++GI  S+   R +CY+GF +  + +  +   P   FY      I +   
Sbjct: 191 QFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFY--YGTPIRRGHL 248

Query: 230 LLFKAEMDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPY 289
             F  EMD +N  +  YTE+KC   L +KS++H+ KLLR WVQT + P TD++IG R+ Y
Sbjct: 249 ATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAY 308

Query: 290 YHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYV-EK 348
              L      +R+ LY+KFNN++       +NYNA ++V+W ++ +K + + I   + +K
Sbjct: 309 DGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQK 368

Query: 349 TPTEAVSFKLTLTKQLELRLRKIETPSTAKESPK 382
           +  E  +F +T+ +  ++ +RK++      E PK
Sbjct: 369 SVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEIPK 402

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  160 bits (405), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/322 (31%), Positives = 170/322 (52%), Gaps = 21/322 (6%)

Query: 24  FERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSA-PHLKKDL----GLFTI 78
           F  ++   FP +    F E K +     +   D+  +  + +A P LKKD+    G   +
Sbjct: 46  FVHSNARSFPQKTKDLFLESKTVA----FFQKDQLFINVEDAALPLLKKDIANISGKSVL 101

Query: 79  TKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDH-GKPYSSGSDFTI 137
             K  K   Y+G DL    D + PL  + L+     F+F+  WE +H G+ Y + +D+TI
Sbjct: 102 NSKKYKL-PYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTI 160

Query: 138 VCSRHNLIDLIMAPFSDE---DVHFNVKYI-NGYLHIFPDKQFQKKDD---GIYSSESNI 190
           +  RH++ +++M+ F DE    V+    Y+ NG + +  D      +    G+ SS    
Sbjct: 161 LSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPMT 220

Query: 191 RRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIK 250
           R+ICY+GF  EDLV E      +  F S+V+ K++++I LL + E+D +N     +TE+K
Sbjct: 221 RKICYSGFAFEDLVLEDIAENARPIF-SVVESKLTESINLLLRNELDGYNNVTNMFTELK 279

Query: 251 CTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNN 310
           C   LK    F  +++L+ WVQT L+P +D++IG+RD     L     Y R++L + FNN
Sbjct: 280 CFAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNN 337

Query: 311 RNLSLLKKKYNYNANISVQWFR 332
            +L      +N+NANI+V+W +
Sbjct: 338 PSLPPAPSHFNFNANIAVEWLK 359

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  142 bits (358), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/314 (30%), Positives = 156/314 (49%), Gaps = 39/314 (12%)

Query: 88  YVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHG---KPYSSGSDFTIVCSRHNL 144
           Y+G DL + Y+ +  +    L D    F+++  ++  H    K Y    +F I+ SRH++
Sbjct: 113 YIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHI 172

Query: 145 IDLIMAPF---SDEDVHFNVKYING--------YLHIFPDKQFQKKDDGIYSSESNIRRI 193
            DL++APF   SD +V   + Y+          Y H  PD +  K+    Y+S   +R+I
Sbjct: 173 NDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQ---FYNS---MRKI 226

Query: 194 CYTGFELEDLVT-------------ETQPGAPK--SAFYSLVQGKISKNIKLLFKAEMDC 238
             +GF  EDLV              E Q   P   + ++S+V+  IS  + +L ++EMD 
Sbjct: 227 VNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDG 286

Query: 239 FNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFEC 298
           +NP   SYTE+KC T L + S FHR+KLL+ WVQ   +P++DLL+G RD     L+    
Sbjct: 287 YNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITW 346

Query: 299 YTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTP----TEAV 354
           ++R +L  K ++     L+   N     +  W+ H++  +      Y++KTP    +  V
Sbjct: 347 FSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPV 406

Query: 355 SFKLTLTKQLELRL 368
            F+L + K   + L
Sbjct: 407 PFRLIVEKNRTITL 420

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  121 bits (304), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 87/350 (24%), Positives = 162/350 (46%), Gaps = 33/350 (9%)

Query: 53  IDSDKFELGRKQSAPHLKKDLGLFTITKKLAKTN---SYVGHDLLEHYDDFQPLTPNQLE 109
           I +++ EL  + + P L KD+   +    L        Y+G++L +  + F P+    L+
Sbjct: 100 ITNNEAELINESNPPFLTKDISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLD 159

Query: 110 DMSGVFEFLNKWE-GDHGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYL 168
                FE+L   +  +  K Y++   +T +  RH+L +L+M  +   +       + G  
Sbjct: 160 STVPCFEYLRTLKISEEDKLYNTP--YTFMTPRHHLTELMMTVYESRESE-----LTGKS 212

