Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F15972g5.438ON1031035502e-74
Kwal_55.214145.438ON1191034307e-56
SAKL0G02618g5.438ON1041033821e-48
CAGL0A02882g5.438ON1041033793e-48
NCAS0F034105.438ON1061033691e-46
TDEL0D026305.438ON1021033481e-43
KLLA0E02267g5.438ON1031033463e-43
ZYRO0F10120g5.438ON1051013463e-43
KNAG0C048805.438ON1041033464e-43
Kpol_1016.35.438ON971033342e-41
Ecym_45095.438ON1031033247e-40
ACL169W5.438ON1031033152e-38
NDAI0B057005.438ON1041033031e-36
Kpol_1016.3asingletonON971032908e-35
TPHA0C00950singletonON991032041e-21
KAFR0D02490singletonON107951911e-19
TBLA0C05870singletonON1001011692e-16
KAFR0D02500singletonON112901667e-16
KAFR0D02400singletonON114901521e-13
ZYRO0C03916g8.381ON147129597.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F15972g
         (103 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   216   2e-74
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   170   7e-56
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   151   1e-48
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   150   3e-48
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     146   1e-46
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   138   1e-43
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   137   3e-43
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   137   3e-43
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   137   4e-43
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   133   2e-41
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   129   7e-40
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   125   2e-38
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   121   1e-36
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   116   8e-35
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                 83   1e-21
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      78   1e-19
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    70   2e-16
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      69   7e-16
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                63   1e-13
ZYRO0C03916g Chr3 (307237..311652) [4416 bp, 1471 aa] {ON} simil...    27   7.9  

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  216 bits (550), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
           QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  170 bits (430), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 78/103 (75%), Positives = 91/103 (88%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEWCVIV+DKKGSDRS  RPAHL+G+ +  E+G LVCAGAIY +V P+GK +NFAGSHL
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
           QI A+TKE+AL++VK D+FAKEGIWDLENIIIYPFGCAVRQ K
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  151 bits (382), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 69/103 (66%), Positives = 85/103 (82%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEWCV+V+DK  +DRS  RPAHL G+    E+G LVCAGAI++E+  +GKP NFAGS L
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
            I A++KE+AL VVKND+FAKEGIWDLENI+I+PFGCAVR+ K
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEK 103

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  150 bits (379), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 80/103 (77%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEWCVIV+DK GSDRS CRP HL G+    E G LVCAGAIY+E    G    FAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
           QI A+TKE+AL++V ND+FAK GIWDLENIIIY FGCAVRQ K
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  146 bits (369), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 81/103 (78%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEWCVIV+DK GSDRSA RP HL  +    E+G LVCAGAIY+E   +G+   FAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
           QI A+TKE+AL +V NDIFAKEGIWD +NIIIY FGCAVR+ K
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  138 bits (348), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 80/103 (77%), Gaps = 2/103 (1%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEW VIV+DK   DRSA RPAHL G+    E+G LVCAGAIY+E    G    FAGSHL
Sbjct: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
           QI A+TKE+AL+VVK DIFAKEG+WDL+NIIIY FGCAVR+ K
Sbjct: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEK 101

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  137 bits (346), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 81/103 (78%), Gaps = 1/103 (0%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEW VIV+DK GSDRSACRP HL G+    E G +V AGAIY +V  DGKP NFAGSHL
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVV-DGKPANFAGSHL 59

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
            I A++K++ ++++KND+FAK  IWD++N +IYPFGCAVR+ K
Sbjct: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEK 102

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  137 bits (346), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 2/101 (1%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEW VI FDK  +DRSA R  HL G+  Q E G LVCAGAIY+E    G+P  FAGSHL
Sbjct: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQ 101
           Q+ A+TKE+A+++VK+DIFAKEG+WDL+N+I+Y FGCA+RQ
Sbjct: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  137 bits (346), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 78/103 (75%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEWC +V+DK GSDRS  RP HL  + +  ++G LVCAGAIY+E    G    FAGSHL
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
           QI A+TKE+AL+V+  D+FAKEGIWDL NII+Y FGCAVR+ K
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPK 103

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  133 bits (334), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (75%), Gaps = 6/103 (5%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEWCVI+ DKKGSDRS  RP HL G+    E+G L CAGAIY++ G      +FAGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYNDDG------SFAGSHL 54

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
           QI A+TKE AL+VVK D+FA  GIWDL++IIIY FGCAVRQ K
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  129 bits (324), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 81/103 (78%), Gaps = 1/103 (0%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEWCV V+DK GSDRS  R  HLE + +  ++G +V AGAIY ++  DGKP  FAGSHL
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDL-VDGKPGGFAGSHL 59

