Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F15950g5.439ON1261266638e-91
TDEL0D026205.439ON1261265804e-78
SAKL0G02640g5.439ON1261265786e-78
Smik_15.2995.439ON1261265771e-77
YOR122C (PFY1)5.439ON1261265771e-77
CAGL0I01078g5.439ON1261265761e-77
NDAI0C015805.439ON1261265752e-77
Skud_15.2845.439ON1261265734e-77
Suva_8.1745.439ON1261265735e-77
Kpol_1062.275.439ON1261265631e-75
TPHA0E017405.439ON1261265622e-75
Ecym_45105.439ON1261265613e-75
KNAG0B042205.439ON1261265613e-75
ACL168C5.439ON1261265562e-74
NCAS0H020705.439ON1261265518e-74
KAFR0D050405.439ON1261265519e-74
KLLA0E02289g5.439ON1261265492e-73
ZYRO0F10142g5.439ON1261265466e-73
TBLA0A065005.439ON1191265134e-68
Kwal_55.214135.439ON58583011e-36
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F15950g
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   259   8e-91
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   228   4e-78
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   227   6e-78
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   226   1e-77
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   226   1e-77
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   226   1e-77
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   226   2e-77
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   225   4e-77
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   225   5e-77
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   221   1e-75
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   221   2e-75
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   220   3e-75
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   220   3e-75
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   218   2e-74
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   216   8e-74
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   216   9e-74
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   216   2e-73
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   214   6e-73
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   202   4e-68
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   120   1e-36

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  259 bits (663), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LISVSY
Sbjct: 121 LISVSY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  228 bits (580), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLLGTGK+DKA IYSRAGDS+WA+SGGL+L  NEI EIAQGF++P GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQTIL+ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LISV Y
Sbjct: 121 LISVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  227 bits (578), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLLGTGK+DKA IYSRAGD++WA SGGL+L   EI EIAQGF+NP+GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+Q QKFMLIRADDRSIYGRHDAEGV+CVRTKQTIL+ HYP GVQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LISV Y
Sbjct: 121 LISVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  226 bits (577), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNL+GTGK+DKA IYSRAGD++WA SGGLSL  NEIGEI QGF+NP+GLQS G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQT+++ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LI V Y
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  226 bits (577), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNL+GTGK+DKA IYSRAGD++WA SGGLSL  NEIGEI QGF+NP+GLQS G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQT+++ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LI V Y
Sbjct: 121 LIGVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  226 bits (576), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLL TGK+DKA IYS+AGD++WA SGGLSL  NEI EI QGF+NP+GLQS G
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQT+L+ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LISV Y
Sbjct: 121 LISVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 112/126 (88%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLL TGK+DKA IYSRAGDS+WA SGG  L  NEI EI QGF+NP+GLQS G
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQT+LV HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LISV Y
Sbjct: 121 LISVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  225 bits (573), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNL+GTGK+DKA IYSRAGD++WA SGGLSL  NEI E+ QGF+NP+GLQS G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGVICVRTKQT++++HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LI V Y
Sbjct: 121 LIGVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  225 bits (573), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNL+GTGK+DKA I+SRAGD++WA SGGLSL  NEIGEI QGF+NP GLQS G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGVICVRTKQT+++ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LI V Y
Sbjct: 121 LIGVQY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  221 bits (563), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLL TGKIDKA +YSRAGD++WA+SGGL+L   EI  IAQGF++PS LQS G
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFM++RADDRSIYGRHDAEGV+CVRTKQTILV HYPA VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LISV Y
Sbjct: 121 LISVQY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  221 bits (562), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLL TGK+DKAA+YSRAGD+ WAASGGLSL   E  EIA+GF++PSGLQ+TG
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQTI++ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LI V Y
Sbjct: 121 LIGVQY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  220 bits (561), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNL+ TGK+DKA IYSRAGD++WA+SGG+SL  NEI EI+QGF+N  GLQS G
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+Q QKFML+RADDRSIYGRH+AEG+I VRTKQTIL+ HYPAGVQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LISV Y
Sbjct: 121 LISVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  220 bits (561), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 111/126 (88%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLLGTGK+DKA IYSRAGDS+WA SGGL+L  NEI  I  GF+N +GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFM +RADDRSIYGRHDAEGVICVRTKQTILV HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LISV Y
Sbjct: 121 LISVQY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  218 bits (556), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLL TGK+DKA IYSRAGD++WA+SGGL+L  +EI EI+QGF+N +GLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RAD+RSIYGRH+AEGV+ VRTKQTIL+ HYPAGVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LISV Y
Sbjct: 121 LISVQY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  216 bits (551), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 99/126 (78%), Positives = 112/126 (88%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQA TDNLL TGK+D+A +YSRAGDS+WA SGGL L  NEI EIA+GF+NP+GLQS G
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADD+SIYGRHDAEG++CVRT QTIL+ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LISV Y
Sbjct: 121 LISVKY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  216 bits (551), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 99/126 (78%), Positives = 111/126 (88%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLL T K+D+A IYSRAGD+ WA SGG++L  NEI EIAQGF+N +GLQS G
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQTI++ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LI V Y
Sbjct: 121 LIGVQY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  216 bits (549), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 113/126 (89%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYTDNLL TGKIDK+ IYSRAGD++WA+SGGL L   EI EIA+GF+NPSGLQS G
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFMLI+ADDRSIYGRH+AEG++ VRTKQTIL+ HYP GVQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LISVSY 126
           LISV Y
Sbjct: 121 LISVQY 126

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  214 bits (546), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQAYT+NLLGTGKIDKAAIYSRAGDSLWA+SGGL+    EIG+IA GF+ PSGLQSTG
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           L +QGQKFML+RADDRSIY RHDAEG+ CVRTKQTI++ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVSY 126
           LI   Y
Sbjct: 121 LIGAQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  202 bits (513), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (84%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60
           MSWQA       TGK+DKA IYSRAGDS+WA+SGGL L  NEI EIA+GF+NPSGLQS G
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120
           LH+Q QKFML+RADDRSIYGRHDAEG++CVRTKQTI++ HYP  VQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LISVSY 126
           LI V Y
Sbjct: 114 LIGVQY 119

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  120 bits (301), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%)

Query: 69  MLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 126
           MLIRADDRSIYGRHDAEGV+CVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,608,988
Number of extensions: 446053
Number of successful extensions: 726
Number of sequences better than 10.0: 22
Number of HSP's gapped: 726
Number of HSP's successfully gapped: 22
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)