Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F15928g5.440ON42342318480.0
Kwal_55.214085.440ON43642413011e-178
SAKL0G02662g5.440ON4794069171e-119
KLLA0E02311g5.440ON4174108501e-110
NDAI0C015905.440ON4704078431e-108
Ecym_45115.440ON4612187981e-101
Kpol_1062.265.440ON4573847941e-101
KAFR0D050505.440ON4192137901e-101
Skud_15.2855.440ON4873677901e-100
NCAS0H020805.440ON4354357793e-99
TDEL0D026105.440ON4404147733e-98
ACL167C5.440ON4392627663e-97
Suva_8.1755.440ON4533667571e-95
Smik_15.3005.440ON4633667502e-94
YOR123C (LEO1)5.440ON4643677432e-93
CAGL0K10230g5.440ON4462767309e-92
TPHA0E017305.440ON4693867311e-91
ZYRO0F10164g5.440ON4232167104e-89
KNAG0B042105.440ON4632237065e-88
TBLA0A064905.440ON4284306611e-81
KNAG0D024408.91ON21885800.15
TDEL0E048505.145ON73298695.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F15928g
         (423 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   716   0.0  
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   505   e-178
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   357   e-119
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   332   e-110
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   329   e-108
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   311   e-101
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   310   e-101
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   308   e-101
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   308   e-100
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   304   3e-99
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   302   3e-98
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   299   3e-97
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   296   1e-95
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   293   2e-94
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   290   2e-93
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   285   9e-92
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   286   1e-91
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   278   4e-89
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   276   5e-88
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   259   1e-81
KNAG0D02440 Chr4 (433064..433720) [657 bp, 218 aa] {ON} Anc_8.91...    35   0.15 
TDEL0E04850 Chr5 complement(903404..905602) [2199 bp, 732 aa] {O...    31   5.4  

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/423 (84%), Positives = 359/423 (84%)

Query: 1   MSDQGEGTVALENSQNELSEKQSPNVEADGEEMDDLFGDDSDQETGSGPGEQEPHSPNSA 60
           MSDQGEGTVALENSQNELSEKQSPNVEADGEEMDDLFGDDSDQETGSGPGEQEPHSPNSA
Sbjct: 1   MSDQGEGTVALENSQNELSEKQSPNVEADGEEMDDLFGDDSDQETGSGPGEQEPHSPNSA 60

Query: 61  NEEEDDEQAMYNRKFYGDKGEDSNDEGSQEFREADIDIMKHIVPYSTEPSQGDKTIYYTK 120
           NEEEDDEQAMYNRKFYGDKGEDSNDEGSQEFREADIDIMKHIVPYSTEPSQGDKTIYYTK
Sbjct: 61  NEEEDDEQAMYNRKFYGDKGEDSNDEGSQEFREADIDIMKHIVPYSTEPSQGDKTIYYTK 120

Query: 121 VPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKE 180
           VPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKE
Sbjct: 121 VPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKE 180

Query: 181 SNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIP 240
           SNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIP
Sbjct: 181 SNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIP 240

Query: 241 TSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXX 300
           TSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDP           G             
Sbjct: 241 TSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLRE 300

Query: 301 XXXXXGMDSPAPTSKPRSASRPGYSQTRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXXX 360
                GMDSPAPTSKPRSASRPGYSQTRYDEYEDDGFMV                     
Sbjct: 301 QQEREGMDSPAPTSKPRSASRPGYSQTRYDEYEDDGFMVDDEENESDGGVGGDGNEDEED 360

Query: 361 XXXXXXXXXXXXXXAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDE 420
                         AERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDE
Sbjct: 361 LLDDEEEEDDDDLNAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDE 420

Query: 421 DDE 423
           DDE
Sbjct: 421 DDE 423

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  505 bits (1301), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 264/424 (62%), Positives = 301/424 (70%), Gaps = 2/424 (0%)

Query: 1   MSDQGEGTVALENSQNELSEKQSPNVEADGEEMDDLFGDDSDQETGSGPGEQEPHSPNSA 60
           MSD         +S+ EL ++      A+GE+MDDLFGD+SD          +       
Sbjct: 14  MSDSERQAEVPRDSEEELRKETPAQDGAEGEDMDDLFGDESDNNIDQEDDGTQAREDGEG 73

Query: 61  NEEEDDEQAMYNRKFYGDKGEDSNDEGSQ-EFREADIDIMKHIVPYSTEPSQGDKTIYYT 119
            E+E+DEQAMYNRKFYGD  EDSNDEGSQ EFREAD+D++KH+VPYST PS+GDKTI+Y 
Sbjct: 74  EEDEEDEQAMYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYSTVPSEGDKTIFYA 133

Query: 120 KVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFK 179
           KVPQFLTIDPIPFDPPAFQ+KIE+R AQ +S EDQIDDRLIEENTVRWRYSRD  Q+VFK
Sbjct: 134 KVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFK 193

Query: 180 ESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFI 239
           ESNA IVQWSDGT+SLRLGDE+TDVLINDTEDTYL VSHDQQELIQSVKGGEVTKNMIFI
Sbjct: 194 ESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFI 253

Query: 240 PTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXX 299
           PTSTNSKSHQRLSKAVARKEQ+EHHGPNTYILRVDP           G            
Sbjct: 254 PTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLR 313