Query: 169 HIFPDKQFQKKDDGIYSSE-----------------SNIRRICYTGFELEDLVTETQPGA 211
            +F     + KDD I  SE                 S  +++  +GF  E+LV E     
Sbjct: 213 WLFT----RIKDDLIVISEDLAKENNPSPQNHKLQNSFSKKVINSGFTFEELVIENFQEC 268

Query: 212 PKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWV 271
            K  FY + + +++     + ++EMD +N    ++TE+KC   L +  A HR+KLL+ W 
Sbjct: 269 HKPYFY-ISENRLTPKSTFIIRSEMDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWF 327

Query: 272 QTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWF 331
           QT L P+ D++IG+RD     L     Y+R+ +YQK  + +L   K  +++  +I +QW 
Sbjct: 328 QTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWL 387

Query: 332 RHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQLELRLRKIETPSTAKESP 381
            H +  +    T     T +  +++K+ + K   + ++K+       E P
Sbjct: 388 NHCIHAIESAFTKDTSDTASNPMTYKVIIDKHKSIIIKKLSIVPKNVEIP 437

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 87/199 (43%), Gaps = 40/199 (20%)

Query: 173 DKQFQKKDDGIYSSESNIRRICYTGFELEDLVTETQP----------------GAPKSAF 216
           D Q   KD     ++  I   CYTG++ E L T +QP                 +    +
Sbjct: 132 DGQIFIKDVTKQETQDPIDLNCYTGYKFESLATLSQPLPLVSRTTLEKRPKKISSNGDEY 191

Query: 217 YSLVQGKISKNIKLLFKAEMDCFNPAK-------RSYTEIKCTTGLKVKSAFHR--RKLL 267
            ++V+  +  + KL+  AE+DC    K       R Y E+KC+T +   +  HR  RKL 
Sbjct: 192 IAVVKTGVGSS-KLVLGAEIDCIFDFKEENKDNLRHYAELKCSTQIITAADAHRFERKLF 250

Query: 268 RMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANIS 327
           + W+Q  LV    ++ G RD  Y  L S E         +F+   + +L K++N   N S
Sbjct: 251 KTWLQCFLVGIPRIIYGFRDENY-TLKSVE---------EFSTEEVPILLKEHNPKMNTS 300

Query: 328 ----VQWFRHLVKRLCQTI 342
               ++W+  L + L + I
Sbjct: 301 CIDAIKWYGLLTEWLLKLI 319

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 104/251 (41%), Gaps = 36/251 (14%)

Query: 92  DLLEHYDDFQPLTPNQLEDMS--GVFEFLNKWEGDHGKPYSSGSDFTIVCSRHNLIDLIM 149
           DLL     F+     + +  +  G+   L ++E    +  S  +   I+  R  +  LI 
Sbjct: 58  DLLSGIKKFKECNTEEFDSTTLHGLLSTLEEYE----RRKSKKTKVDIITFRGIIRKLIS 113

Query: 150 APFSDED---VHFNVKYINGYLHIFPDKQFQKKDDGIYSSESNIRRICYTGFELEDLVTE 206
           + F       V+F +   +G L I   K    +     + ES   R  Y+G++ E L T 
Sbjct: 114 SAFDSSQFNPVNFRIVSFDGQLFIKEVKTDASETSINKNRESLQARAYYSGYKFEALATL 173

Query: 207 TQPG--APKSA--------------FYSLVQGKISKNIKLLFKAEMDCFNPAK------- 243
           + P    P++               F S+V+  I K  K+L  AE+DC    K       
Sbjct: 174 SLPLPLVPRTTLEKRPKKIINNGDQFISMVRTGIGK-CKILIGAEVDCIFDFKEDSDDNL 232

Query: 244 RSYTEIKCTTGLKVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTR 301
           + Y E+KCTT +   S  H+  RKL + W+Q  LV    ++ G RD  +  L + E +T 
Sbjct: 233 KHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRDDNF-MLKTVEEFTT 291

Query: 302 QELYQKFNNRN 312
            E+     N N
Sbjct: 292 SEVPLILKNNN 302

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 126/310 (40%), Gaps = 50/310 (16%)

Query: 95  EHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIVCSRHNLIDLIMAPF-- 152
           ++Y DF+         + G+ E +   E   GK  ++     I+  R     LI   F  
Sbjct: 68  DYYKDFEDRCS-----LRGLLETIESSERHKGKKINA----DIITFRGIARKLISCAFDS 118

Query: 153 -SDEDVHFNVKYINGYLHI--FPDKQFQKKDDGIYSSESNIRRI--CYTGFELEDLVTET 207
            S   V   +   NG L I   P+     K      +  NI +    +TG++ E L T +
Sbjct: 119 PSFNTVDLRIVSFNGQLFIKEVPEAVNAAKASSATEAGRNINQDLNVFTGYKFETLATLS 178