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
            + A+T+E+ ++++K DI+AKEG+WD++NI+I+PFGCAVR+ K
Sbjct: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEK 102

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  125 bits (315), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEWC I++DK G DRS  R  HL  + +  E+G LV AGAIY EV  DG+P+ FAGS L
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEV-VDGRPSQFAGSQL 59

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
            + A+++E+AL ++++D FAK G+WD+EN+++YPFGCAVR+ K
Sbjct: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEK 102

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  121 bits (303), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 73/103 (70%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           MVEWCVI+ DKKGSDRSA    H  G+    E+G +VC GAIY+E   +G     AGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
           Q+ A+TKE+ +++VK DIFAKEGIWD++N IIY F  A+R  K
Sbjct: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPK 103

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  116 bits (290), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 72/103 (69%), Gaps = 6/103 (5%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           M EWC+I+ DKKGS+RS     H  G++   E+G L C GAIY++ G      + AGSHL
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYNDDG------SVAGSHL 54

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103
           QI A+TKE AL+VVK D+FA  GIWDL++I+IY F CAVRQ K
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score = 83.2 bits (204), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 65/103 (63%), Gaps = 8/103 (7%)

Query: 1   MVEWCVIVFDKKGSD--RSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGS 58
           M E+ V++ D  G++  R    P H   +    + G +VC GA+++E   +G P    GS
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNE---EGSPV---GS 54

Query: 59  HLQISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQ 101
           H+QI A+++E  L+++K D+FA+E +WDLE+ IIY F CAVR+
Sbjct: 55  HIQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRK 97

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 78.2 bits (191), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 59/95 (62%), Gaps = 6/95 (6%)

Query: 1  MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
          M EW V V DK  +DR+     HL  +   +EK  LV AGA+   +G +GK     GS  
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGAL---IGDNGKEV---GSSF 54

Query: 61 QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPF 95
          Q+ A +KEDA+ V+KNDIFAKEG+++L++ + Y F
Sbjct: 55 QVVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 69.7 bits (169), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 52/101 (51%), Gaps = 6/101 (5%)

Query: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
           M EW V + D   SDR+     H++ +      G L C GA+  + G      N  GSH 
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDDNG------NMIGSHF 54

Query: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQ 101
           ++   TKE+A++++  D F K G+WD+ +I I  F C  R+
Sbjct: 55  ELKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHRE 95

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 68.6 bits (166), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 58/90 (64%), Gaps = 6/90 (6%)

Query: 1  MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
          M EW V + D +G+DR+   P H++ +   +++  LV AGA+     P+GK T   G  L
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGAL---TTPEGKET---GGIL 54

Query: 61 QISANTKEDALQVVKNDIFAKEGIWDLENI 90
           I+A TKE+A++VVK D+FA++GI+ ++ I
Sbjct: 55 IIAAKTKEEAIEVVKRDVFARKGIFKMDTI 84

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 63.2 bits (152), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 54/90 (60%), Gaps = 6/90 (6%)

Query: 1  MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60
          M EW V V D K  DR+   P H+  +    + G +V AGA+     P+GK     G   
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGAL---TTPEGKEI---GGMF 54

Query: 61 QISANTKEDALQVVKNDIFAKEGIWDLENI 90
           ++A TKE+A+++VK D+FA++GI++++++
Sbjct: 55 IVTAKTKEEAIEIVKRDVFARKGIFNMDSV 84

>ZYRO0C03916g Chr3 (307237..311652) [4416 bp, 1471 aa] {ON} similar to
            uniprot|Q04002 Saccharomyces cerevisiae YDR180W SCC2
            Sister chromatid cohesion protein
          Length = 1471

 Score = 27.3 bits (59), Expect = 7.9,   Method: Composition-based stats.
 Identities = 9/29 (31%), Positives = 22/29 (75%)

Query: 68   EDALQVVKNDIFAKEGIWDLENIIIYPFG 96
            ED+++ +KN I A+  +++++N+ I+ +G
Sbjct: 1390 EDSVENIKNSIIAEMSLFEVKNLFIHLYG 1418

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,098,456
Number of extensions: 405175
Number of successful extensions: 879
Number of sequences better than 10.0: 23
Number of HSP's gapped: 867
Number of HSP's successfully gapped: 23
Length of query: 103
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 29
Effective length of database: 44,996,115
Effective search space: 1304887335
Effective search space used: 1304887335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)