Query: 300 XXXXXXGMDSPAPTSKPRSASRPGYSQTRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXX 359
                 G+DSPAP +KP+S S  GYSQ+RYDEYEDDGFMV                    
Sbjct: 314 EQQEREGLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGFMV-DDENNETGEDDEGEDDEDD 372

Query: 360 XXXXXXXXXXXXXXXAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDD 419
                          AERLRQLKR GA+QY ++ + D++V  ++ +DS +KRRKVAVLDD
Sbjct: 373 LLDDNNEEEEDDDLNAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDD 432

Query: 420 EDDE 423
           EDDE
Sbjct: 433 EDDE 436

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  357 bits (917), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/406 (50%), Positives = 255/406 (62%), Gaps = 24/406 (5%)

Query: 31  EEMDDLFGDDSDQ--ETGSGPGEQEPHSPNSANE---------EEDDEQAMYNRKFYGDK 79
           EEMDDLFGDDSD   E      E+E  SPN  ++         EED+EQAMYNRKFYGD 
Sbjct: 84  EEMDDLFGDDSDNAGEGELEGEEKEGKSPNHLSKSEANHGSYLEEDEEQAMYNRKFYGDD 143

Query: 80  GE-DSNDEGSQ-EFREADIDIMKHIVPYSTEPSQGDKTIYYTKVPQFLTIDPIPFDPPAF 137
            + DS+ E SQ EF+EAD++I KHIVPY T  +  DK +YY KVPQFLTIDP+PFDPP+F
Sbjct: 144 VDNDSDAEDSQREFKEADVEIAKHIVPYKTTSNSQDKEVYYAKVPQFLTIDPVPFDPPSF 203

Query: 138 QSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAHIVQWSDGTYSLRL 197
           +  +E R AQ +S EDQ+DDRLI+ENT+RWRYSRD  Q+VFKESNA I+QWSDGT+SLRL
Sbjct: 204 KRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRL 263

Query: 198 GDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVAR 257
           GDE++DVLINDT++T+L VSH+QQEL+Q V+GGE+TK M+FIPTST+SK HQRLSKAV R
Sbjct: 264 GDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVR 323

Query: 258 KEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXXXXGMDSPAPTSKPR 317
           +EQ+EH GPNTYI+R DP                                DS  P    +
Sbjct: 324 REQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQLEKENRDSVEPLGVRK 383

Query: 318 SASRPGYSQTRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAER 377
           SA+   +   R +EYE                                         AER
Sbjct: 384 SAT-SSFGVGRRNEYE----EDDFLVDDEEEEEEGGISGEEEEEAEEEDDDDEDDLNAER 438

Query: 378 LRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDEDDE 423
           LRQLKR+GAAQY  ++          +E+S+ KRRK+AVLDDE+++
Sbjct: 439 LRQLKREGAAQYEQKDEESG------SEESSHKRRKIAVLDDEEED 478

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  332 bits (850), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/410 (45%), Positives = 251/410 (61%), Gaps = 36/410 (8%)

Query: 33  MDDLFGDDSDQETGS-GPGEQEPHSPNSA---------NEEEDDEQAMYNRKFYGDKGE- 81
           +DDLFGD+S++E       EQ+  S +S+         ++EED+EQAMYNRKF G+  E 
Sbjct: 25  LDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHRVIDDEEDEEQAMYNRKFLGEDYEG 84

Query: 82  DSNDEGSQEFREADIDIMKHIVPYSTEPSQGDKTIYYTKVPQFLTIDPIPFDPPAFQSKI 141
            S +E  ++++E D++I+KH+VPY T     DKTIYY KVPQFLTIDP+PFDPP+FQ K+
Sbjct: 85  QSEEEYEKKYKEVDVEIVKHVVPYKTANGADDKTIYYAKVPQFLTIDPVPFDPPSFQKKV 144

Query: 142 EERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAHIVQWSDGTYSLRLGDEY 201
           E+R ++ +S EDQ+ DRLIEENT+RWRYSRDK++RVFKESNA IV+WSDGT+SL++GDEY
Sbjct: 145 EDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEY 204

Query: 202 TDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQQ 261
           TD+L+N+TE+TYL VSH++QELIQ V+GGE+TK+M+F+PTSTNSK H+ LSKAVAR++++
Sbjct: 205 TDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRDER 264

Query: 262 EHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXXXXGM-DSPAPTSKPRSAS 320
             HGPNTYI R DP                                 DSP P     +  
Sbjct: 265 GQHGPNTYITRTDPELEKRELEKKHDQILRERRKKQLKEKLELENAGDSPEPQF---NIQ 321

Query: 321 RPGYSQTRYDEYE-DDGFMVXXXXXXXXXXXXXXXXXXXX------XXXXXXXXXXXXXX 373
           +    +   DEYE DDGF+                                         
Sbjct: 322 KNLSKRHNLDEYEYDDGFVAQDDEEEDDEEEEEDEDFSGEDNDVGDEEESDGGDSEKEYE 381

Query: 374 XAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDEDDE 423
            A+RLR++K+ GA +Y               ED+  K+RK+AVLDDEDDE
Sbjct: 382 NAKRLREVKQTGAQEYQ--------------EDAQAKKRKIAVLDDEDDE 417