Query: 208 QP--GAPKSA--------------FYSLVQGKISKNIKLLFKAEMDCFNPAKRS------ 245
            P    P+                + S+V+  +  N KL+  AE+DC    K +      
Sbjct: 179 NPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVG-NCKLILGAEVDCIFDFKENGRDNLK 237

Query: 246 -YTEIKCTTGLKVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQ 302
            Y E+KCT  +   S  H+  RKL R W+Q  LV    ++ G +D +Y  L + E ++ +
Sbjct: 238 HYAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHY-VLKTVEEFSTE 296

Query: 303 ELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTK 362
           E+     N N  +           +++W+  L + L + I P  E   ++  +FKL    
Sbjct: 297 EVPVLLKNNNPQVGSACLE-----AIKWYGLLTEWLLKMI-PRDEDPHSQIRAFKLVFEN 350

Query: 363 QLELRLRKIE 372
              LRL +IE
Sbjct: 351 N-HLRLSEIE 359

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 128/310 (41%), Gaps = 50/310 (16%)

Query: 95  EHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIVCSRHNLIDLIMAPF-- 152
           ++Y+DF+         + G+ E +   E   GK  ++     ++  R     LI   F  
Sbjct: 68  DYYNDFEDRCS-----LRGLLETIESSERHKGKKINA----DVITFRGIARKLISCAFDS 118

Query: 153 -SDEDVHFNVKYINGYLHI--FPDKQFQKKDDGIYSSESNIRR--ICYTGFELEDLVTET 207
            S   V+  V   NG L I    +     K     S+ +NI +    +TG++ E L T +
Sbjct: 119 PSFNTVNLRVVSFNGQLFIKEVSEAIGASKTSSTVSAGNNINQDLSAFTGYKFETLATLS 178

Query: 208 QP--GAPKSA--------------FYSLVQGKISKNIKLLFKAEMDCFNPAKRS------ 245
            P    P+                + S+V+  +  + KL+  AE+DC    K +      
Sbjct: 179 NPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVG-SCKLILGAEVDCIFDFKENGRDNLK 237

Query: 246 -YTEIKCTTGLKVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQ 302
            Y E+KCT  +   S  H+  RKL R W+Q  LV    ++ G +D +Y  L + E ++ +
Sbjct: 238 HYAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHY-VLKTVEEFSTE 296

Query: 303 ELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTK 362
           E+     N N  +           +++W+  L + L + I P  E    +  +FKL    
Sbjct: 297 EVPVLLKNNNPQMGSACLE-----AIKWYGLLTEWLLKMI-PRDEDPHAQIRAFKLVFEN 350

Query: 363 QLELRLRKIE 372
              LRL +IE
Sbjct: 351 N-HLRLSEIE 359

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 81/177 (45%), Gaps = 34/177 (19%)

Query: 192 RICYTGFELEDLVTETQPGAPKS----------------AFYSLVQGKISKNIKLLFKAE 235
           R  Y+G++ E LVT  +P    S                 + S+V+  + K+ KL+  AE
Sbjct: 157 RSYYSGYKFESLVTLPKPLGEVSRTTLEKRPKKIVNNGEQYISVVRTGVGKS-KLILGAE 215

Query: 236 MDCFNPAK-------RSYTEIKCTTGLK--VKSAFHRRKLLRMWVQTSLVPSTDLLIGLR 286
           +DC    K       + YTE+KCT G+    ++    RK+ + W+Q  LV    ++ G R
Sbjct: 216 VDCVFDFKEDSGDNLKHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVNRVIYGFR 275

Query: 287 DPYYHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANI-SVQWFRHLVKRLCQTI 342
           D  +  L S E ++ QE+     N N  +       NA + +++W+    + L +TI
Sbjct: 276 DDNFI-LKSVEEFSTQEIPIILKNNNPQMT------NACVDAIKWYGAFTEWLLKTI 325

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 83/177 (46%), Gaps = 34/177 (19%)

Query: 192 RICYTGFELEDLVTETQP--GAPKSA--------------FYSLVQGKISKNIKLLFKAE 235
           R  Y+G++ E L T ++P    P+S+              F ++V+  +  N KL+  AE
Sbjct: 157 RSYYSGYKFESLATLSKPLPQTPRSSLEKRSKKICNNGDQFVTVVRSGVG-NCKLVLGAE 215

Query: 236 MDC-FNPAK------RSYTEIKCTTGLK--VKSAFHRRKLLRMWVQTSLVPSTDLLIGLR 286
           +DC F+ A+      + Y E+KCT G+    ++    RKL + W+Q  LV    ++ G R
Sbjct: 216 VDCVFDFAEDTSNNLKHYAELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINRIIYGFR 275

