Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F15906g5.441ON51551527320.0
Kwal_55.214025.441ON51651418240.0
SAKL0G02684g5.441ON53951811461e-151
ZYRO0F10186g5.441ON51950510201e-133
Kpol_1062.255.441ON53347910201e-133
TDEL0D026005.441ON5235049811e-127
TBLA0A027905.441ON5474999791e-126
NCAS0F034205.441ON5254699711e-125
NDAI0B057105.441ON5635649741e-125
TPHA0E017205.441ON5374589451e-121
KLLA0E02333g5.441ON4805159351e-121
Smik_4.6375.441ON5114939211e-118
CAGL0A02904g5.441ON5015129181e-118
YDR371W (CTS2)5.441ON5114959111e-117
KNAG0C048705.441ON4584488921e-114
Ecym_45125.441ON5275158941e-114
Suva_2.5435.441ON5114858931e-114
Skud_4.6405.441ON5114588901e-113
ACL166W5.441ON4905198401e-106
KAFR0E038105.441ON4904577812e-97
Ecym_46977.378ON77084870.061
KLTH0C07018g7.378ON76885840.13
Kwal_27.108987.378ON76888800.40
Skud_5.2127.378ON76783780.73
YER091C (MET6)7.378ON76783770.85
Smik_5.2327.378ON76783761.2
Suva_5.2077.378ON76783761.2
ABR212C7.378ON76883751.5
KLLA0E20065g7.378ON76886723.8
Suva_13.3522.336ON56240706.3
TPHA0D039503.431ON501161696.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F15906g
         (515 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...  1056   0.0  
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   707   0.0  
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   446   e-151
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   397   e-133
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   397   e-133
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   382   e-127
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   381   e-126
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   378   e-125
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   379   e-125
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   368   e-121
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   364   e-121
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   359   e-118
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   358   e-118
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   355   e-117
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   348   e-114
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   348   e-114
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   348   e-114
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   347   e-113
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   328   e-106
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   305   2e-97
Ecym_4697 Chr4 (1363306..1365618) [2313 bp, 770 aa] {ON} similar...    38   0.061
KLTH0C07018g Chr3 (608415..610721) [2307 bp, 768 aa] {ON} highly...    37   0.13 
Kwal_27.10898 s27 (546649..548955) [2307 bp, 768 aa] {ON} YER091...    35   0.40 
Skud_5.212 Chr5 complement(333916..336219) [2304 bp, 767 aa] {ON...    35   0.73 
YER091C Chr5 complement(339864..342167) [2304 bp, 767 aa] {ON}  ...    34   0.85 
Smik_5.232 Chr5 complement(348431..350734) [2304 bp, 767 aa] {ON...    34   1.2  
Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON...    34   1.2  
ABR212C Chr2 complement(802388..804694) [2307 bp, 768 aa] {ON} S...    33   1.5  
KLLA0E20065g Chr5 complement(1786006..1788312) [2307 bp, 768 aa]...    32   3.8  
Suva_13.352 Chr13 complement(583952..585640) [1689 bp, 562 aa] {...    32   6.3  
TPHA0D03950 Chr4 (827439..828944) [1506 bp, 501 aa] {ON} Anc_3.4...    31   6.8  

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/515 (98%), Positives = 506/515 (98%)

Query: 1   MAPILCFARKFLVAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAG 60
           MAPILCFARKFLVAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAG
Sbjct: 1   MAPILCFARKFLVAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAG 60

Query: 61  TGLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDE 120
           TGLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDE
Sbjct: 61  TGLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDE 120

Query: 121 WSDVQMDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVN 180
           WSDVQMDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVN
Sbjct: 121 WSDVQMDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVN 180

Query: 181 NFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEP 240
           NFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEP
Sbjct: 181 NFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEP 240

Query: 241 KVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWN 300
           KVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWN
Sbjct: 241 KVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWN 300

Query: 301 LMAYDFSGAWSAQTAYQSNLYTPAKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMP 360
           LMAYDFSGAWSAQTAYQSNLYTPAKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMP
Sbjct: 301 LMAYDFSGAWSAQTAYQSNLYTPAKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMP 360

Query: 361 AYGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSAY 420
           AYGRGFKGVEVSHKSIENVIGKPFQDV         ISLYKQLPLKGGMEFFDHNAVSAY
Sbjct: 361 AYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNAVSAY 420

Query: 421 CVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKGKSLVGAFTKEI 480
           CVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKGKSLVGAFTKEI
Sbjct: 421 CVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKGKSLVGAFTKEI 480

Query: 481 KCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTFQN 515
           KCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTFQN
Sbjct: 481 KCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTFQN 515

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/514 (66%), Positives = 399/514 (77%), Gaps = 3/514 (0%)

Query: 1   MAPILCFARKFLVAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAG 60
           M P L  ARKFLV  CV  IILE +YT +I  S +++AFQ  +N + RS  M ST  D  
Sbjct: 1   MLPGLVIARKFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKD 60

Query: 61  TGLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDE 120
             L   +E G  +G+YYSNWSPY ARKHFPHDIDFR+LT V+Y+FLVVN ETGECQLSDE
Sbjct: 61  NSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDE 120

Query: 121 WSDVQMDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVN 180
           WSDVQMDLYKQM S+F+K+DL+ QFP  S++ LPLGCIGELF+LKY++FL++ GG   V 
Sbjct: 121 WSDVQMDLYKQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVK 180

Query: 181 NFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEP 240
           NFKTIMSVGGWSNREAF SLV+SPAK++VF++SCV +MF+YGFDGIDIDWEFPKND+ EP
Sbjct: 181 NFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEP 240

Query: 241 KVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWN 300
           K YL M+++LR++LD LES IFG++ H  HF LTSAISAD  CL+YLPL E DRYVD WN
Sbjct: 241 KAYLDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWN 300

Query: 301 LMAYDFSGAWSAQTAYQSNLYTPAKTNKRSTNGR-GSADKAVRFLTDKSKLASKKIVLGM 359
           LMAYDFSGAWS  TAYQSNLY+ +   KRS N   GSAD AVR L +K KL +KKIVLGM
Sbjct: 301 LMAYDFSGAWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGM 360

Query: 360 PAYGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSA 419
           PAYGRGFKGV V H S  NVIG+ FQ V         ISLY QLPLKGG E+FD +AVSA
Sbjct: 361 PAYGRGFKGVSVPHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEWFDQDAVSA 420

Query: 420 YCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAFT 477
           Y VKL+ NK+ AEL+VYDNV SM  KA YV KN+LGGGFWWESCGE+Y    +SL  AFT
Sbjct: 421 YSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFT 480

Query: 478 KEIKCLNKTEPTIYSLPEVVQHYLKLHPGGFLAS 511
           +EIK LNKT PTIY+LP+V ++Y K +P GFLAS
Sbjct: 481 QEIKYLNKTVPTIYALPQVGEYYHKKYPDGFLAS 514

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  446 bits (1146), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 227/518 (43%), Positives = 330/518 (63%), Gaps = 20/518 (3%)