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  329 bits (843), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/407 (45%), Positives = 245/407 (60%), Gaps = 27/407 (6%)

Query: 33  MDDLFGDD---------SDQETGSGPGEQEPHSPNSANEEEDDEQAMYNRKFYGDKGEDS 83
           MDDLFGDD         SD E      E++  S     E+ DDE+AMY RKFYGD  + S
Sbjct: 75  MDDLFGDDEDEDKEQRGSDDEEEGFIVEEDDESAQRRPEDMDDEEAMYTRKFYGDTDKYS 134

Query: 84  -NDEGSQEFREADIDIMKHIVPYSTEPSQGDKTIYYTKVPQFLTIDPIPFDPPAFQSKIE 142
            N+E + +F+EA+++I++H+VPY T   Q D TIYY KVP FLTIDPIPFDP +F++K++
Sbjct: 135 DNEEDAHDFKEANVEIIRHMVPYKTSSDQADTTIYYAKVPPFLTIDPIPFDPVSFETKVK 194

Query: 143 ERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAHIVQWSDGTYSLRLGDEYT 202
           +R A  +S EDQ+ DRLI+ENT+RWRYSRD+NQRVFKESNA IVQWSDG++SL+LGDEYT
Sbjct: 195 DRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRVFKESNAQIVQWSDGSFSLKLGDEYT 254

Query: 203 DVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQQE 262
           D+L+NDT++T+L VSHDQQEL+Q   GGE+TK M+FIPTSTNSK HQ+LSKAV R+ Q++
Sbjct: 255 DILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMFIPTSTNSKIHQQLSKAVTRRNQRQ 314

Query: 263 HHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXXXXGMDSP-----APTSKPR 317
           + GP T I+  DP           G                    D+      + +SK R
Sbjct: 315 NLGPGTMIIEKDPELEKKELEKKQGQILRERRKRQLKEREIQESPDTTFDVRGSASSKNR 374

Query: 318 SASRPGYSQTRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAER 377
           S +   Y  +R DEYE                                         A+R
Sbjct: 375 SPAPSSYRGSRQDEYE----EDDFLVDDDEEEEFVGDEDEEEEEEEEEEEEDEDDRKAKR 430

Query: 378 LRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVL-DDEDDE 423
           L+++K+ GA +Y  +E S       D E+ + KRRKVAVL DDE+DE
Sbjct: 431 LKEIKKGGAQEYADREES-------DMEEGSSKRRKVAVLSDDEEDE 470

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  311 bits (798), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 183/218 (83%), Gaps = 5/218 (2%)

Query: 63  EEDDEQAMYNRKFYGD----KGEDSNDEGSQEFREADIDIMKHIVPY-STEPSQGDKTIY 117
           +E+DEQ MYNRKFYGD       +S+ E  +E +EA++ IMKH+VPY +T  S+ D ++Y
Sbjct: 82  DEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNASEKDSSLY 141

Query: 118 YTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRV 177
           Y KVPQFLTIDPIPFDPP FQS+IE+R  + +S EDQ+ DRLI+ENT+RWRYSR  NQ+V
Sbjct: 142 YAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQV 201

Query: 178 FKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMI 237
           FKESNA I+QWSDGT+SL+LGDE++D+LIND E+TY+ VSH+Q+EL+Q V+GGE+ K+M+
Sbjct: 202 FKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSML 261

Query: 238 FIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDP 275
           FIPTSTNSK+HQRLS A+AR+E +EH GP+TYI+R+DP
Sbjct: 262 FIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDP 299

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 7/55 (12%)

Query: 375 AERLRQLKRKGAAQY-----NTQEASDNNVESD--DAEDSAMKRRKVAVLDDEDD 422
           AERL+QLK +GAA+Y      T   SD + + D  + + SA KRRKVAVLD +D+
Sbjct: 407 AERLKQLKIEGAARYQHGSTTTTSPSDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  310 bits (794), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/384 (44%), Positives = 223/384 (58%), Gaps = 28/384 (7%)

Query: 58  NSANEEEDDEQAMYNRKFYGDKGEDSND--EGSQEFREADIDIMKHIVP--YSTEPSQGD 113
           N  +E+ED+EQAMY RKFYG+   D +D  E   EFRE D+ + +H+VP   ++E +  D
Sbjct: 83  NYVDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDAD 142

Query: 114 KTIYYTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDK 173
            TIYY KVP FLTIDPIPFDPP F++ + ER     S E+Q++DRLI++NT+RWRYSRD 
Sbjct: 143 TTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDD 202

Query: 174 NQRVFKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVT 233
           NQRVFKESNA IVQWSDG+YSL+LGDEYTD+L+NDT++T+L VSHDQQEL+Q V GGE++
Sbjct: 203 NQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEIS 262

Query: 234 KNMIFIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXX 293
           K+++F+P ST SK HQRLSKA+ R+   E  GP + I+ +DP                  
Sbjct: 263 KSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQVFRER 322

Query: 294 XXXXXXXXXXXXGMDSPA------PTSKPRSASRPGYSQTRYDEYEDDGFMV-------- 339
                        +++          S+ RS +   Y  +R DEYE+D F+V        
Sbjct: 323 RKKKQKEIEALESLETTGFGNNSYSASRKRSTTPMSYGGSRRDEYEEDDFIVDDEEEEPE 382