Query: 287 DPYYHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANI-SVQWFRHLVKRLCQTI 342
           D ++  L S E Y   E+     N N  L       NA + +V+W+    + L  +I
Sbjct: 276 DEHF-ILRSVEEYGSHEIPLLLKNNNPQLT------NACMDAVRWYGAFTEWLLSSI 325

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 88/204 (43%), Gaps = 36/204 (17%)

Query: 195 YTGFELEDLVTETQPGAPKSAFYSLVQ--GKISKN--------------IKLLFKAEMDC 238
           Y+G++ E L T +QP  P  +  +L +   KI  N               KL+  AE+DC
Sbjct: 162 YSGYKFETLATLSQP-VPYVSRATLDKRSKKICNNGDEYVTVVKTGVGSAKLVLGAEIDC 220

Query: 239 FNPAK-------RSYTEIKCTTGLKVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRDPY 289
               K       + Y E+KCTT +   +  H+  RK+ R W+Q  LV    ++ G RD  
Sbjct: 221 VFDFKEDGKDNLKHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDEN 280

Query: 290 YHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKT 349
           Y  L + E Y+  E+     N N      K N     +++W+    + L + I       
Sbjct: 281 Y-VLKTIEEYSTDEIPILLKNNN-----TKMNSMCLDAIKWYGLFTEWLLKIIP---RDQ 331

Query: 350 PTEAVSFKLTLTKQLELRLRKIET 373
           P E   +KL L     L+L +IE+
Sbjct: 332 PKEIRPYKLVLENN-HLKLSEIES 354

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 90/204 (44%), Gaps = 34/204 (16%)

Query: 194 CYTGFELEDLVTETQP--GAPKSA--------------FYSLVQGKISKNIKLLFKAEMD 237
            +TG++ E LVT + P    P+                + S+V+  +  N KL+  AE+D
Sbjct: 165 AFTGYKFETLVTLSNPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVG-NCKLILGAEVD 223

Query: 238 CFNPAKRS-------YTEIKCTTGLKVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRDP 288
           C    K +       Y E+KCT  +   S  H+  RKL R W+Q  LV    ++ G +D 
Sbjct: 224 CVFDFKENGKDNLKHYAELKCTQQVMNISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDD 283

Query: 289 YYHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEK 348
            Y  L + E ++ +E+     N N  +       +   +++W+  L + L + I P  E 
Sbjct: 284 QY-VLKTVEEFSTEEVPVLLKNNNPQM-----GSSCLEAIKWYGLLTEWLLKMI-PRDED 336

Query: 349 TPTEAVSFKLTLTKQLELRLRKIE 372
              +  +FKL       LRL +IE
Sbjct: 337 PHAQVRAFKLIFENN-HLRLSEIE 359

>KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 122/295 (41%), Gaps = 47/295 (15%)

Query: 111 MSGVFEFLNKWEGDHGKPYSSGSDFTIVCSRHNLIDLIMAPFSD---EDVHFNVKYINGY 167
           +SG+ + +  +E    K   +     I+  R  +  LI A F       V   V   NG 
Sbjct: 80  LSGLLKTIQAYEERKNKKVPAD----IITFRGIMRKLISAAFDSPKYNRVDLRVLSFNGQ 135

Query: 168 LHIFPDKQFQKKDDGIYSSESNIRRICYTGFELEDLVTETQP----------------GA 211
           L I    Q         S E    R  Y+G++ E L T ++P                  
Sbjct: 136 LFIREPNQAHPPPANTSSMEY---RSYYSGYKFETLSTISKPLPQVTRNSLEKRHKRICC 192

Query: 212 PKSAFYSLVQGKISKNIKLLFKAEMDC-FNPAKRS------YTEIKCTTGLK--VKSAFH 262
               + ++V+  +  + KL+  AE+DC F+  + S      Y E+KCT G+    ++   
Sbjct: 193 NGDQYITVVRSGVG-HCKLVLGAEVDCVFDFTEDSSDNLKHYAELKCTKGVSTFAEARAF 251

Query: 263 RRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSLLKKKYNY 322
            RK+ + W+Q  LV    ++ G RD  +  L S E Y+ QE+     N N  L       
Sbjct: 252 ERKMFKTWLQCFLVGINRVIYGFRDENFI-LRSVEEYSTQEVPLLLKNNNPQLT------ 304

Query: 323 NANI-SVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQLELRLRKIETPST 376
           NA + +V+W+  L + L  +I    E++     +++LT      L+L +IE   T
Sbjct: 305 NACMDAVRWYGALTEWLLSSIPR--EESAEHIRAYRLTFENN-HLKLVEIEKSDT 356