Query: 9   RKFLVAICVTGIILE-AIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADN 67
           + FL+ +  + + LE +++ G ++     + F++ ++++  +    +   + G   ++++
Sbjct: 29  QTFLICLLTSLLFLEMSVFFGTLKGRATQK-FKQIYSDMNSNDNNQNLQEEVGP--ASND 85

Query: 68  ESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMD 127
              +++G+YY+NWSPYA R HFPHD++F ++T+V+Y+F VV+ ++G  + SDEWSD QMD
Sbjct: 86  SQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMD 145

Query: 128 LYKQMISSFKKLDLRAQ----FPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFK 183
           LYK+    FK   L +     F +  K+ LP+GCIGELF+LKYS+ L    G     NFK
Sbjct: 146 LYKKFYPQFKAALLSSSSSSTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFK 205

Query: 184 TIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVY 243
             MSVGGWSNR+AF  +V    K + F+ +CV  MF+YGFDG+DIDWEFP+ND  EPK+Y
Sbjct: 206 VSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMY 265

Query: 244 LQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMA 303
           L M++ LRE LD LE  IF  + H  HF LT A+ A +E L+ LPL++ D YVD+WNLMA
Sbjct: 266 LTMIRRLREALDDLERDIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMA 325

Query: 304 YDFSGAWSAQTAYQSNLYTP-----AKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLG 358
           YD+ G WS  T Y SNLY+       + + R    + +AD AV++L     + S+K+VLG
Sbjct: 326 YDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLG 385

Query: 359 MPAYGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVS 418
           M AYGRGF  V+ +  S  + IGKP+  V         + LY QLPL G +E FD  +VS
Sbjct: 386 MAAYGRGFTRVKTTANS-GSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSVS 444

Query: 419 AYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG--KSLVGAF 476
           AY    S + K    + YDNVDSM  KA YV+ ++L GGFWWESCG+++K   KSL+ AF
Sbjct: 445 AY----SFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAF 500

Query: 477 TKEIKCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTFQ 514
           T ++  L K +P+IY+   V+++YLK +P GFL+  F+
Sbjct: 501 TNDLGSLAKQQPSIYTSAHVIRYYLKNYPQGFLSRVFK 538

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  397 bits (1020), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 204/505 (40%), Positives = 302/505 (59%), Gaps = 23/505 (4%)

Query: 7   FARKFLVAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSAD 66
           F    ++A  +  I++E  +  +I  S+      +H + +G     L    D  T +   
Sbjct: 9   FNHSIILAFIIASIVIEMCFYRKIFKSSAEHDVLDHVHEVGDGS--LQQFKDHHTVIG-- 64

Query: 67  NESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQM 126
            + G+ +G+YYS+WSPY  RKHFPHDIDF K++H+YYAF +++  TGE + SDEWSD QM
Sbjct: 65  -DEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQM 123

Query: 127 DLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIM 186
           DLYK +     +L L+      S   LP GC+GELF+L+++  L R+ G     +FK +M
Sbjct: 124 DLYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKG----RHFKVMM 179

Query: 187 SVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQM 246
           +VGGWSNR+ +  +V  P ++E F++SCV  MF+YGFDGID+DWEFP+ND  EP++YL++
Sbjct: 180 AVGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLEL 239

Query: 247 LKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDF 306
            + +R + D LE  IF  + +   F L+ A  A ++ L  LP++E DRY+D WN+M YD+
Sbjct: 240 ARKMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDY 299

Query: 307 SGAWSAQTAYQSNLYT-PAKTNKR-----STNGRG-SADKAVRFLTDKSKLASKKIVLGM 359
            G WS  T Y  NLY  P K + +     S++  G  A+ A+  + ++  + S+KI LGM
Sbjct: 300 HGEWSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGM 359

Query: 360 PAYGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSA 419
            AYGRGF  V+ S    +  I K F  V         + LY QLP+KG  E +D   VS 
Sbjct: 360 AAYGRGFTHVKASSND-KRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSG 418

Query: 420 YCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAFT 477
           +C     + K    + YDNV+S+  KA YV++  L GGFWWESCG+++    +SL+ AFT
Sbjct: 419 FCF----DHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFT 474

Query: 478 KEIKCLNKTEPTIYSLPEVVQHYLK 502
             IK + K E ++Y  PE +++YL+
Sbjct: 475 GRIKTIAKNENSVYHKPEALRYYLE 499

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  397 bits (1020), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 209/479 (43%), Positives = 285/479 (59%), Gaps = 34/479 (7%)

Query: 60  GTGLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSD 119
           G     + +SG+  G+YYSNWSPY  R H PHD+DF +LTHVYYAF VV+S+TG    SD
Sbjct: 53  GKSFPNNPDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSD 112

Query: 120 EWSDVQMDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGV 179
            WSD +MD YK +    KKL L   F    K+ LP+GCIGELF+L++S     N      
Sbjct: 113 NWSDFEMDCYKPLAMKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRK-- 170

Query: 180 NNFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKE 239
             FK IMSVGGWSNREAF  ++    KL+ F++SC+  MF YGFDGI++DWEFPK+D  E
Sbjct: 171 --FKLIMSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLE 228

Query: 240 PKVYLQMLKALRERLDTLESQIFGSKDHKHH-----FALTSAISADEECLKYLPLQEADR 294
           PK+YL+++K L+ + + LE +IF +  + +H     F L+ A  A +E L  L ++E D 
Sbjct: 229 PKMYLELVKKLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDH 288

Query: 295 YVDYWNLMAYDFSGAWSAQTAYQSNLYTPAKTNKRSTNGRG------------------S 336
           YVD WN+M YD+ G WS +T Y SNLY+P +T     +                     +
Sbjct: 289 YVDVWNMMTYDYHGEWSEKTGYHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLN 348

Query: 337 ADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXX 396
            D A+ ++  K  +  KKI LGM AYGRGF  V  S +     I KP++ V         
Sbjct: 349 GDYAINYVIKKYHINPKKINLGMAAYGRGFTKVNASSQDTR-FINKPYRGVGGASEGEPG 407

Query: 397 ISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGG 456
           + LY QLP+K  +E FD + VSA+C    ++KK    + YDN DSM  KA YV++++L G
Sbjct: 408 MWLYNQLPIKNSLEEFDPDYVSAFC----YDKKSKTFVGYDNRDSMKVKAQYVKEHNLKG 463

Query: 457 GFWWESCGEDYKG--KSLVGAFTKEIKCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTF 513
           GFWWESCG+D+K   KSL+ AFT EI  + +   T+++  EV+++YLK        STF
Sbjct: 464 GFWWESCGDDHKNPEKSLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTF 522

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  382 bits (981), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 195/504 (38%), Positives = 296/504 (58%), Gaps = 31/504 (6%)

Query: 12  LVAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNESGF 71
           ++ + +  I +E  +  +I   +  R   ++  +  +   +++       G        +
Sbjct: 12  IIIVILASIAVEMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVEPG-------QY 64

Query: 72  VTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQ 131
           ++G+YYSNWSPY+ R HFPHDID  +++H+YYAF +V+  TG  +L DEWSDV MDLYK 
Sbjct: 65  LSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKP 124