Query: 340 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERLRQLKRKGAAQYNTQEASDNNV 399
                                              AERLR+LKR+G A YN  E S +  
Sbjct: 383 YAGEEDDDDLDGFEEEEEEQEEEEEGEDEDADEKRAERLRELKRQGTAAYNDDEKSGS-- 440

Query: 400 ESDDAEDSAMKRRKVAVL-DDEDD 422
                   + KRRKVAV+ DDEDD
Sbjct: 441 -------ESPKRRKVAVIEDDEDD 457

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  308 bits (790), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 138/213 (64%), Positives = 181/213 (84%), Gaps = 2/213 (0%)

Query: 65  DDEQAMYNRKFYGDKGEDSND-EGSQEFREADIDIMKHIVPYSTEP-SQGDKTIYYTKVP 122
           D+E+AMYNRKFYG++G D +D E    F+EAD+++++H+VPY T P ++ DKTIYYTKVP
Sbjct: 66  DEEEAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYTKVP 125

Query: 123 QFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESN 182
            FL+IDP+PFDPP+F++K++ER +  +SVEDQ+ DRLI+ENT+RWRYSRD  QRVFKESN
Sbjct: 126 AFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKESN 185

Query: 183 AHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTS 242
           A IVQWSDG+YSL+LG EYTD+L+N T++T+L VSHDQQEL+Q V GG++ K +IFIPTS
Sbjct: 186 AQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTS 245

Query: 243 TNSKSHQRLSKAVARKEQQEHHGPNTYILRVDP 275
           TNSK HQRLSKA+AR++Q+ H GP T I+ +DP
Sbjct: 246 TNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDP 278

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  308 bits (790), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 161/367 (43%), Positives = 222/367 (60%), Gaps = 15/367 (4%)

Query: 61  NEEEDDEQAMYNRKFYGDKGED--SNDEGSQEFREADIDIMKHIVP--YSTEPSQGDKTI 116
           +++E +EQAMY RKFYG+   D    DE +  F+E +I+I++HI+P   +   +     I
Sbjct: 131 DDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNEI 190

Query: 117 YYTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQR 176
           +Y ++P FLTID +PFDPP+F++K+ ERA   TS EDQ+DDRLI+ENTVRWRYSRDK+Q 
Sbjct: 191 FYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQH 250

Query: 177 VFKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNM 236
           VFKESN  IVQWSDG+YSL++G+E TD+L+NDT +T+L VSHDQQELIQ  +GGE+ K +
Sbjct: 251 VFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTL 310

Query: 237 IFIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXX 296
           +FIPTSTNSK HQ+LSKAV R+ Q+++ GP TYI+ +DP                     
Sbjct: 311 MFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVLRDRRRR 370

Query: 297 XXXXXXXXXGMDSPAPTSKPRSASRPGYSQTRYDEYEDDGFMVXXXXXXXXXXXXXXXXX 356
                      D+   T   + +S   Y  +R +EYE+D F+V                 
Sbjct: 371 QLKEREKQESPDAAFETGFRKQSSPTSYGISRRNEYEEDDFLV---DDDEEEEAGFDDGD 427

Query: 357 XXXXXXXXXXXXXXXXXXAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAV 416
                             A RLR LKR+GAA Y  +E  D++ E+        KRR+VAV
Sbjct: 428 DEEEEEEEEEEEEADQENAARLRNLKREGAAMYKEEEKDDDSNET--------KRRRVAV 479

Query: 417 LDDEDDE 423
           ++D++DE
Sbjct: 480 IEDDEDE 486

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  304 bits (779), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 182/435 (41%), Positives = 240/435 (55%), Gaps = 33/435 (7%)

Query: 6   EGTVALENSQNELSEKQSPNV---EADGEEMDDLFGDDSDQETGSGPGEQEPHSPNSANE 62
           E  V    S  E++E+    V   EADG  MDDLFGD+ +++      EQ       +  
Sbjct: 17  ETPVVDNTSPTEITEENKKEVAEEEADG--MDDLFGDEEEEDENKSVDEQSEDDDIGSRP 74

Query: 63  EE---DDEQAMYNRKFYGD----KGEDSNDEGSQEFREADIDIMKHIVPYSTEPSQGDKT 115
                D+E+AMY RKFYGD    +     D     F+E ++++++H+VPY T   + D+T
Sbjct: 75  RRTDIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDET 134

Query: 116 -IYYTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKN 174
            +YY KVP FLTI+P+PFDP AF+S + +R +  +S EDQ+ DRLI+ENTVRWRYSRD N
Sbjct: 135 TVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDAN 194

Query: 175 QRVFKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTK 234
           QRVFKESNA IVQWSDG++SL+LGDEYTD+L+N+T +T+LAVSHDQQEL+Q   GGE+TK
Sbjct: 195 QRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITK 254

Query: 235 NMIFIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXX 294
            ++FIPTSTNSK HQ+LSKAV R+ Q+EH GP T I+  DP           G       
Sbjct: 255 TLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRR 314