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 113/262 (43%), Gaps = 39/262 (14%)

Query: 137 IVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDDGIYSSESNIRRICYT 196
           IV  R  +  LIM+ F + +  +NV  ++  + +F  + F K    + +    +  + YT
Sbjct: 101 IVTFRGIIRKLIMSSF-ETNSKYNV--VDLRIVLFDGQLFIKDVSTVNAKPEKVTPLEYT 157

Query: 197 GFELEDLVTETQP----------GAPK------SAFYSLVQGKISKNIKLLFKAEMDCFN 240
           G++ E L T  +P            PK        F S+V+  +  N K+L  AE+D   
Sbjct: 158 GYKFEALCTLPEPLPYVSRTKLNKRPKKIVSHGDEFVSVVKTGVG-NCKILLGAEVDAIF 216

Query: 241 PAK-------RSYTEIKCTTGLKVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRDPYYH 291
             K       + Y E+KCT  +   +   +   KL + W+Q  L+  T +  G RD  Y 
Sbjct: 217 DFKEKGKDNLQHYIELKCTAAINNINDTKKFENKLFKTWIQCFLIGITRITYGFRDEQY- 275

Query: 292 QLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPT 351
            L + E +   ++   F N N +L     N     +++W+    + L + I P  + + T
Sbjct: 276 LLKTIEEFATSDIPLIFKNHNPTLASNCVN-----AIKWYGVFTEWLMKMI-PTEDTSVT 329

Query: 352 EAVSFKLTLTKQLELRLRKIET 373
           +A      + +   LRL +IE+
Sbjct: 330 KAYRL---VCENNHLRLTEIES 348

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 117/285 (41%), Gaps = 49/285 (17%)

Query: 124 DHGKPYSSGSDFTIVCSRHNLIDLIMAPFSDE----DVHFNVKYINGYLHIFPDKQFQKK 179
           D  K + S  +  ++  R  L  LIM  +        ++F V + +  + I   K+  +K
Sbjct: 91  DVEKKHDSKLNVNVITFRGILRKLIMVAYEHNPKFNKINFRVVFFDKQVFI---KEINEK 147

Query: 180 DDGIYSSESNIRRICYTGFELEDLVTETQPGA----------------PKSAFYSLVQGK 223
           +D   + + N     YTG++ E L    +P A                    + S+V+  
Sbjct: 148 EDISNAIDVN----SYTGYKFEALTLLNEPIAFTERDSLDSRADACVSNGDEYVSVVKTG 203

Query: 224 ISKNIKLLFKAEMDCFNPAK-------RSYTEIKCTTGLKVKSAFH--RRKLLRMWVQTS 274
           I K+ ++L   E+D     K       + Y E+KCT  L          +KL + W+Q  
Sbjct: 204 IGKH-RVLMGGEVDGIYDFKEDGADNLKHYLELKCTRSLSSYQDIENFEKKLFKTWLQCF 262

Query: 275 LVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHL 334
           L+    +  G RD  Y+ L+S E Y  +++ + F NR +             ++QW+  +
Sbjct: 263 LIGIPRITYGFRDRSYN-LTSIEEYLTEDVPKLFTNRGVKA-------QCMDAIQWYGEI 314

Query: 335 VKRLCQTITPYVEKTPTEAVSFKLTLTKQLELRLRKIETPSTAKE 379
           +  L  T+  ++E    E   FKL  +   EL L  +E P+   E
Sbjct: 315 IGWLYDTLA-HLETDANEIRPFKLLFSGS-ELDL--VEIPAKDPE 355

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 89/203 (43%), Gaps = 34/203 (16%)

Query: 195 YTGFELEDLVTETQP--GAPKSA--------------FYSLVQGKISKNIKLLFKAEMDC 238
           +TG++ E L T + P    P+                + S+V+  +  N KL+  AE+DC
Sbjct: 166 FTGYKFETLATLSNPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVG-NCKLILGAEVDC 224

Query: 239 FNPAKRS-------YTEIKCTTGLKVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRDPY 289
               K +       Y E+KCT  +   S  H+  RKL R W+Q  LV    ++ G +D +
Sbjct: 225 VFDFKENGKDNLKHYAELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

Query: 290 YHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKT 349
           Y  L + E ++ +E+     N N      +   +   +++W+  L + L + + P  E  
Sbjct: 285 Y-VLKTVEEFSTEEVPVLLKNNN-----PQVGSSCLEAIKWYGLLTEWLLKMV-PREEDP 337

Query: 350 PTEAVSFKLTLTKQLELRLRKIE 372
                +FKL       L+L +IE
Sbjct: 338 HARIRAFKLVFENN-HLKLSEIE 359

>ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} similar
           to uniprot|P53063 Saccharomyces cerevisiae YGL246C RAI1
           Nuclear protein that binds to and stabilizes the
           exoribonuclease Rat1p required for pre-rRNA processing
          Length = 380