Query: 132 MISSFKKLDLRAQFPTGSKDK-LPLGCIGELFFLKYSN-FLTRNGGSAGVNNFKTIMSVG 189
           M     KL+   +     + + LP GC+GELF+++ +N F  RN     + +FK IM VG
Sbjct: 125 MAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRN-----IRDFKVIMCVG 179

Query: 190 GWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKA 249
           GWSNRE F  +V +P +++ F+DSC+  MF+YGFDGID+DWEFP++D  EP++YLQ+ K 
Sbjct: 180 GWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKR 239

Query: 250 LRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGA 309
           L+ER++ LE  IFG   +   F L+ A  A  E L  LP+ E D+Y+D WN+M YD+ G 
Sbjct: 240 LKERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGE 299

Query: 310 WSAQTAYQSNLYTPAKTNKRSTNGRG----------SADKAVRFLTDKSKLASKKIVLGM 359
           WS +T Y  NLY  +  +   T+ +            A  A+  + + + + S KI LGM
Sbjct: 300 WSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGM 359

Query: 360 PAYGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSA 419
            AYGRGF  V V+  + +  I KPF  V         + LY QLP++G  E FD + VS 
Sbjct: 360 AAYGRGFTNV-VAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSG 418

Query: 420 YCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAFT 477
           +C    ++      + YD+V+S+  KA YV + +L GGFWWESCG+D+  + +SL+ AFT
Sbjct: 419 FC----YSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFT 474

Query: 478 KEIKCLNKTEPTIYSLPEVVQHYL 501
            EIK ++K +  +Y    V+++Y+
Sbjct: 475 NEIKFVSKFDDLMYRQTPVLRYYV 498

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  381 bits (979), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 200/499 (40%), Positives = 294/499 (58%), Gaps = 41/499 (8%)

Query: 29  RIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNESGFVTGMYYSNWSPYAARKH 88
           ++Q  TK+    E  NN+          ++  T L+  N  G+ +G+YYSNWSPY+ RKH
Sbjct: 44  QLQPPTKI----EPLNNVDNE-----IKDNKNTNLTVANPQGYTSGVYYSNWSPYSPRKH 94

Query: 89  FPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQMISSFKKL----DLRAQ 144
           FPHDIDF +++HVYY+F +VN + G+ +L D+WSD++MDLYK +     KL    D+  +
Sbjct: 95  FPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGKLKNKVDVYEE 154

Query: 145 FPTGS--KDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWSNREAFTSLVE 202
             T S  K  LP GCIGE F+L+ S  L     +    NFK IM++GGWSNR++F  + +
Sbjct: 155 PQTQSTIKTNLPKGCIGEFFYLRNSKLLP-TINTENSKNFKMIMTIGGWSNRDSFPKMAK 213

Query: 203 SPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIF 262
           SP K+  F+ S +  MFEYGFDGID+DWEFPKN+ +EP VYL++++ LR+ ++ LE +I+
Sbjct: 214 SPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQGMNELEEEIY 273

Query: 263 GSK----DHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAWSAQTAYQS 318
            +     + + HF L+ A  A EE L  LP++E ++ +DYWN+M YD++G WS +T Y S
Sbjct: 274 KNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHS 333

Query: 319 NLYTPAKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGVEVSH----- 373
           NLY  +K   +      +AD A++++ +   +   K+VLG+  YGRG+  V V+H     
Sbjct: 334 NLYDGSKV--KHDEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFG 391

Query: 374 --------KSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSAYCVKLS 425
                      E  I   ++ V         + +Y QLP+KG +E FD   VSAYC  L 
Sbjct: 392 KNNKERELTGDEVFIDLEYKGVGGESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLK 451

Query: 426 HNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGE--DYKGKSLVGAFTKEIKCL 483
            N     L+ YDNV+SM  K  YV+   L GGF WESCG+  D   +SL+ AFT E+  +
Sbjct: 452 TNT----LVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLITAFTNELGKI 507

Query: 484 NKTEPTIYSLPEVVQHYLK 502
            K E +I+   +  + YL+
Sbjct: 508 KKQESSIFQDEKTFEFYLE 526

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  378 bits (971), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 290/469 (61%), Gaps = 30/469 (6%)

Query: 64  SADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSD 123
           +++ E G+++G+YYS+WSPY  R HFPHDID  +++H+YYAF +V+ +TG+   SDEWSD
Sbjct: 67  NSNGEKGYLSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSD 126

Query: 124 VQMDLYKQMISSFKKLDL-RAQFPTGSKDK--LPLGCIGELFFLKYSNFLTRNGGSAGVN 180
           +QMDLYK +      L+L   + P   +DK  LPLGCIGELF+LK+S  +   GGS+   
Sbjct: 127 LQMDLYKPLSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIP--GGSST-- 182

Query: 181 NFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEP 240
             K I+S+GGWSNR+ F  LV    K E F+DS V  MF YGFDGID+DWEFPK+D  EP
Sbjct: 183 --KMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEP 240

Query: 241 KVYLQMLKALRERLDTLESQIFG-SKDHKHHFALTSAISADEECLKYLPLQEADRYVDYW 299
             YL+M+  LR ++D LE +IFG +KDH   F L+ A  A    L  LP+ + D+YVDYW
Sbjct: 241 NKYLEMISKLRRKMDDLELEIFGETKDHP-KFQLSVATPAFIYKLSILPIIQMDQYVDYW 299

Query: 300 NLMAYDFSGAWSAQTAYQSNLYTPAKTNKRST--------NGRGSADKAVRFLTDKSKLA 351
           N+M YD+ G+WS  T Y  NL+    +  R+         N   +A++A+ F+     + 
Sbjct: 300 NMMTYDYYGSWSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVP 359

Query: 352 SKKIVLGMPAYGRGFKGVEVSHKSIENVIGKPFQDV-XXXXXXXXXISLYKQLPLKGGME 410
           S K+VLGM AYGR FK V+ S + ++ +I + F+ V          + LY QLPLKG +E
Sbjct: 360 SSKVVLGMAAYGREFKHVK-SRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVE 418

Query: 411 FFDHNAVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDY--K 468
            +D N  +A+C    ++KK    I YDNVDS+  KA YV+   LGGGFWWESCG+D+  K
Sbjct: 419 MYDPNYGAAFC----YDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINK 474

Query: 469 GKSLVGAFTKEIKCLNK--TEPTIYSLPEVVQHYLKLH-PGGFLASTFQ 514
            +SL+  F+ E+  + K   +  I+   E + +YL  +   GFL+   Q
Sbjct: 475 RRSLLYNFSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  379 bits (974), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/564 (39%), Positives = 309/564 (54%), Gaps = 78/564 (13%)

Query: 10  KFLVAICVTGIILEAIYTGRIQTSTKMRAFQEHF-------------------NNLGRSG 50
           +FL+ + +   IL+   T     S K +   +H+                   N  G+  
Sbjct: 11  RFLILLAIICFILQMCLTKLFFNSNKEKIVTDHYKNNNNNNNNNNNNNNNDDGNKKGQHH 70

Query: 51  AML-STSNDAGT--GLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLV 107
           + L    ND      L   N + FV+G+YYS+WSPY  R HFPHDID  K+THVYY+F +
Sbjct: 71  SHLFPQENDIVNYPKLGKTNNT-FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFL 129