Query: 295 XXXXXXXXXXXGMDSPAPTS-----KPRSASRPGYSQTRYDEYEDDGFMVXXXXXXXXXX 349
                        D+    S     + R+   P     R DEYE                
Sbjct: 315 RRQLKEKELLESPDTTMDVSGGYETRKRNTPNPSLGSRRQDEYE-------EDDFLVDDE 367

Query: 350 XXXXXXXXXXXXXXXXXXXXXXXXXAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAM 409
                                    AERLR  KR G  + N +  ++N       E S+ 
Sbjct: 368 DEEDFIEDDEEEEEEEEEEDNDEEKAERLRNAKRSGYDEDNQESGTEN-------ESSSS 420

Query: 410 KRRKVAVL-DDEDDE 423
           K+R+VAV+ DDEDDE
Sbjct: 421 KKRRVAVINDDEDDE 435

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  302 bits (773), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 178/414 (42%), Positives = 238/414 (57%), Gaps = 34/414 (8%)

Query: 32  EMDDLFGDD-------SDQETGSGPGEQEPHSPNSANEEEDDEQA----MYNRKFYGDKG 80
           EMDDLFGD+       SD+E G      E  S      + DDE+A    MY RKFYG+  
Sbjct: 39  EMDDLFGDEGQASDRGSDEEEGGSSNSDEEESSRRGEMQMDDEEAQEHAMYTRKFYGEDA 98

Query: 81  EDSND--EGSQEFREADIDIMKHIVPYSTEPSQGDK--TIYYTKVPQFLTIDPIPFDPPA 136
           ++ +D  E +  F E ++++++HIVPY T     D+  TIYY KVP+FLTIDP+PFDPP+
Sbjct: 99  DNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKVPEFLTIDPVPFDPPS 158

Query: 137 FQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAHIVQWSDGTYSLR 196
           F+SK++ER    +S EDQ+ DRLI+ENT+RWRYSRD+NQ+V+KESNA IVQWSDG  SL+
Sbjct: 159 FESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQQVYKESNAQIVQWSDGGLSLK 217

Query: 197 LGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVA 256
           LG EYTD+L+NDT++T+ AVSHD+QEL+Q  +GGEVTK+++FIPTSTNSK HQ+L+KAV 
Sbjct: 218 LGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTKAVI 277

Query: 257 RKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXXXXGMDSPAPTS-- 314
           R++Q++  GP  Y +  DP                                D     +  
Sbjct: 278 RRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVRERRKRQLKEIESRNSPDISTGLNGY 337

Query: 315 --KPRSASRPG---YSQTRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 369
              P +AS      Y  ++ +EYE D F+V                              
Sbjct: 338 RKTPVTASDEQDSYYGSSKRNEYEQDDFLV--DDDEEEEAGYSEEDDVLDDNNDDQEAED 395

Query: 370 XXXXXAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDEDDE 423
                AERLRQLKR+G  +Y          E +   D + KRRKVA++DDEDDE
Sbjct: 396 EEDAKAERLRQLKRQGTERY---------TEPEPESDPSTKRRKVAIIDDEDDE 440

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  299 bits (766), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 197/262 (75%), Gaps = 23/262 (8%)

Query: 34  DDLFGDDSD---------------QETGSGPGEQEPHSPNSANEEEDDEQAMYNRKFYGD 78
           +DLFG+DSD               +++GS       H   +   E+++EQ MYNRKFYGD
Sbjct: 36  NDLFGEDSDVSGSDDADEADDGASEDSGSRRSRGTGHGLGA---EDNEEQEMYNRKFYGD 92

Query: 79  ---KGEDSNDEG-SQEFREADIDIMKHIVPYS-TEPSQGDKTIYYTKVPQFLTIDPIPFD 133
              +  D +DE  ++E +EAD++++KH+VP    +P +G + +YYTKVPQFLTIDP+PFD
Sbjct: 93  DLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLYYTKVPQFLTIDPVPFD 152

Query: 134 PPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAHIVQWSDGTY 193
           PP+FQ +IE+R A+ +S EDQ+ D LI+ENT+RWRYSR  +QRVFKESNA +++WSDGT 
Sbjct: 153 PPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFKESNAQVIEWSDGTL 212

Query: 194 SLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSK 253
           SL+LGDEYTD+L N+ E+TYL VSH+QQE++Q V+GG ++ +M+FIPTSTNSK H+RL+K
Sbjct: 213 SLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFIPTSTNSKIHKRLTK 272

Query: 254 AVARKEQQEHHGPNTYILRVDP 275
           A+AR+E +EH GP+TYI+R DP
Sbjct: 273 AIARREAREHSGPSTYIVRKDP 294

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 5/48 (10%)

Query: 375 AERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDEDD 422
           A RL+QLKR+GAA+Y     +         E+ A+KRRKVAVLD +D+
Sbjct: 397 AARLQQLKREGAAKYAAAPPAPRA-----DEEVALKRRKVAVLDSDDE 439

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  296 bits (757), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 157/366 (42%), Positives = 215/366 (58%), Gaps = 19/366 (5%)

Query: 62  EEEDDEQAMYNRKFYGDKGED--SNDEGSQEFREADIDIMKHIVP--YSTEPSQGDKTIY 117
           ++E +EQAMY RKFYG+   D    DE +  F+E ++++++HI+P   +   +     I+
Sbjct: 102 DDEAEEQAMYTRKFYGEDANDFSDQDEATHTFKEENVELVRHIIPSKANVNETASHNEIF 161