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 77/173 (44%), Gaps = 32/173 (18%)

Query: 195 YTGFELEDLVTETQP----------GAPK------SAFYSLVQGKISKNIKLLFKAEMDC 238
           Y+G++ E L T  QP            PK        + ++V+  +  N+K++  AE+DC
Sbjct: 158 YSGYKFETLATLPQPLPLVSRTTLDKRPKKLVNTGEEYITVVKTGVG-NVKVILGAEVDC 216

Query: 239 FNPAK-------RSYTEIKCTTGLKVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRDPY 289
               K       + Y E+KC+  +   +   +  RK+ R W+Q  LV    ++ G RD  
Sbjct: 217 IFDFKEEGKDNLKHYAELKCSADVSTPADARKFERKVFRTWLQCFLVGIPRIIYGFRDN- 275

Query: 290 YHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTI 342
            + L + E YT  E+     + N ++     N +   +++W+  L + L + I
Sbjct: 276 NNVLKTVEEYTTTEVPVLLKSNNPAM-----NSSCLDAIKWYGTLTEWLLKMI 323

>KNAG0D02970 Chr4 (535257..536417) [1161 bp, 386 aa] {ON} Anc_3.570
           YGL246C
          Length = 386

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 62/136 (45%), Gaps = 10/136 (7%)

Query: 246 YTEIKCTTGLK--VKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQE 303
           Y E+KCT  ++    +A    K+ R W+Q  LV    ++ G R+  Y  L + E YT  +
Sbjct: 236 YLELKCTMDIRNEADAAAFEGKMFRTWLQCFLVGVPRIIYGFRNRQYL-LQTVEEYTTAD 294

Query: 304 LYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQ 363
           + Q   + N  L     +     +++W+    + L Q I     +  T A  ++L    +
Sbjct: 295 IPQMVGSHNPQLHSAFRD-----AIRWYGRFTEWLLQVIPRGDRQATTRA--YRLVSDPR 347

Query: 364 LELRLRKIETPSTAKE 379
           +  +L+ IE PS + E
Sbjct: 348 VSGKLQLIEVPSGSDE 363

>TBLA0E00180 Chr5 complement(23463..24599) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 99/236 (41%), Gaps = 45/236 (19%)

Query: 137 IVCSRHNLIDLIMAPFSDEDV-HFNVKYINGYLHIFPDKQFQKKDDGIYSSESNIRRICY 195
           I+  R  +  LI A F  E   H +++ +     IF  +  Q + + +  ++ N     Y
Sbjct: 101 IITFRGIIRKLISAAFDSEQFNHVDLRVLVFDGQIFIKEIPQDEPELVGKAKLN----AY 156

Query: 196 TGFELEDLVTETQP----------GAPK------SAFYSLVQGKISKNIKLLFKAEMDCF 239
           +G++ E L T  QP            PK        + S+V+  IS N +L+  AE+DC 
Sbjct: 157 SGYKFETLATIPQPLPFVSRELLEKRPKKIVTTGDEYVSVVKTGIS-NCRLVLGAEVDCI 215

Query: 240 NPAKRS--------YTEIKCTTGLKV--KSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPY 289
              K S        Y E+KCT  +    ++    +K+ R W+Q  LV    ++ G RD  
Sbjct: 216 FDFKESSKTNNIYHYAELKCTQQICTAQQARGFDKKIFRTWLQCFLVGIPRIIYGFRDD- 274

Query: 290 YHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANI---SVQWFRHLVKRLCQTI 342
              L S E         +F+   + +L K     AN    +++W+  L + L  TI
Sbjct: 275 NMVLKSVE---------EFSTEEIPILLKDDPAWANACLDAIKWYGALTQWLLDTI 321

>TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 100/235 (42%), Gaps = 41/235 (17%)

Query: 137 IVCSRHNLIDLIMAPFSD---EDVHFNVKYINGYLHIFPDKQFQKKDDGI-YSSESNIRR 192
           I+  R  +  LI A F       V   V   +G + I   +    KD+ +  ++ES  R 
Sbjct: 101 IITFRGVIRRLISAAFDSPKFNKVDLRVVAFDGQIFI---RDVASKDEELRMTTES--RN 155

Query: 193 ICYTGFELEDLVTETQP----------GAPK------SAFYSLVQGKISKNIKLLFKAEM 236
             YTG++ E + T +QP            PK        + ++V+  +  N KL+  AE+
Sbjct: 156 AWYTGYKFETVATLSQPLPYVDRETVEKRPKKLVNTGDEYITVVRTGVG-NSKLILGAEV 214