Query: 108 VNSETGECQLSDEWSDVQMDLYKQMISSFKKLDLRAQFPTGS------------KDKLPL 155
           VN  TG+   SDEWSD++MDLYK +      L    +                 K +LPL
Sbjct: 130 VNGATGDVTCSDEWSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPL 189

Query: 156 GCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCV 215
           GC+GELF+LK               NFK IMS+GGWSNRE F S+V    KL  F++S V
Sbjct: 190 GCVGELFYLK------------KFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSV 237

Query: 216 SKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSK-------DHK 268
            +MF+YGFDGID+DWEFP++D  EP  YL++++ LR+R+D LE  IF          DH 
Sbjct: 238 EQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHD 297

Query: 269 HH---FALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAWSAQTAYQSNLYTPA- 324
           +H   F L+ A  A  E L  LP++E ++Y+DYWN+M YD+ G WS +T Y  NLY    
Sbjct: 298 YHHPKFELSVATPAFIEKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGN 357

Query: 325 --------KTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGVEVSHKSI 376
                   K    S+N   +A+ A+ ++   + ++S+K+VLG+ AYGRGF  V+V+ K+ 
Sbjct: 358 NGTINAQYKHEHTSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVN-KND 416

Query: 377 ENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNKKQAELIVY 436
           E  I K F  V         + LY QLP+K   E FD N VSA+C    ++ K    + Y
Sbjct: 417 ELFINKKFDGVGGASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFC----YDPKTKTFVGY 472

Query: 437 DNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG--KSLVGAFTK--EIKCLNKTEPT--I 490
           DNVD+M  KA YV+  HL GGFWWESCG+D+K   +SL+ AFT   E+K L K E +  I
Sbjct: 473 DNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLI 532

Query: 491 YSLPEVVQHYLK-LHPGGFLASTF 513
           Y  P+ +++YL      GFL+  F
Sbjct: 533 YEQPDTIKYYLNYFGNDGFLSPFF 556

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  368 bits (945), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 193/458 (42%), Positives = 285/458 (62%), Gaps = 25/458 (5%)

Query: 69  SGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDL 128
           S +  G+YYSNWSPY+ R  FPHDID  +++HVYY+FL+V+ + G  + SD WSD Q+D+
Sbjct: 76  SLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDM 135

Query: 129 YKQMISSFKKLD--LRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIM 186
           YK +  S  ++D    +   +  K+ LP+GCIGE F+L+ +        S    +FK  M
Sbjct: 136 YKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKST---DFKVFM 192

Query: 187 SVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQM 246
           SVGGWSNREAF  +V  P K++ F++SC+  MF YGFDGID+DWEFP++D  EP +YL +
Sbjct: 193 SVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDI 252

Query: 247 LKALRERLDTLESQIFGSKDHKH----HFALTSAISADEECLKYLPLQEADRYVDYWNLM 302
           +K L+ ++  LE+ I+      +    HF L+ A  A +E L+ LP+Q+ D++VD WN+M
Sbjct: 253 IKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMM 312

Query: 303 AYDFSGAWSAQTAYQSNLYTPA-------KTNKRSTNGRGSADKAVRFLTDKSKLASKKI 355
            YD+SG WS  T Y SNL++P        K ++ ++N     D AV+++ D  K++S+KI
Sbjct: 313 TYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKI 372

Query: 356 VLGMPAYGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHN 415
           +LGM AYGRGF GV  S K+   + GK F  V         + LY +LP+KG  E FD  
Sbjct: 373 ILGMAAYGRGFSGVSKS-KTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKE 431

Query: 416 AVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKGK--SLV 473
           +VSAYC    ++ K    + YDN  SM+ K+ YV  N+LGGGF WE+CGE       SL+
Sbjct: 432 SVSAYC----YDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLI 487

Query: 474 GAFTKEIKCLNKTEPTIYSLPEVVQHYL-KLHPGGFLA 510
            +FT ++  ++K + +++S  +V+++YL K    GFL+
Sbjct: 488 NSFTFDMNNIDK-QKSMFSNRKVLEYYLMKYGKQGFLS 524

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  364 bits (935), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 211/515 (40%), Positives = 288/515 (55%), Gaps = 59/515 (11%)

Query: 10  KFLVAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNES 69
           KF + I V   I+E      +        F +     G +G    T  D  T + ++   
Sbjct: 13  KFWIIIIVLAFIVEMCIVPWL--------FLDKIKKGGSAGRRPPTEIDPDTRVPSEGPD 64

Query: 70  GFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLY 129
           GF    YYSNWSPY AR H P DI   +LTHVYYAF VV++++G  + SD WSD ++ L 
Sbjct: 65  GFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPL- 123

Query: 130 KQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVG 189
                             G K     GCI EL  +K  +           + FKTI+ +G
Sbjct: 124 ----------------SVGVK-----GCIKELQKIKLES----------KHEFKTILCLG 152

Query: 190 GWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKA 249
           GWSNREA+  + +S  K++ F+++ V  MF YGFDGID+DWEFP+ D+ EP VYL+M++ 
Sbjct: 153 GWSNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRG 212

Query: 250 LRERLDTLESQIFGS----KDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYD 305
           +RE +D LE QIFGS    KDH  HF L+ A  A  E L  LP+ E  +YVD WN+M YD
Sbjct: 213 IREGMDQLERQIFGSPAEEKDHP-HFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYD 271

Query: 306 FSGAWSAQTAYQSNLYTPAKTNKRS-----TNGRGSADKAVRFLTDKSKLASKKIVLGMP 360
           F G WS  T Y SNLY    +++RS     +N   S+D AV+ +TD+  ++S++I LGM 
Sbjct: 272 FHGEWSDVTGYHSNLYLQGHSHRRSLSNRISNSSLSSDTAVKLMTDRHNISSRRIALGMA 331

Query: 361 AYGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSAY 420
           AYGRGF  VE +    +N +GK +  V         I LY QLP+ G  E FD NAVSAY
Sbjct: 332 AYGRGFTNVETND---DNYLGKKYHGVGGGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAY 388

Query: 421 CVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG-KSLVGAFTKE 479
           C     + K    + YDNV SM  K  Y++K +L GGFWWESCG+     KSLV AF+KE
Sbjct: 389 CF----DPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDSKDPRKSLVNAFSKE 444

Query: 480 IKCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTFQ 514
           I  L++   +++   +V Q +L+ +P  +++S FQ
Sbjct: 445 I-GLSEGFVSLFKSDKVKQFHLQKYPKDYISSLFQ 478

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  359 bits (921), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/493 (41%), Positives = 291/493 (59%), Gaps = 46/493 (9%)

Query: 31  QTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNESGFVTGMYYSNWSPYAARKHFP 90
           Q S K+R   + FNN G     +    D   G + D E GFV+G+YYSNWSPY  R HFP
Sbjct: 41  QRSNKIR---DSFNNGGHKVPNM----DQTQGPNVDGE-GFVSGVYYSNWSPYKPRFHFP 92

Query: 91  HDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQM-ISSFKKLDLRAQFPTGS 149
           HDI+  +++HVYYAF  +N  TG  + +D WSD++M+LYK + I S + +D  +      
Sbjct: 93  HDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNSS--NDI 150

