Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F15884g5.442ON32932917360.0
Kwal_55.213995.442ON32932915820.0
SAKL0G02706g5.442ON33233214390.0
Smik_4.6385.442ON34634613500.0
TDEL0D025905.442ON33033213480.0
Skud_4.6415.442ON34634613350.0
KAFR0D050605.442ON32632913320.0
YDR372C (VPS74)5.442ON34534513330.0
KLLA0E02355g5.442ON32432613230.0
Suva_2.5445.442ON34634613240.0
CAGL0A02926g5.442ON32832913110.0
ZYRO0F10208g5.442ON33233213060.0
KNAG0B042005.442ON34434413050.0
Ecym_45135.442ON33333112951e-180
NCAS0F034305.442ON33233312871e-179
Kpol_1016.25.442ON32832912791e-178
ACL165C5.442ON33132912621e-175
NDAI0B057205.442ON36536512461e-172
TBLA0A064805.442ON33433412381e-171
TPHA0J026105.442ON32932911901e-164
Kpol_1062.245.442ON2762769291e-125
TBLA0A027805.442ON3873048981e-119
NCAS0H020905.442ON3452845737e-71
Skud_15.4828.790ON33643702.7
ABL179C2.30ON74081694.7
KAFR0H021508.349ON702132685.5
NDAI0A003201.33ON49798676.4
ZYRO0F07172g8.667ON50640669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F15884g
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   673   0.0  
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   613   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   558   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   524   0.0  
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   523   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   518   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   517   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   518   0.0  
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   514   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   514   0.0  
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   509   0.0  
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   507   0.0  
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   507   0.0  
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   503   e-180
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   500   e-179
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   497   e-178
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   490   e-175
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   484   e-172
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   481   e-171
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   462   e-164
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   362   e-125
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   350   e-119
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   225   7e-71
Skud_15.482 Chr15 complement(842032..843042) [1011 bp, 336 aa] {...    32   2.7  
ABL179C Chr2 complement(69348..71570) [2223 bp, 740 aa] {ON} Syn...    31   4.7  
KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {O...    31   5.5  
NDAI0A00320 Chr1 (45071..46564) [1494 bp, 497 aa] {ON} Anc_1.33        30   6.4  
ZYRO0F07172g Chr6 (579706..581226) [1521 bp, 506 aa] {ON} conser...    30   9.9  

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/329 (100%), Positives = 329/329 (100%)

Query: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60
           MSGLQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM
Sbjct: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120
           GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT
Sbjct: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT
Sbjct: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240
           EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI
Sbjct: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240

Query: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300
           CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE
Sbjct: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300

Query: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           EVVSNQDASLQLECVAGVFEVFSRMDTLL
Sbjct: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/329 (90%), Positives = 313/329 (95%)

Query: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60
           MSGLQRRRVNKSES    +PV+++E +GE KRVAYDPEEA L+D+ T PKLNLMEEVLLM
Sbjct: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLM 60

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120
           GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQV+ND ARKRFDVSERLVEVINATKT
Sbjct: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKT 120

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT
Sbjct: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240
           EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFP+SV FKL+RTLSLI
Sbjct: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLI 240

Query: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300
           CGAYGANVLENVL SLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVN+NKE+QE
Sbjct: 241 CGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQE 300

Query: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           E+ +N DA L+LE VAGVFEVFSRMDTLL
Sbjct: 301 EIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/332 (81%), Positives = 302/332 (90%), Gaps = 3/332 (0%)

Query: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEG---KRVAYDPEEAKLRDDTTTPKLNLMEEV 57
           MSGLQRRRVN++ S  ++ P+ + +++ E    ++VAYDPEEAKL+++TT PKL LMEEV
Sbjct: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60

Query: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINA 117
           LLMGLKDKEGYLSFWNDNISYALRGCILIELALR KI+VL+DPARKRFDVS+RL+EVI+ 
Sbjct: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120