Query: 118 YTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRV 177
           Y ++P FLTIDPIPFDPP+F++K+ ERA    S EDQ+DDRLI+ENTVRWRYSRD +Q V
Sbjct: 162 YARIPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDNDQHV 221

Query: 178 FKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMI 237
           FKESN  IVQWSDG+YSL++G+EYTD+L+NDT +T+L VSHDQQEL+Q  +GGE+ K ++
Sbjct: 222 FKESNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKTLM 281

Query: 238 FIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXX 297
           FIPTST+SK HQ+LSKAV RK Q+++ GP TYI+ +DP                      
Sbjct: 282 FIPTSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDRRKRQ 341

Query: 298 XXXXXXXXGMDSPAPTSKPRSASRPGYSQTRYDEYEDDGFMVXXXXXXXXXXXXXXXXXX 357
                     D    T+  + +S   Y  TR +EYE                        
Sbjct: 342 LKEKEKQESPDVGFETAFRKQSSPTAYGATRRNEYE-------EDDFLVDDDEEEEAEFD 394

Query: 358 XXXXXXXXXXXXXXXXXAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVL 417
                            A RLR LKR+GAA Y  +   D++ ES        KRR+VAV+
Sbjct: 395 DDDDNEEEEEEEADEDNAARLRNLKREGAAMYKEEGGDDDSNES--------KRRRVAVI 446

Query: 418 DDEDDE 423
           +D++DE
Sbjct: 447 EDDEDE 452

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  293 bits (750), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 155/366 (42%), Positives = 213/366 (58%), Gaps = 15/366 (4%)

Query: 64  EDDEQAMYNRKFYGDKGEDSND--EGSQEFREADIDIMKHIVPYS--TEPSQGDKTIYYT 119
           E +EQAMY RKFYG+   D +D  E +  F+E ++++++HI+P       +     I+Y 
Sbjct: 106 EAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYA 165

Query: 120 KVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFK 179
           ++P FLTIDP+PFDPP+F++K+ ER +   S EDQ+DDRLI+ENTVRWRYSRDK+Q VFK
Sbjct: 166 RIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFK 225

Query: 180 ESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFI 239
           ESN  IVQWSDGTYSL++G+E TD+L+NDT +T+L VSHDQQELIQ  +GGE+ K ++FI
Sbjct: 226 ESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFI 285

Query: 240 PTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXX 299
           PTSTNSK HQ+LSKAV R+ Q+++ GP TYI+ +DP                        
Sbjct: 286 PTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQILRDRRRRQLK 345

Query: 300 XXXXXXGMDSPAPTSKPRSASRPGYSQTRYDEY--EDDGFMVXXXXXXXXXXXXXXXXXX 357
                   D+   T   + +S   Y  +R +EY  +D                       
Sbjct: 346 EKEKQESPDAAFETGFRKQSSPTAYGTSRRNEYEEDDFLVDDDEEEEAEFDDDDDNEEEE 405

Query: 358 XXXXXXXXXXXXXXXXXAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVL 417
                            A RLR LK++GAA Y  +E  DNN           KRR+VAV+
Sbjct: 406 EEEEEEEEEEEDADEANAARLRSLKKEGAAMYRQEENEDNN---------ETKRRRVAVI 456

Query: 418 DDEDDE 423
           +D+++E
Sbjct: 457 EDDEEE 462

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  290 bits (743), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 214/367 (58%), Gaps = 22/367 (5%)

Query: 64  EDDEQAMYNRKFYGDKGEDSN-----DEGSQEFREADIDIMKHIVP--YSTEPSQGDKTI 116
           E +EQAMY RKFYG   ED+N     DE +  F+E ++++++HI+P   +   +     I
Sbjct: 112 EAEEQAMYTRKFYG---EDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEI 168

Query: 117 YYTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQR 176
           +Y ++P FLTIDPIPFDPP+F++K+ ERA+   S EDQ+DDRLI+ENTVRWRYSRDK+Q 
Sbjct: 169 FYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQH 228

Query: 177 VFKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNM 236
           VFKESN  IVQWSDGTYSL++G+E TD+L+NDT +T+L VSHDQQELIQ  +GGE+ K +
Sbjct: 229 VFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTL 288

Query: 237 IFIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXX 296
           +FIPTSTNSK HQ+LSKAV R+ Q++  GP TYI+ +DP                     
Sbjct: 289 MFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILRDRRRR 348

Query: 297 XXXXXXXXXGMDSPAPTSKPRSASRPGYSQTRYDEYEDDGFMVXXXXXXXXXXXXXXXXX 356
                      D+   T   +  S   Y  +R +EYE+                      
Sbjct: 349 QLKEKEKQESPDAAFETGFRKQNSPTTYGASRRNEYEE-----DDFLVDDDEEEEAAFDD 403

Query: 357 XXXXXXXXXXXXXXXXXXAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAV 416
                             A RLR LKR+GAA Y  +E         + + S  KRR+VAV
Sbjct: 404 EEDDNEEEEEEEDADEENASRLRNLKREGAAMYREEEEE-------EKDRSETKRRRVAV 456