Query: 150 KDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWSNREAFTSLVESPAKLEV 209
           +  LPLGCIGELF+LK+S              FK IMS+GGWS+ E F  ++++   L+ 
Sbjct: 151 QKILPLGCIGELFYLKHS---------CSGKKFKVIMSIGGWSDSENFKVIIKNENLLQA 201

Query: 210 FLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKH 269
           F+DS V  MF+ GFDGID+DWEFP+N+  EP+ YL++++ LR +L++LESQIFG +  + 
Sbjct: 202 FVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFG-EGVED 260

Query: 270 HFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAWSAQTAYQSNLYTPAKTNKR 329
           HF L+ A  A ++ L YLP+ E D+Y+DYWN+M YD+ G+WS  T Y SNL++  +    
Sbjct: 261 HFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETEL--- 317

Query: 330 STNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGF--KGVEVSHKSIENV-IGKPFQD 386
                 S + A+ ++ DK  + S+K+VLGM AYGR F  KG      +   + I + F+ 
Sbjct: 318 ------SGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQNTILINQSFKG 371

Query: 387 VXXXXXXXXX------ISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNKKQAELIVYDNVD 440
           V               I  YK LP KG +E +D   VSAYC     ++K +  I YDN  
Sbjct: 372 VGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCF----DEKNSIFISYDNTK 427

Query: 441 SMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAFTKEIKCLNKTEPTIYSLPEVVQ 498
           S+  KA YV  N LGGGFWWESCGE Y  + +SL+ AF + ++    T+P+++    VV 
Sbjct: 428 SVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMFENERVVN 487

Query: 499 HYL-KLHPGGFLA 510
            YL K    GFL 
Sbjct: 488 FYLNKYGNNGFLT 500

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  358 bits (918), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 195/512 (38%), Positives = 290/512 (56%), Gaps = 45/512 (8%)

Query: 12  LVAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNESGF 71
            + I +T +IL+     +I    K R+  + +  +  S  + +TS              +
Sbjct: 12  FIVILITSLILQMSLHYKIFQKLKRRSQSDDYR-MPESDVLSNTS--------------Y 56

Query: 72  VTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQ 131
           + G+YYSNWSPY  R HFPHDIDF K++H+YYAFL+++ ETG    SDEWSD Q++L KQ
Sbjct: 57  IAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAKQ 116

Query: 132 ----MISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKY--SNFLTRNGGSAGVNNFKTI 185
               M   F   +L+A     +  + P GCIGEL +L+Y  S    RN         K I
Sbjct: 117 CREYMFKRFTGDELKAV----TNIRAPPGCIGELNYLRYIYSKIKKRN--------VKLI 164

Query: 186 MSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQ 245
           MSVGGWSNRE+F  +V    K + F++SC+  M  YGFDGID+DWEFP++D+ EP  YL+
Sbjct: 165 MSVGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLR 224

Query: 246 MLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYD 305
           M + L+ +L  LE+ I G   +K  F L+ A  A ++ L  LP+ + D+Y+D WNLM YD
Sbjct: 225 MARELKLQLQKLEANILGDHSNK-TFQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYD 283

Query: 306 FSGAWSAQTAYQSNLYTPA----KTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMPA 361
           + G WS +T   +NLY         ++   +   S D A+ ++ ++ K+  +K++LGM A
Sbjct: 284 YYGEWSERTGLHANLYNEKGKLLHLHRHDEDAGLSGDAAINYMVNRCKIDPRKVILGMAA 343

Query: 362 YGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSAYC 421
           YGRGF  V++   +  N  G  F  V         + LY QLP+ G  E +D+  V AYC
Sbjct: 344 YGRGFTNVDMKSTNPHNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYC 403

Query: 422 VKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG--KSLVGAFTKE 479
               ++ +   L+ YDN  S+I+KA+Y+  N LGG FWWESCG+ +K   +SL+  + + 
Sbjct: 404 ----YDDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRV 459

Query: 480 IKCLNKTEPTIYSLPEVVQHYLKLH-PGGFLA 510
           I+ +   + TIYS  ++  +YL+ +   GFL 
Sbjct: 460 IRNVKNNKETIYSTTKLHDYYLENYDTNGFLT 491

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  355 bits (911), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/495 (40%), Positives = 292/495 (58%), Gaps = 43/495 (8%)

Query: 29  RIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNESGFVTGMYYSNWSPYAARKH 88
           +I  + +    +++FNN G    + S   + GT +    +  F++G+YYSNWSPY  R H
Sbjct: 36  KIFKNQRSDDIRDNFNNGGHR--VPSNVQNHGTHIR---DEAFISGVYYSNWSPYKPRFH 90

Query: 89  FPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQMISSFKKLDLRAQFPTG 148
           FPHDI+ ++++H+YYAF  +NS TG  + +D WSD++M+LYK +     +L ++      
Sbjct: 91  FPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNSEL-IKESSNNS 149

Query: 149 SKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWSNREAFTSLVESPAKLE 208
            ++ LPLGCIGELF+LK          +     FK IMS+GGWS+ E F  +++    L+
Sbjct: 150 VQNILPLGCIGELFYLK---------NTCSDKKFKVIMSIGGWSDSENFKIIIKDDKLLQ 200

Query: 209 VFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHK 268
            F+DS V  MF  GFDGID+DWEFP N+  EP+ YL++++ LR +L++LESQIFG K  +
Sbjct: 201 NFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNSLESQIFG-KRTE 259

Query: 269 HHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAWSAQTAYQSNLYTPAKTNK 328
            HF L+ A  A ++ L YLP+ E D+YVDYWN+M YD+ G+WS  T Y SNL++  + N 
Sbjct: 260 DHFQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLFSETELN- 318

Query: 329 RSTNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGVE----------VSHKSIEN 378
                    + A+ ++ D+  + S+K+VLGM AYGR F   +          V    I  
Sbjct: 319 --------GNFAMHYMIDRFGVNSRKLVLGMAAYGRSFHIKDNKFEPFNQNTVLINKIFK 370

Query: 379 VIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNKKQAELIVYDN 438
            +GKP +++         I  YK LP  G +E +D   VSAYC     ++K +  I YDN
Sbjct: 371 GVGKPTKEI-DKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCF----DEKNSIFISYDN 425

Query: 439 VDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAFTKEIKCLNKTEPTIYSLPEV 496
             S+  KA YV  N+LGGGFWWESCGE Y  + +SL+ AF + +     ++P+I+    V
Sbjct: 426 TKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEGLHFNVSSKPSIFQDVRV 485

Query: 497 VQHYL-KLHPGGFLA 510
            ++YL K   GGFL+
Sbjct: 486 KKYYLNKYGDGGFLS 500

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  348 bits (892), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/448 (41%), Positives = 268/448 (59%), Gaps = 44/448 (9%)

Query: 71  FVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYK 130
           +V+G+YYS+WSPY  R HFP +ID  K+TH+YY+F +V++++   +L D WSD++M    
Sbjct: 51  YVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEM---- 106

Query: 131 QMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGG 190
                          P G K+ +  GCIG L  L+                FK IM+VGG
Sbjct: 107 ---------------PMG-KNTVLKGCIGALNSLRDEK-----------PGFKNIMAVGG 139