Query: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177
           +KTGEVLLDEALNL+KNDEPL IANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180

Query: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTL 237
           LRTEMKNFFLFDM THPITDTSCKEAIKRR+LSVLVSRNM+LNYNEYF  ++ FK+IRTL
Sbjct: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240

Query: 238 SLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKE 297
           SLICGAYGANVLENVL+SLDY+KRDRAFSRADEILAQFS+FPFALDK TE+GISVNLNKE
Sbjct: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300

Query: 298 VQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           VQ E+  N    LQLE VAGVFEVFSRMDTLL
Sbjct: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/346 (73%), Positives = 296/346 (85%), Gaps = 17/346 (4%)

Query: 1   MSGLQRRRVNKSES--ISSQDP---------------VVNDETDGEGKRVAYDPEEAKLR 43
           MS LQRRRVN+++S   SS  P                V+D+ +G  K++AYDPEE+KLR
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60

Query: 44  DDTTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARK 103
           D+   P L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALRGKI++L+D ARK
Sbjct: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120

Query: 104 RFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQ 163
           RFD+SERL+EVI+ +KTGEVLLDE L LMKNDEPLTI+NWIDLLSGETWN +KI+YQLKQ
Sbjct: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 164 VRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNE 223
           VRERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 224 YFPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALD 283
           YFP +  FK+IRTL+LICG+YGANVLENVL++L+YEKRD+A SRA+EI+AQFSQFPF L+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300

Query: 284 KQTETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           K+TE GISVNLNKEV+EE+ SN   +LQLE +AGVFEVFSRMD LL
Sbjct: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/332 (76%), Positives = 291/332 (87%), Gaps = 5/332 (1%)

Query: 1   MSGLQRRRVNKSES---ISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEV 57
           MS LQRRRVN+ +S    S Q    N+ T    KRVAYDPEEAK+ ++   PKL LMEEV
Sbjct: 1   MSNLQRRRVNRVDSGDESSLQASEFNETT--TSKRVAYDPEEAKITENVKNPKLTLMEEV 58

Query: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINA 117
           LL+GL+DKEGYLSFWNDNISYALRGCI+IELALRGKI++++D ARKRFDVSERL+EV++A
Sbjct: 59  LLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDA 118

Query: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177
           +KTGEVLLDE L LMK DEPLTIANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGV
Sbjct: 119 SKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 178

Query: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTL 237
           LRTEMKNFFLFDM THP+TDTSCKEA+KRR+LSVLVSRNM+L+YNEYFP +  FKLIRT+
Sbjct: 179 LRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTI 238

Query: 238 SLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKE 297
           +LICG+Y ANVLENVL+SLDYEKRDRA SRADEIL Q++Q+PF LDK TE+G+S+NLNKE
Sbjct: 239 ALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKE 298

Query: 298 VQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           V+EE+  N+D  LQLE VAGVFEVFSRMD LL
Sbjct: 299 VKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/346 (71%), Positives = 293/346 (84%), Gaps = 17/346 (4%)

Query: 1   MSGLQRRRVNKSESI-------------SSQDPVVN----DETDGEGKRVAYDPEEAKLR 43
           MS LQRRRVN+++S              S  D + N    D+  G  K++AYDPEE+KLR
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAYDPEESKLR 60

Query: 44  DDTTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARK 103
           D+   P L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCILIELALRGKI++L+D ARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 104 RFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQ 163
           RFD+SERLVEV++ +KTGEVLLDE L LMKNDEPLTI+NWIDLLSGETWN +KI+YQLKQ
Sbjct: 121 RFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 164 VRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNE 223
           VRERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 224 YFPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALD 283
           YFP +  FK+IRTL+LICG+YGANVLENVL++L+YEKRD+A +RA+EI+AQFSQ+PF L+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLE 300