Query: 417 LDDEDDE 423
           ++D++DE
Sbjct: 457 IEDDEDE 463

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  285 bits (730), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 136/276 (49%), Positives = 190/276 (68%), Gaps = 4/276 (1%)

Query: 67  EQAMYNRKFYGDKGED-SNDEGSQEFREADIDIMKHIVPYSTEPSQGDK-TIYYTKVPQF 124
           EQ MY RKFYG+   + S+D+    F+E+++D+++HI+PY T  +  +   I+Y KVP F
Sbjct: 108 EQEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPAF 167

Query: 125 LTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAH 184
           LTIDP+PFDP  F++ ++ER ++  S EDQ+ DRLI+ENT+RWRYSRD  Q VFKESNA 
Sbjct: 168 LTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNAQ 227

Query: 185 IVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTN 244
           IVQWSDG++SL+LGDEYTD+++NDT++T+L VSHDQQEL+Q   GGE+TK M+FIPTSTN
Sbjct: 228 IVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTSTN 287

Query: 245 SKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXXX 304
           SK HQ+LSKAV+R+  +++ GP +YI++ DP           G                 
Sbjct: 288 SKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKEIETR 347

Query: 305 XGMDSP-APTSKPRSASRPGYSQTRYDEYEDDGFMV 339
              ++  A T + +  + P  S +R +EYEDDGF+V
Sbjct: 348 ENAENGFAETGEFKRGNTPSRS-SRQNEYEDDGFLV 382

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  286 bits (731), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 163/386 (42%), Positives = 217/386 (56%), Gaps = 44/386 (11%)

Query: 61  NEEEDDEQAMYNRKFYGDKGEDSN----DEGSQEFREADIDIMKHIVPYSTEPSQGDKT- 115
           +E+ED+E AMY RKFYGD  ED N    DE   EF+EAD+++++HIVPY     + D + 
Sbjct: 105 DEDEDEEHAMYTRKFYGD--EDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSK 162

Query: 116 --------IYYTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRW 167
                    YY ++P FLTIDP+PFDPP F+S+++ER    T+V+D+I DRLI+ENT+RW
Sbjct: 163 DDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRW 222

Query: 168 RYSRDKNQRVFKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSV 227
           RYSRD NQ VFKESNA I+QWSDG+YSL+LGD+YTD+L+ND  +T+L VSHDQQEL+Q V
Sbjct: 223 RYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCV 282

Query: 228 KGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXG 287
            GGE++K+ +F+P STNS+ HQRLSKA+AR++Q     P + I+ VDP            
Sbjct: 283 DGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQS 342

Query: 288 XX-XXXXXXXXXXXXXXXXGMDSP-------APTSKPRSASRPGY--SQTRYDEYEDDGF 337
                               +DSP         +S  +    P Y   + R DEYE+D F
Sbjct: 343 QIFRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTPSYDPRRERADEYEEDDF 402

Query: 338 MVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERLRQLKRKGAAQYNTQEASDN 397
           +                                     ERL+          N++  +D 
Sbjct: 403 I---VDDEGEEDDDVEDDVEDEEDEDEEEEEEEEERNLERLK----------NSKTQNDF 449

Query: 398 NVESDDAEDSAMKRRKVAVLDDEDDE 423
            VE D       KRRKVAV+DDEDDE
Sbjct: 450 EVEEDS------KRRKVAVIDDEDDE 469

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  278 bits (710), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 174/216 (80%), Gaps = 1/216 (0%)

Query: 61  NEEEDDEQAMYNRKFYG-DKGEDSNDEGSQEFREADIDIMKHIVPYSTEPSQGDKTIYYT 119
           ++EE +E AMY RKFYG D    S++E +QEFRE D+++++HIVPY          +YY 
Sbjct: 82  DDEEAEEHAMYTRKFYGEDVDRVSDEEEAQEFREEDVELVRHIVPYRATQGTDKPVLYYA 141

Query: 120 KVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFK 179
           K+P+FLTIDP+PFDPP+F++ ++ER   + S EDQ+ DRLI+ENTVRWRYSRD NQ+VFK
Sbjct: 142 KIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFK 201

Query: 180 ESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFI 239
           ESNA IVQWSDGT+SL+LGDEYTD+L NDT++T+ AVSHDQQEL+Q  +GGEVTK ++FI
Sbjct: 202 ESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFI 261

Query: 240 PTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDP 275
           PTST+S+ HQ+L+KAV R++ ++  GP TYI++ DP
Sbjct: 262 PTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDP 297

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 28/49 (57%), Gaps = 17/49 (34%)

Query: 375 AERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDEDDE 423
           AERLR+LKR+GA  Y  +                 KRR+VAV+DDE+DE
Sbjct: 392 AERLRRLKREGANNYEER-----------------KRRRVAVIDDEEDE 423

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  276 bits (706), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 131/223 (58%), Positives = 169/223 (75%), Gaps = 3/223 (1%)

Query: 56  SPNSANEEEDDEQAMYNRKFYGDKGEDSNDEGSQ-EFREADIDIMKHIVPYSTEP--SQG 112
           SP     + D+E+ MYNRKFYG+  + S+ E ++ EF+EA+++++KHIVPY   P  + G
Sbjct: 88  SPRRKRLDMDEEEEMYNRKFYGEDVDMSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIG 147