Query: 191 WSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKAL 250
           WSN++AF   +     +E    SCV  MF+YGFDGID+DWE+PK+D KEP++YL++++ +
Sbjct: 140 WSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKI 199

Query: 251 RERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAW 310
           R+ ++ LE  I+G  D K  F L+ A  A  + L+  P++E D+Y+DYWN+M YD+ G W
Sbjct: 200 RQHMNELEIAIWG--DKKRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEW 257

Query: 311 SAQTAYQSNLYTPAKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGV- 369
           S+ T + SNLY    TNK S +    AD A+R++T+K  + S+K+VLGM  YGRGF  V 
Sbjct: 258 SSGTGFHSNLYD--GTNKFSEHSL-CADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVK 314

Query: 370 EVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNKK 429
           E   K    +I + F+ V         + LY QLP++G  E FD    SAYC     + K
Sbjct: 315 EGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCF----DPK 370

Query: 430 QAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG--KSLVGAFTKEIKCLNKTE 487
              L+ YDNVDS  QKA YV  ++L GGFWWESCG  +    +SLV  F ++I+ L++ E
Sbjct: 371 TKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNE 430

Query: 488 PTIYSLPEVVQHYLKLHP-GGFLASTFQ 514
             +Y  P++ +HYL++    GFLA+TF+
Sbjct: 431 TNLYQDPKLREHYLQIFAKSGFLAATFK 458

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  348 bits (894), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/515 (39%), Positives = 292/515 (56%), Gaps = 57/515 (11%)

Query: 13  VAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNESGFV 72
           + + +  IILE  +  ++     +  F++  +++ R+ A+ + +      L       + 
Sbjct: 13  ILVLLVAIILEMTFIPKLM----IEKFKKPRSDIERT-ALSTITRPVDRNLQ---HGKYA 64

Query: 73  TGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQM 132
            G+YY++WSPY  R HFPHDIDF+++T+V YAF VV+ +TG+ Q +D WSD++M  +   
Sbjct: 65  VGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPG 124

Query: 133 ISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWS 192
           I            P G       G IGEL +LK    L RN       NF+  M+VGGWS
Sbjct: 125 I------------PQGVT-----GMIGELNYLK----LQRN------TNFRLFMAVGGWS 157

Query: 193 NREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRE 252
           NREAF  +V S  KL+ F++S +  MFEYGFDGID+DWEFPK+D  EP +YL+M   LR 
Sbjct: 158 NREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRS 217

Query: 253 RLDTLESQIFGSKDHKH-HFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAWS 311
           ++D LE +I+G+ +  +  F L+ A  A  + LK LP+ E +++V  WN+M YDF G+WS
Sbjct: 218 KMDKLEDEIWGANNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWS 277

Query: 312 AQTAYQSNLYTPAKTN----KRSTNGRG-------SADKAVRFLTDKSKLASKKIVLGMP 360
            +T Y SNLY   K N    KR   G         +AD A++ + +  K+ +KK+ LGMP
Sbjct: 278 KRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMP 337

Query: 361 AYGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVSAY 420
           AYGRGF  V+   K  ++++ K +  V         I LY QLPL    E FD   VSAY
Sbjct: 338 AYGRGFTNVQT--KDDDDLLNKKYSGVGGGSEGEPGIWLYNQLPLANTAEKFDDRWVSAY 395

Query: 421 CVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG--KSLVGAFTK 478
           C     +K     + YDN+ SM  K+ YV++ HL GGF+WESCG+ +    ++LV AF++
Sbjct: 396 CF----DKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQ 451

Query: 479 EIKCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTF 513
           E+  +    PTI+  P  + +YLK    GFL S F
Sbjct: 452 ELSEMRI--PTIFKDPRAIAYYLKHRQKGFLYSLF 484

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  348 bits (893), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/485 (40%), Positives = 287/485 (59%), Gaps = 44/485 (9%)

Query: 40  QEHFNNLGRSGAMLSTSNDAGTGLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLT 99
           +++F N GR        N   +G    ++ G+V+G+YYSNWSPY  R HFPHDI+  +++
Sbjct: 47  RDNFQN-GRHQVPNMVQNQKPSG----DDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVS 101

Query: 100 HVYYAFLVVNSETGECQLSDEWSDVQMDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIG 159
           HVYYAF  ++ +TG    +D WSD++MDLYK +     +L          +  LPLGCIG
Sbjct: 102 HVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIG 161

Query: 160 ELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMF 219
           ELF+LK          +     FK+IMS+GGWS+ E F ++V++   L+ F+DS V  MF
Sbjct: 162 ELFYLK---------NACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMF 212

Query: 220 EYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISA 279
           + GFDGIDIDWEFP+N+  EP+ YL++++ LR +L++LESQIFG    K HF L+ A  A
Sbjct: 213 KLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGST-KDHFELSIAAPA 271

Query: 280 DEECLKYLPLQEADRYVDYWNLMAYDFSGAWSAQTAYQSNLYTPAKTNKRSTNGRGSADK 339
            ++ L +LP+ E D+Y+D+WN+M YD+ G+WS  T Y SNL++  +          S + 
Sbjct: 272 FKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSETEL---------SGNF 322

Query: 340 AVRFLTDKSKLASKKIVLGMPAYGRGF-----------KGVEVSHKSIENVIGKPFQDVX 388
           A+ ++  +  +  +K+VLGM AYGR F           K   + ++  + V GKP +++ 
Sbjct: 323 AIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKNTVLINQQFKGV-GKPGKEI- 380

Query: 389 XXXXXXXXISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHY 448
                   I  YK LP KG  E +D   VSAYC     ++K +  I YDN +S+  KA Y
Sbjct: 381 DKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCF----DEKNSIFIGYDNTESIKTKADY 436

Query: 449 VEKNHLGGGFWWESCGEDY--KGKSLVGAFTKEIKCLNKTEPTIYSLPEVVQHYL-KLHP 505
           V    LGGGFWWESCGEDY  K +SL+ AF + +     ++P+++    V+++YL K   
Sbjct: 437 VMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDKRVMKYYLSKYGD 496

Query: 506 GGFLA 510
           GGFLA
Sbjct: 497 GGFLA 501

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  347 bits (890), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/458 (41%), Positives = 275/458 (60%), Gaps = 38/458 (8%)

Query: 66  DNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQ 125
           D   G+V+G+YYSNWSPY  R HFPHDI+  +++HVYYAF  +NS+TG  + +D WSD++
Sbjct: 68  DGGKGYVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLE 127

Query: 126 MDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTI 185
           M+LYK +     +L +        ++ LPLGC+GELF+LK          +     FK I
Sbjct: 128 MNLYKPLAIKSSQL-VENNLNDSVQNILPLGCVGELFYLK---------NACSEKKFKVI 177

Query: 186 MSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQ 245
           MS+GGWS+ E F ++V     L+ F+DS V  MF+ GFDGIDIDWEFP+N+  EP+ YL+
Sbjct: 178 MSIGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLK 237