Query: 284 KQTETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           K+TE G+SVNLNKEV+EE+ +N    LQLE +AGVFEVFSRMD LL
Sbjct: 301 KETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/329 (76%), Positives = 284/329 (86%), Gaps = 3/329 (0%)

Query: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60
           MS LQRRR N+S+S +     V++  D   ++VAYDPEEAKLRD+ + PKL LMEEVLLM
Sbjct: 1   MSTLQRRRKNRSDSNADDSENVSESQD---RKVAYDPEEAKLRDNVSIPKLTLMEEVLLM 57

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120
           GL+D+EGYLSFWNDNISYALRGCILIELALR KI++L+D ARKRFDVSERLVEVI+ +KT
Sbjct: 58  GLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVEVIDGSKT 117

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDEAL LMKNDEPLTIANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLRT
Sbjct: 118 GEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 177

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240
           EMKNFFLFDM THP+TDTSCKEAIKRRILS LVSRNM+LNYN YF  +  FK IR ++L+
Sbjct: 178 EMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKYIRIVALV 237

Query: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300
           C +YGANVLENVLSSLDYEKRDRA SRA+EILAQF+Q+PF L K TE GISVNLNKEV+ 
Sbjct: 238 CCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVNLNKEVEN 297

Query: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           EV  N   +LQLE +AGV EVFSRMD LL
Sbjct: 298 EVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/345 (72%), Positives = 296/345 (85%), Gaps = 16/345 (4%)

Query: 1   MSGLQRRRVNKSES-----ISSQ------DPVVN-----DETDGEGKRVAYDPEEAKLRD 44
           MS LQRRRVN+++S     I S       D + N     D+ +G  K++AYDPEE+KLRD
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60

Query: 45  DTTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKR 104
           +   P L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALRGKI++L+D ARKR
Sbjct: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120

Query: 105 FDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQV 164
           FD+SERL+EVI+++KTGEVLLDE L LMKNDEPL+I+NWIDLLSGETWN +KI+YQLKQV
Sbjct: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180

Query: 165 RERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEY 224
           RERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNEY
Sbjct: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240

Query: 225 FPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDK 284
           FP +  FK+IRTL+LICG+YGANVLENVL++L+YEKRD+A SRA+EI+AQFSQ+PF L+K
Sbjct: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300

Query: 285 QTETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           +TE G+SVNLNKEV+EE+ +N    LQLE +AGVFEVFSRMD LL
Sbjct: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/326 (75%), Positives = 285/326 (87%), Gaps = 4/326 (1%)

Query: 4   LQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLMGLK 63
           LQRRRVNK ++  S  P +++E D    ++ YD +EAKLRD+T+ PKL LMEEVLLMGLK
Sbjct: 3   LQRRRVNKGDTTESI-PQIDNEHD---HKIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLK 58

Query: 64  DKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKTGEV 123
           DK+GYLSFWNDNISYALRGCILIELALRGKI+ ++DPARKR+DVSERL+EVI+ +KTGEV
Sbjct: 59  DKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEV 118

Query: 124 LLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMK 183
           LLDE+L+LMKND P +I  WIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLRTEMK
Sbjct: 119 LLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMK 178

Query: 184 NFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLICGA 243
           NFFLFDM THPITDT+CKE+IKRRILS+LVSRN +L YN YFP  V FK IRTLSLICGA
Sbjct: 179 NFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGA 238

Query: 244 YGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQEEVV 303
           YGANVLENVL++LDYE RD  F+RADEILAQFS+FPF LDKQT TG+SVNLNKE+ +E+ 
Sbjct: 239 YGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELN 298

Query: 304 SNQDASLQLECVAGVFEVFSRMDTLL 329
           ++  + LQLE VAGVFEVFSRMDTLL
Sbjct: 299 NHPGSDLQLEVVAGVFEVFSRMDTLL 324

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/346 (71%), Positives = 291/346 (84%), Gaps = 17/346 (4%)