Query: 113 DKTIYYTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRD 172
              IY  KVP FL IDP PFDP +F+ K+ +R     S ED++ DRLI+ENTVRWRYSRD
Sbjct: 148 TNDIYVAKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRD 207

Query: 173 KNQRVFKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEV 232
            NQ VFKESN  IVQWSDG+YSL+LG+EYTD+LINDT++T+L VSHDQQEL+Q V+GG V
Sbjct: 208 TNQSVFKESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLV 267

Query: 233 TKNMIFIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDP 275
            K ++FIPTST+SK HQ+LSKAVAR+   +  GP TYI+ VDP
Sbjct: 268 NKTLMFIPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDP 310

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  259 bits (661), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 162/430 (37%), Positives = 227/430 (52%), Gaps = 41/430 (9%)

Query: 33  MDDLFGDDSDQETGSGPGEQE------------------PHSPNSANEEEDDEQ--AMYN 72
           MDDLFGDD D+E G    + E                   +  +  +E  DDEQ  AMY 
Sbjct: 1   MDDLFGDDEDEEAGDKNTQNEIDDDDDDDDDDDDEGFVRKNRRSEYDENSDDEQDKAMYE 60

Query: 73  RKFYGDKG--EDSNDEGSQEFREADIDIMKHIVPYSTEPSQGD----KTIYYTKVPQFLT 126
           +KFYG+ G     +D+   E++E+DI++++HIVPY T PS  +    + +YY KVP FL 
Sbjct: 61  KKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYKTRPSNKELDKHRELYYAKVPPFLM 120

Query: 127 IDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQ--RVFKESNAH 184
           +DP+PFD   F+S ++ER     + + QI DRL +ENT+RWRYSRD N   +VFK+SNA 
Sbjct: 121 VDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDSNDNDKVFKQSNAQ 180

Query: 185 IVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTN 244
           I+QWSDG+YSL+LG++YTD+L N+T++ +L VSHDQQEL+Q   GGE+TK ++FIP+ST 
Sbjct: 181 IIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGEITKTLMFIPSSTK 240

Query: 245 SKSHQRLSKAVARKEQQEHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXXX 304
           SK HQRL+ AV  ++++   GP   ++  DP                             
Sbjct: 241 SKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLLEKKQWQMMRDRRRKQLQERENN 300

Query: 305 X--GM--------DSPAPTSKPRSASRPGYSQ-TRYDEYEDDGFMVXXXXXXXXXXXXXX 353
              G+        +SP+  S+    SR   +   R +EYE+D F+V              
Sbjct: 301 EVDGITSGFSKRDNSPSINSQSIKGSRSDRNHDYRRNEYEEDDFIV-DDEDEEVDGMVDD 359

Query: 354 XXXXXXXXXXXXXXXXXXXXXAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRK 413
                                AERLR  KR+G  Q +  E    N E   +     KRRK
Sbjct: 360 DDDNAEEEEEEEEEEDEDDLNAERLRNAKRQG-YQEDDDERDARNEEEQSSSSEVTKRRK 418

Query: 414 VAVLDDEDDE 423
           +AV+DDEDDE
Sbjct: 419 IAVIDDEDDE 428

>KNAG0D02440 Chr4 (433064..433720) [657 bp, 218 aa] {ON} Anc_8.91
           YFR001W
          Length = 218

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 39/85 (45%), Gaps = 8/85 (9%)

Query: 23  SPNVEADGEEMDDLFGDDSDQETGSGPGEQEPHSPNSANEEEDDEQAMYNRKFYGDKGED 82
           +P V AD +  + L  D  D     GPG Q+ +S N    +   EQA    + YG K   
Sbjct: 20  APEVFADKQARNQL-ADGVDSSARHGPGRQKKYSTNKL--QVSKEQAKM--RLYGKKAAS 74

Query: 83  SNDEGSQEFREADIDI---MKHIVP 104
            N   S ++ E D+DI    K IVP
Sbjct: 75  RNRSVSGKYDEKDLDIPTLNKAIVP 99

>TDEL0E04850 Chr5 complement(903404..905602) [2199 bp, 732 aa] {ON}
           Anc_5.145 YGR196C
          Length = 732

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 50/98 (51%), Gaps = 6/98 (6%)

Query: 11  LENSQNELSEKQSPNVEADGEEMDDLFGDDSDQETGSGPGEQEPHSPNSANEEEDDEQAM 70
           LEN   ++S++ +P ++   +  DD    +SD+ + +G  E+EP    SA E +DD +  
Sbjct: 134 LENLMAQISKEMTPKIDQTEDFNDDEVSLNSDRISSTG-LEKEPL---SAGESDDDLEVA 189

Query: 71  YNRKF--YGDKGEDSNDEGSQEFREADIDIMKHIVPYS 106
            N  F  Y +  ED N   S E   +DID+    +P S
Sbjct: 190 KNGYFAKYVNDEEDKNYVSSGESSTSDIDVNDRQLPAS 227

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.127    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,120,228
Number of extensions: 1956008
Number of successful extensions: 16928
Number of sequences better than 10.0: 671
Number of HSP's gapped: 15671
Number of HSP's successfully gapped: 1022
Length of query: 423
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 311
Effective length of database: 40,638,807
Effective search space: 12638668977
Effective search space used: 12638668977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 67 (30.4 bits)