Query: 246 MLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYD 305
           ++K LR +L+ LESQIFG +  + HF ++ A  A ++ L +LP+ E D+Y+DYWN+M YD
Sbjct: 238 LVKMLRLKLNNLESQIFG-ESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYD 296

Query: 306 FSGAWSAQTAYQSNLYTPAKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRG 365
           + G+WS  T Y SNL++  +          S + A+ ++ D+  + S K+VLGM AYGR 
Sbjct: 297 YYGSWSETTGYHSNLFSETEL---------SGNFAMHYMIDEFSVDSSKLVLGMAAYGRS 347

Query: 366 FKGVEVSHKSI-ENV---------IGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHN 415
           F   +   +   +N          +GKP +++         I  YK LP KG +E +D  
Sbjct: 348 FHIKDSKFQPFTQNTVLINQHFKGVGKPGKEI-DKADGKEGIWPYKSLPKKGTIEQYDPK 406

Query: 416 AVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLV 473
            VSAYC     ++K +  I YDN  S   KA YV  N LGGGFWWESCGE +  K +SL+
Sbjct: 407 YVSAYCF----DEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLI 462

Query: 474 GAFTKEIKCLNKTEPTIYSLPEVVQHYL-KLHPGGFLA 510
            AF + I+    ++P+++    V++ YL K    GFL+
Sbjct: 463 NAFNEGIRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLS 500

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  328 bits (840), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/519 (37%), Positives = 282/519 (54%), Gaps = 60/519 (11%)

Query: 13  VAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNESGFV 72
           + I V  I+LE  +  ++         +E  +   R   +           +   +  + 
Sbjct: 13  ILILVAAIVLEMTFLPKL--------IKEKLSRRIRPKPLEVHEETRPVPDAPYPDGEYT 64

Query: 73  TGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQM 132
            G+YYS+WSPY  R H+P +IDF+++THVYYAF VV+ +TG+    D+WSD +M      
Sbjct: 65  VGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM------ 118

Query: 133 ISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWS 192
                 ++L    P G       G IGEL +LK     TR G      +FK +M+VGGWS
Sbjct: 119 -----PMNLTG-MPRGLN-----GAIGELNYLK-----TRPG-----TDFKLMMAVGGWS 157

Query: 193 NREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRE 252
           NRE F  +V    K   F+DS +  MFEYGFDGID+DWEFPK+D  EP++YL+M   LR 
Sbjct: 158 NREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRH 217

Query: 253 RLDTLESQIFGS-KDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAWS 311
           ++D LE  I+G     +  F L+ A  A  + L   P++E ++Y+  WN+M YD+ GAWS
Sbjct: 218 KMDELEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWS 277

Query: 312 AQTAYQSNLY----TPAKT--NKRSTNGRG-------SADKAVRFLTDKSKLASKKIVLG 358
            +T Y SNLY    +P K+  +KR     G       +A  A+  +T++ K++ +KI LG
Sbjct: 278 ERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALG 337

Query: 359 MPAYGRGFKGVEVSHKSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAVS 418
           M AYGRGF  V       E +IG+ +  V         + LY QLPL  G E FD+  VS
Sbjct: 338 MAAYGRGFTNVRGDG---EQLIGQKYSGVGGGSEGEPGMWLYNQLPLAHGPEKFDNVWVS 394

Query: 419 AYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKGK--SLVGAF 476
           AY    S++     L+VYDNVDSM  K  YV+   L G F WESCG+++K K  +LV AF
Sbjct: 395 AY----SYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAF 450

Query: 477 TKEIKCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTFQN 515
           T+ +K   K   T Y   +++Q+YL+  P GFL   +++
Sbjct: 451 TENMKGARKA--TAYKDSKLIQYYLRTRPEGFLVPMYRH 487

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  305 bits (781), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 174/457 (38%), Positives = 250/457 (54%), Gaps = 53/457 (11%)

Query: 71  FVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYK 130
           F  G+YYSNWS Y  R HFPH+I+F  ++HVYYAF +V+ + G+    D+W+D Q  + K
Sbjct: 58  FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILK 117

Query: 131 QMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGG 190
                               +KL  G +GELF LK  N              K IM +GG
Sbjct: 118 N-------------------NKLVKGNVGELFDLKMKN------------RVKCIMCIGG 146

Query: 191 WSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKAL 250
           WSNREA+      P+K+E F +  V  MFEYGFDGID+DWE+P++D  EP++YL++++ +
Sbjct: 147 WSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRI 206

Query: 251 RERLDTLESQIF-GSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGA 309
           +  ++ LES+IF  +     +F L+ A  A ++ L+  PL+E D  +DYWN+M YD+ G 
Sbjct: 207 KHHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGE 266

Query: 310 WSAQTAYQSNLYTPAK--TNKRSTNGRG-------SADKAVRFLTDKSKLASKKIVLGMP 360
           WS +T Y SNLY  +K  T   S    G       + D AV+++ ++  +   KI+LGM 
Sbjct: 267 WSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMINQG-IKKDKIILGMA 325

Query: 361 AYGRGFKGVEVSH---KSIENVIGKPFQDVXXXXXXXXXISLYKQLPLKGGMEFFDHNAV 417
           AYGRGF  V+V           IG+ F  V         +  Y QLP+ G +E FD   V
Sbjct: 326 AYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRYV 385

Query: 418 SAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG--KSLVGA 475
           S YC + +        + YD +DS+  K  Y++   +GGGFWWESCG+ +K   +SLV A
Sbjct: 386 SGYCFEPT----TGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNA 441

Query: 476 FTKEIKCLNKTEP-TIYSLPEVVQHYLK-LHPGGFLA 510
           + KE+   N  +P +IY     V HY +  H  GFL+
Sbjct: 442 YVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLS 478

>Ecym_4697 Chr4 (1363306..1365618) [2313 bp, 770 aa] {ON} similar to
           Ashbya gossypii ABR212C
          Length = 770

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 13/84 (15%)

Query: 230 WEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKY-LP 288
           W FP+ND  +    LQ+  A+R+ +  LE+            A    I  DE  L+  LP
Sbjct: 574 WSFPRNDIDQKIQALQLALAIRDEVTDLEA------------AGIKVIQVDEPALREGLP 621

Query: 289 LQEADRYVDYWNLMAYDFSGAWSA 312
           L++     DY+N  A  F  A S 
Sbjct: 622 LRDGQERADYFNWAAEAFRVATSG 645

>KLTH0C07018g Chr3 (608415..610721) [2307 bp, 768 aa] {ON} highly
           similar to uniprot|P05694 Saccharomyces cerevisiae
           YER091C MET6 Cobalamin-independent methionine synthase
           involved in amino acid biosynthesis also called
           N5-methyltetrahydrofolate homocysteine methyltransferase
           or 5-methyltetrahydropteroyltriglutamate homocysteine
           methyltransferase
          Length = 768

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 36/85 (42%), Gaps = 13/85 (15%)

Query: 228 IDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKY- 286
           + W FP+ND  +    LQ+  ALR+ ++ LE+            A    I  DE  L+  
Sbjct: 572 LRWSFPRNDVDQKTQALQLALALRDEVNDLEA------------AGIKVIQVDEPALREG 619