Query: 1   MSGLQRRRVNKSESI-------------SSQDPVVNDETDGE----GKRVAYDPEEAKLR 43
           MS LQRRRVN+++S              SS D   N   DG+     K++AYDPEE+KLR
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60

Query: 44  DDTTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARK 103
           D+   P L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCILIELALRGKI++L+D ARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 104 RFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQ 163
           RFD+SERLVEVI+ +KTGEVLLDE L LMKNDEPLTI+NWIDLLSGETWN +KI+YQLKQ
Sbjct: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 164 VRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNE 223
           VRERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 224 YFPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALD 283
           YFP +  FK+IRTL+LICG+YGANVLENVL++L+YEKRD+A SRA+EI++ FSQ+PF L+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300

Query: 284 KQTETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           K T+ G+SVNLNKEV+EE+ +N    LQLE +AGVFEVFSRMD LL
Sbjct: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/329 (74%), Positives = 289/329 (87%), Gaps = 1/329 (0%)

Query: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60
           MS LQRRRVNKSE+ S+      D+    GK +AYDPEE+KL++D+  P L LMEEVLLM
Sbjct: 1   MSTLQRRRVNKSENASNGIEDREDDGTSSGK-IAYDPEESKLQNDSKQPTLTLMEEVLLM 59

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120
           GL+D+EGYLSFWND+ISYALRGCILIELALR KI++L+ PAR RFD+SERL+EVI+++KT
Sbjct: 60  GLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKT 119

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDE L LM NDEPL+IANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLRT
Sbjct: 120 GEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 179

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240
           EMKNFFLFDM THP++D+SCKEAIKRRILSVLVSRNM+++YN YFP S  FKLIRT+SLI
Sbjct: 180 EMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLI 239

Query: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300
            GAYGANVLENV+SSL+Y+KRD+A +RA+EILAQFSQ+PF L K+++ GISVNLNKE+QE
Sbjct: 240 AGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQE 299

Query: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           E+ SN  + L+LE +AGVFEVFSRMD LL
Sbjct: 300 ELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  507 bits (1306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/332 (74%), Positives = 287/332 (86%), Gaps = 3/332 (0%)

Query: 1   MSGLQRRRVNKSESI-SSQDPV--VNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEV 57
           MSGLQRRRVN+ +S  S+ +P   +  + D   K+VAYDPEE KL D+   PKL LMEEV
Sbjct: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKLTLMEEV 60

Query: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINA 117
           LL+GL+DKEGYLSFWNDNISYALRGCI+IELALRGKI+V++D ARKRFDVSERL+EV ++
Sbjct: 61  LLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120

Query: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177
           +KTGEVLLDEAL LMK DEPL+I NWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180

Query: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTL 237
           LRTEMKNFFLFDM THP+TDTSCKEAIKRRILSVLV RN++LNYN+YF   V FKLIRT+
Sbjct: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240

Query: 238 SLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKE 297
           +LICGAY ANVLENVL+SL YEKRD A  RADEIL QFS++PF LD QTE+GIS+NLNKE
Sbjct: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300

Query: 298 VQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           V +E+  + +++LQLE +AGVFEVFSRMD LL
Sbjct: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  507 bits (1305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/344 (71%), Positives = 286/344 (83%), Gaps = 15/344 (4%)

Query: 1   MSGLQRRRVNKSES---------------ISSQDPVVNDETDGEGKRVAYDPEEAKLRDD 45
           MS LQRRRVN+S+S                +S D    +ET G  ++VAYDPEEAKLRD+
Sbjct: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60

Query: 46  TTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRF 105
            T PKL LMEEVLLMGL+D+EGYLSFWNDNISYALRGCI+IELALR KI++L+D ARKRF
Sbjct: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120

Query: 106 DVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVR 165
           D+SERLVEV++ +KTGEVLLDE L LMKNDEPLTIANWIDLLSGETWN MKI+YQLKQVR
Sbjct: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180