Query: 237 DCFNPAK-------RSYTEIKCTTGLKVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRD 287
           DC    K       + Y E+KC+  +  ++   +  +K+ + W+Q  LV    ++ G RD
Sbjct: 215 DCIFDFKEEGKDNLKHYAELKCSAMVSTQADARKFEKKIFKTWLQCFLVGIPRIIYGFRD 274

Query: 288 PYYHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTI 342
                L + E +   E+     + N ++     +     +++W+  LV+ L  TI
Sbjct: 275 DNCI-LKTVEEFAADEVPIILKSNNPAMSTACLD-----AIKWYGTLVEWLLNTI 323

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 96/231 (41%), Gaps = 43/231 (18%)

Query: 111 MSGVFEFLNKWEGDHGKPYSSGSDFTIVCSRHNLIDLI---MAPFSDEDVHFNVKYINGY 167
           + G+ + L ++E    K     S+  I+  R  +  LI   M P +   V   +   +G 
Sbjct: 79  LKGLLDTLMEYEKKKNKK----SNVDIITFRGIMSKLIRASMEPPNFNKVDLRIVSYDGQ 134

Query: 168 LHIFPDKQFQKKDDGIYSSESNIRRIC---------YTGFELEDLVTETQP--------- 209
           L I     +    +   SS  N R+           YTG++ E + T  +P         
Sbjct: 135 LFIKDVSDYNAATNESNSSGVNSRQQAGTSRQQIDTYTGYKFEGIATLDKPLPYVEREVI 194

Query: 210 -GAPK------SAFYSLVQGKISKNIKLLFKAEMDCFNPAK-------RSYTEIKCTTGL 255
              P+        + ++V+  + +  K++  AE+DC    K       + YTE+KC++ +
Sbjct: 195 EKRPRKILNNGDEYITVVRTGVGE-CKVVLGAEIDCIFDFKEEGKDNLKHYTELKCSSQI 253

Query: 256 KVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQEL 304
              +   R  +K+ R W+Q  LV    ++ G RD  Y  L + E ++ +E+
Sbjct: 254 STTNDVRRFEKKMFRAWLQCFLVGVPRVIYGFRDDQY-MLKTVEEFSTEEI 303

>Ecym_2600 Chr2 (1167583..1168737) [1155 bp, 384 aa] {ON} similar to
           Ashbya gossypii AFR263C AFR262C
          Length = 384

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 59/135 (43%), Gaps = 27/135 (20%)

Query: 195 YTGFELEDLVT-------------ETQPGAPKS---AFYSLVQGKISKNIKLLFKAEMDC 238
           Y+G++ E L T             E++P    S    F ++V+  I K  KL+  AE+DC
Sbjct: 160 YSGYKFETLTTLSKSFSETPRQVLESRPKKIVSNGEQFVTVVRTGIGK-CKLILGAEVDC 218

Query: 239 FNPAK-------RSYTEIKCTTGLK--VKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPY 289
               K       + Y E+KC+  +     +     KL + WVQ  LV    ++ G RD  
Sbjct: 219 VFDFKEVGSDNLKHYAELKCSKAVNTVADARTFELKLFKTWVQCFLVGINRIIYGFRDEN 278

Query: 290 YHQLSSFECYTRQEL 304
              L S E ++ QE+
Sbjct: 279 C-ILKSVEEFSTQEI 292

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 99/240 (41%), Gaps = 48/240 (20%)

Query: 95  EHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIVCSRHNLIDLIMAPFSD 154
           +HY +FQ   P  L+   G+ + +  +E    K         I+  R  +  LI + F  
Sbjct: 68  DHYKNFQ--DPGTLK---GLLKTIQAYEEIKQKKVK----VDIITFRGVIRKLISSAFDS 118

Query: 155 ---EDVHFNVKYING--YLHIFPDKQFQKKDDGIYSSESNIRRICYTGFELEDLVTETQP 209
                V+  +   +G  ++   P K+ + KD  I           Y+G++ E+LVT ++P
Sbjct: 119 PKFNQVNLRIVLFDGQIFMKEVPRKEEEPKDGKIAPP-------VYSGYKFENLVTVSKP 171

Query: 210 ----------GAPK------SAFYSLVQGKISKNIKLLFKAEMDCFNPAK-------RSY 246
                       PK        + S+V+  +  N KL+  AE+D     K       + Y
Sbjct: 172 IPYTSRTTIEKRPKKIVSNGDEYISVVRTGVG-NCKLMLGAEVDAIFDFKEEDKDNLKHY 230

Query: 247 TEIKCTTGLKVKSAFHR--RKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQEL 304
            E+K T  +   S   +  +K+ + W+Q  LV    ++ G RD  +  L S E ++  E+
Sbjct: 231 VELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPRIIYGFRDNNFI-LKSVEEFSTDEV 289

>AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 376

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 112/272 (41%), Gaps = 44/272 (16%)

Query: 97  YDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIVCSRHNLIDLIMAPFSDE- 155
           + D Q    +    + G+ + L ++E    K  ++     I+  R  +  LI   F    
Sbjct: 66  FQDEQAEAEDDTGSLHGLLQTLMEYERRKSKKVNA----DIIAFRGQVKRLIHCAFGGHA 121

Query: 156 -DVHFNVKYINGYLHIFPDKQFQKKDDGIYSSESNIRRICYTGFELEDLVTETQPGA--P 212
            DV   V   +G L I   ++  K +      ES      Y+G++ E +    +P A  P
Sbjct: 122 TDVDMYVMSFDGQLFIRAARK--KLEFPTSPRESWAYLAYYSGYKFERMALLDRPVAETP 179

Query: 213 KSAFYS--------------LVQGKISKNIKLLFKAEMDCF----NPAK---RSYTEIKC 251
           +    S              +V+  + ++ KL+  AE+D       P     + Y E+K 
Sbjct: 180 REVLESRGKQVVRNGPQYKTVVRTGVGEH-KLVLGAEVDGIFDFREPTGDNLKHYVELKV 238

Query: 252 TTGLK-VKSAFH-RRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFN 309
              ++ +K A +  +KL  +W+Q  LV    ++IG RD  +  L S E ++  E+     
Sbjct: 239 AKKVQTLKDATNFEQKLFSVWLQCFLVGINRVIIGFRDEKF-VLKSVEEFSTSEIPL--- 294

Query: 310 NRNLSLLKKKYNYNANI-SVQWFRHLVKRLCQ 340
                LLK     NA + +++W+  L K LC+
Sbjct: 295 -----LLKSTGLRNACVDAIKWYGALTKWLCE 321

>KLTH0B08756g Chr2 complement(708976..712047) [3072 bp, 1023 aa]
           {ON} similar to uniprot|P07276 Saccharomyces cerevisiae
           YGR258C RAD2 Single-stranded DNA endonuclease cleaves
           single-stranded DNA during nucleotide excision repair to
           excise damaged DNA subunit of Nucleotide Excision Repair
           Factor 3 (NEF3) homolog of human XPG protein
          Length = 1023

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%)

Query: 224 ISKNIKLLFKAEMDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRM 269
           I +NI  L   ++D  NPA R + E+  +T   + SA   +  LRM
Sbjct: 167 IMENIDELDGVDLDAVNPASREFEELPKSTQYMILSALRLKSRLRM 212

>AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 775

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 63/153 (41%), Gaps = 18/153 (11%)

Query: 229 KLLFKAEMDCFNPAKRSYTE-IKCTTGLKV--KSAFHRRKLLRMWVQTSLVPSTDLLIGL 285
           KL+  AE+D     +    + +K    LKV  K+     KL   W+Q  LV    ++IG 
Sbjct: 617 KLVLGAEIDGIIDFREPTGDNLKHYVELKVCQKNRNFSEKLFSSWLQCFLVGINRVIIGF 676

Query: 286 RDPYYHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANI-SVQWFRHLVKRLCQTITP 344
           RD  +  L S E ++  E+          LLK     N  + +++W+  L K LC+    
Sbjct: 677 RDEKF-VLKSVEEFSTSEIPH--------LLKGTEYSNVCVDAIEWYGALTKWLCE---- 723

Query: 345 YVEKTPTEAVSFKLTLTKQLELRLRKIETPSTA 377
            + + P +             LRLR++     A
Sbjct: 724 -LPRGPEDDFKLYRLSCSHGALRLRQLHDEDLA 755

>ABR165W Chr2 (711762..713681) [1920 bp, 639 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER022W (SRB4)
          Length = 639

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 124 DHGKPYSSGSDFTIVCSRHNL----IDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKK 179
           D G  Y    D  +   RHN+    ++L+    S E+VH     +  ++ +    + +++
Sbjct: 309 DSGSLYKQ--DRGVAVLRHNMDLNKLELVPISNSKEEVHITANSVERFMRVHIYTKIEEE 366

Query: 180 DDGIYSSESNI 190
           DD I S ES+I
Sbjct: 367 DDYILSGESSI 377

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,735,868
Number of extensions: 2143784
Number of successful extensions: 5670
Number of sequences better than 10.0: 50
Number of HSP's gapped: 5801
Number of HSP's successfully gapped: 50
Length of query: 390
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 279
Effective length of database: 40,753,473
Effective search space: 11370218967
Effective search space used: 11370218967
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)