Query: 287 LPLQEADRYVDYWNLMAYDFSGAWS 311
           LPL+  D    Y    A  F  A S
Sbjct: 620 LPLRAGDERAAYLQWAAESFRVATS 644

>Kwal_27.10898 s27 (546649..548955) [2307 bp, 768 aa] {ON} YER091C
           (MET6) - vitamin B12-(cobalamin)-independent isozyme of
           methionine synthase (also called
           N5-methyltetrahydrofolate homocysteine methyltransferase
           or 5-methyltetrahydropteroyl triglutamate homocysteine
           methyltransferase) [contig 33] FULL
          Length = 768

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 13/88 (14%)

Query: 228 IDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKY- 286
           + W FP+ND  +    +Q+  ALR+ ++ LE+            A    I  DE  L+  
Sbjct: 572 LRWSFPRNDVDQKTQAMQLALALRDEVNDLEA------------AGIKVIQVDEPALREG 619

Query: 287 LPLQEADRYVDYWNLMAYDFSGAWSAQT 314
           LPL+  +    Y    A  F  A S  T
Sbjct: 620 LPLRAGEERAAYLQWAAESFRVATSGVT 647

>Skud_5.212 Chr5 complement(333916..336219) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 13/83 (15%)

Query: 230 WEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKY-LP 288
           W FP++D  +    +Q+  ALR+ ++ LE+            A  + I  DE  L+  LP
Sbjct: 574 WSFPRDDVDQKTQAMQLALALRDEVNDLEA------------AGINVIQVDEPALREGLP 621

Query: 289 LQEADRYVDYWNLMAYDFSGAWS 311
           L+E      Y+   A  F  A S
Sbjct: 622 LREGAERSAYYTWAAEAFRVATS 644

>YER091C Chr5 complement(339864..342167) [2304 bp, 767 aa] {ON}
           MET6Cobalamin-independent methionine synthase, involved
           in methionine biosynthesis and regeneration; requires a
           minimum of two glutamates on the methyltetrahydrofolate
           substrate, similar to bacterial metE homologs
          Length = 767

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 13/83 (15%)

Query: 230 WEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKY-LP 288
           W FP++D  +    +Q+  ALR+ ++ LE+            A    I  DE  L+  LP
Sbjct: 574 WSFPRDDVDQKTQAMQLALALRDEVNDLEA------------AGIKVIQVDEPALREGLP 621

Query: 289 LQEADRYVDYWNLMAYDFSGAWS 311
           L+E      Y+   A  F  A S
Sbjct: 622 LREGTERSAYYTWAAEAFRVATS 644

>Smik_5.232 Chr5 complement(348431..350734) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 13/83 (15%)

Query: 230 WEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKY-LP 288
           W FP++D  +    +Q+  ALR+ ++ LE+            A    I  DE  L+  LP
Sbjct: 574 WSFPRDDVDQKTQAMQLALALRDEVNDLEA------------AGIKVIQVDEPALREGLP 621

Query: 289 LQEADRYVDYWNLMAYDFSGAWS 311
           L+E      Y+   A  F  A S
Sbjct: 622 LREGAERSAYYTWAAEAFRVATS 644

>Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 13/83 (15%)

Query: 230 WEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKY-LP 288
           W FP++D  +    +Q+  ALR+ ++ LE+            A    I  DE  L+  LP
Sbjct: 574 WSFPRDDVDQRTQAMQLALALRDEVNDLEA------------AGIKVIQVDEPALREGLP 621

Query: 289 LQEADRYVDYWNLMAYDFSGAWS 311
           L+E      Y++  A  F  A S
Sbjct: 622 LREGAERSAYYSWAAEAFRVATS 644

>ABR212C Chr2 complement(802388..804694) [2307 bp, 768 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER091C
           (MET6)
          Length = 768

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 13/83 (15%)

Query: 230 WEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKY-LP 288
           W FP++D  +    LQ+  ALR+ ++ LES            A    I  DE  ++  LP
Sbjct: 573 WSFPRDDIDQRTQALQLAFALRDEVNDLES------------AGIKVIQVDEPAIREGLP 620

Query: 289 LQEADRYVDYWNLMAYDFSGAWS 311
           L+  +    Y N  A  F  A S
Sbjct: 621 LRAGEERSAYLNWAAQAFRVATS 643

>KLLA0E20065g Chr5 complement(1786006..1788312) [2307 bp, 768 aa]
           {ON} highly similar to uniprot|P05694 Saccharomyces
           cerevisiae YER091C MET6 Cobalamin-independent methionine
           synthase involved in amino acid biosynthesis also called
           N5-methyltetrahydrofolate homocysteine methyltransferase
           or 5-methyltetrahydropteroyltriglutamate homocysteine
           methyltransferase
          Length = 768

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 36/86 (41%), Gaps = 13/86 (15%)

Query: 228 IDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKY- 286
           + W FP++D  +     Q+  A+R+ +  LE+            A    I  DE  ++  
Sbjct: 572 LRWSFPRDDVDQKTQAYQLALAIRDEVSDLEA------------AGIKVIQVDEPAVREG 619

Query: 287 LPLQEADRYVDYWNLMAYDFSGAWSA 312
           LPL+      +Y+N  A  F  A S 
Sbjct: 620 LPLRAGQERTEYYNWSAESFRVATSV 645

>Suva_13.352 Chr13 complement(583952..585640) [1689 bp, 562 aa] {ON}
           YMR171C (REAL)
          Length = 562

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 153 LPLGCIGELFFLKYSNFLTR---NGGSAGVNNFKTIMSVG 189
           LP+ CI ++++ ++  F T    N G++G N FK ++S G
Sbjct: 229 LPIPCINKVYYCEFKIFETDGPLNNGASGDNAFKNVISFG 268

>TPHA0D03950 Chr4 (827439..828944) [1506 bp, 501 aa] {ON} Anc_3.431
           YGR093W
          Length = 501

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 63/161 (39%), Gaps = 44/161 (27%)

Query: 235 NDAKEPKVYLQMLKALRERLDTLESQIFGSK---------------------DHKHHFAL 273
           +D KE  + LQ L+   E++D L S I GSK                     + K+HF+ 
Sbjct: 105 DDRKE--LILQKLEMFNEKVDILISHIGGSKHSKEAGRNSGSDIIDAILRKVEPKYHFSY 162

Query: 274 TSAISADEECLKYLPLQ--EADRYVDYWNLMAYDFSGAWS---------AQTAYQ----- 317
              +   E      P Q  ++ R     N+  +     W+          ++AY+     
Sbjct: 163 NDQLKYYENA----PFQWKKSGRITRCMNIPVFGSKEKWAYAVLIELDDNESAYEVPPNI 218

Query: 318 -SNLYTPAKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVL 357
            SN +  +K NKR    + + D  V   T ++++   KIVL
Sbjct: 219 GSNPFEESKQNKRGREAKYTTDIKVNPFTKETQMKKPKIVL 259

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,821,203
Number of extensions: 2389309
Number of successful extensions: 6164
Number of sequences better than 10.0: 31
Number of HSP's gapped: 6199
Number of HSP's successfully gapped: 31
Length of query: 515
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 401
Effective length of database: 40,409,475
Effective search space: 16204199475
Effective search space used: 16204199475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)