Query: 166 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYF 225
           ERLAKGLVDKGVLRTEMKNFFLFDM THP+TD+SCKEAIKRRILS +VSRNM+L++N YF
Sbjct: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240

Query: 226 PSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQ 285
           P S  FK IRT++L+C  YGA+VLENVLSSLDYE+RDRA SRA+E+L +F Q+PF L+KQ
Sbjct: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300

Query: 286 TETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
            ++GIS NLNKE Q EV  + +++L LE VAGV EVFSRMD LL
Sbjct: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  503 bits (1295), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 246/331 (74%), Positives = 279/331 (84%), Gaps = 5/331 (1%)

Query: 4   LQRRRVNKSE----SIS-SQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVL 58
           LQRRRVNK+E    S+  +Q     DE D    +VAYDPE+ KLR++T  P L LMEEVL
Sbjct: 3   LQRRRVNKAEVGGTSVELTQRKHGEDEDDKGSHKVAYDPEDQKLRENTKEPTLTLMEEVL 62

Query: 59  LMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINAT 118
           LMGLKDKEGYLSFWND+ISY+LRGCILIELALRGKI+V+ D ARKRFD+SERLVEVI  +
Sbjct: 63  LMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLVEVIETS 122

Query: 119 KTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVL 178
           KTGE LLDE L+LMK++EPL+I NWIDLLSGETWN +KISYQLKQVRERLAKGLVDKGVL
Sbjct: 123 KTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGLVDKGVL 182

Query: 179 RTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLS 238
           RTEMKNFFLFDM THP+ D+SCKE+IKRR+LSVLV RN+ L+Y EYFP SV FK +RT++
Sbjct: 183 RTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFKYLRTIA 242

Query: 239 LICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEV 298
           LICGAYGANVLENVLSSLDYEKR+R FSRA+EIL QFSQ+PFALDK  ETGISVNL  +V
Sbjct: 243 LICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISVNLYNQV 302

Query: 299 QEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           +EE+  N    LQLE VAGVFEVFSRMD  L
Sbjct: 303 KEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  500 bits (1287), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 245/333 (73%), Positives = 283/333 (84%), Gaps = 5/333 (1%)

Query: 1   MSGLQRRRVNKSES---ISSQDPVVNDETDGEGKRVAYDPEEAKLRD-DTTTPKLNLMEE 56
           MS LQRRRVNK +S     S  P V  ++D + K VAYDPEEA++R+     P L LMEE
Sbjct: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNK-VAYDPEEARMRNVGGQVPVLTLMEE 59

Query: 57  VLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVIN 116
           VLLMGL+DKEGYLSFWNDNISYALRGCILIELALRGKIQ+L+D ARKRF++SERLV+VI+
Sbjct: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119

Query: 117 ATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKG 176
            TKTGEVLLDE L LMKNDEPL+IA+WIDLLSGETWN MKI+YQLKQVRERLAKGLVDKG
Sbjct: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179

Query: 177 VLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRT 236
           VLRTEMKNFFLFDM THP+TD+SCKEAIKRR+LS+LVSRNM+L+YN YFP + RFK+IRT
Sbjct: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239

Query: 237 LSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNK 296
           ++LICGAYGANVLEN+L SLD+E  D A +RADE++AQFS+FPF L+  T  GISVNLN+
Sbjct: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299

Query: 297 EVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           EVQ+E+       LQLE +AGV EVFSRMDTLL
Sbjct: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  497 bits (1279), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 285/329 (86%), Gaps = 1/329 (0%)

Query: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60
           MS LQRRR+N+  S +++    +DE   +  ++AYDPEEAKL+DD T P L LMEEV+L+
Sbjct: 1   MSSLQRRRLNRINSDTAESSN-DDEERSKSTKIAYDPEEAKLKDDVTVPTLTLMEEVVLL 59

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120
           GL DK+GYLSFWNDNISY LRGCI+IELALR KI++L+DPARKRFD+SERLVEV++ +KT
Sbjct: 60  GLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVEVVDGSKT 119

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDEAL LMKNDEPL+IANWIDLLSGETWNF KI+YQLKQVRER++KGLVDKGVLRT
Sbjct: 120 GEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLVDKGVLRT 179

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240
           EMKNFFLFDM THP+TDTSCKEAIKRRILS LVSR M+LNYNEYFP + ++K+IRT++LI
Sbjct: 180 EMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKVIRTIALI 239

Query: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300
           C +Y ANVLENVLSSL+YEKRD A +R++ IL++F+Q+PF LDK ++  +S+NL+K V++
Sbjct: 240 CSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSINLSKLVED 299

Query: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           E+  N  ++LQLE VAGVF+VFS+MD +L
Sbjct: 300 EIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  490 bits (1262), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/329 (72%), Positives = 276/329 (83%), Gaps = 3/329 (0%)

Query: 4   LQRRRVNKS---ESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60
           LQRRRVNK+   E++       +DE +G   +VAYDPEE KLR++T  P L LMEEVLLM
Sbjct: 3   LQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLLM 62

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120
           GLKDKEGYLSF N+NISYALRGCILIELALRG+IQV++D  R+RFD SERL+EV++ +KT
Sbjct: 63  GLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKT 122

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GE LLDEAL LMK  EPLTI NW+DLLSGETWNF+KI+YQL+QVRERLAKGLVDKGVLRT
Sbjct: 123 GEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRT 182

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240
           EMKNFFLFDMPTHP+ DTSCKE+IKRRILSVLV RN++L Y E FP +V FK +RT++LI
Sbjct: 183 EMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALI 242

Query: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300
           C A+GANVLE VLS+LDYEKRDR FSRA+E+L QFSQ+PFALDK  ETGISVNLN+ VQE
Sbjct: 243 CSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQE 302

Query: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           E+  N   +L LE VAGV +V+SRMD LL
Sbjct: 303 ELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  484 bits (1246), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 246/365 (67%), Positives = 279/365 (76%), Gaps = 36/365 (9%)

Query: 1   MSGLQRRRVNKSESISSQDPVVNDETDGE-------------------GKRVAYDPEEAK 41
           MS LQRRR  +  S      V +D  D                       ++AYDPEEAK
Sbjct: 1   MSTLQRRRRPQDGSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEEAK 60

Query: 42  L-----------------RDDTTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCI 84
           L                  ++  TP L LMEEVLLMGL+DKEGYLSFWNDNISYALRGCI
Sbjct: 61  LLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 120

Query: 85  LIELALRGKIQVLNDPARKRFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWI 144
           LIELALRGKI++L+D ARKRFD+SERL+EV + +KTGEVLLDE L LMKNDEPLTIANWI
Sbjct: 121 LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI 180

Query: 145 DLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAI 204
           DLLSGETWN MKI+YQLKQVRERLAKGLVDKGVLRTEMKNFFLFDM THP+TD+SCKEAI
Sbjct: 181 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 240

Query: 205 KRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRA 264
           KRR+LSVLVSRNM+ NYNEYFP +  FK+IRT++LICGAYGANVLENVLSSLDYEK D A
Sbjct: 241 KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA 300

Query: 265 FSRADEILAQFSQFPFALDKQTETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSR 324
            +RADE++AQFS+FPF L+K T T +SVNLN+ VQ+E+  N    LQLE +AGV EVFSR
Sbjct: 301 IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR 360

Query: 325 MDTLL 329
           MDTLL
Sbjct: 361 MDTLL 365

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  481 bits (1238), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/334 (68%), Positives = 281/334 (84%), Gaps = 5/334 (1%)

Query: 1   MSGLQRRRVN-KSESISSQDPVVNDET----DGEGKRVAYDPEEAKLRDDTTTPKLNLME 55
           MS LQRRR   +S+S+ S     ND        E +RVAYDPEE K+R++ + P+L LME
Sbjct: 1   MSTLQRRRKQARSDSVGSSGTDSNDNEPTNRQAESRRVAYDPEEDKIRNNMSVPQLTLME 60

Query: 56  EVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVI 115
           EV+L+GL+DKEGYLSFWNDNISYALRGCI+IELALRGKI++L+DPARKRF++SERLVEV+
Sbjct: 61  EVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKRFELSERLVEVV 120

Query: 116 NATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDK 175
           +++KTGEVLLDEAL +M+NDEPL I+NW+DLLSGETWN  KI+YQLKQVRER++KGLVDK
Sbjct: 121 DSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKGLVDK 180

Query: 176 GVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIR 235
           GVLRTEMKNFFLFDM THP+TD+SCKEAIKRRILS+LV+R  +  YN+YFP +  FK IR
Sbjct: 181 GVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSFKYIR 240

Query: 236 TLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLN 295
           T+SLIC AYGANVLENVL+SL+Y+KRD   +RA+E+L QFSQ+PF L+KQTE G S+NLN
Sbjct: 241 TISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTSINLN 300

Query: 296 KEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
             V+EE+ ++   +L LE VAGVFEVFS+MD LL
Sbjct: 301 ALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  462 bits (1190), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 214/329 (65%), Positives = 270/329 (82%)

Query: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60
           MSG+QRRR+N+  +    D   ND++     +VA+DPEEAK++DD + PKL LMEEV+L+
Sbjct: 1   MSGVQRRRINRISNEDESDHSDNDQSRSNVSKVAFDPEEAKIKDDVSVPKLTLMEEVVLL 60

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120
           GL D EGYLSFWNDNISY LRGCILIELALRGKI++++D ARK FD+SERL+EVI+A+KT
Sbjct: 61  GLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIEVIDASKT 120

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDE L LMKNDEP +I +WIDLLSGETWNF K++YQLKQVRERL+KGLVDKGVLRT
Sbjct: 121 GEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLVDKGVLRT 180

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240
           EMKNFFLFDM THP+ D+SCKE++KRRI+S LV R + L YNEYFP S  FK+IRT+SLI
Sbjct: 181 EMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKVIRTVSLI 240

Query: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300
             AY ANVLENVL++L+YEKRD+A SRA+ +L  F  +PF L  + +  IS+NLN+ V++
Sbjct: 241 ITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISINLNQLVED 300

Query: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           E+ +N   +LQLE +AGVF+VF++MD ++
Sbjct: 301 EIKANPKTALQLEVLAGVFDVFAKMDVII 329

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  362 bits (929), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 166/276 (60%), Positives = 221/276 (80%)

Query: 54  MEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVE 113
           MEEV+L+G++DKEGYLSFWN+N+S+ LRGCILIELA RG IQV++DP+RKRFD+S+RL+E
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 114 VINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLV 173
           V+N  KTGE LLDE L +MK++E  +I+ WIDLLSGETWN  KI+ QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 174 DKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKL 233
           DKG+LRTEMKNFFLFDM THP+ D  CKE IK+RILSVL+ +   +  +EYFP +V+ + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 234 IRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVN 293
           +RT++LI  AY  +VLENV S LDY+K+D  F R  EIL Q S +PF  D ++ T I+ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 294 LNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
           LN+ V+ E+  +++ +L+LE +AGVFEVF +MD+++
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  350 bits (898), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 164/304 (53%), Positives = 223/304 (73%), Gaps = 1/304 (0%)

Query: 27  DGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILI 86
           +G+     +DPEE+   ++   P LNLMEE++L+GLKDK+GYLSFWNDNISY LRGCILI
Sbjct: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143

Query: 87  ELALRGKIQVLNDPARKRFDVSERLVEVINA-TKTGEVLLDEALNLMKNDEPLTIANWID 145
           ELALR KI+V++DP R  +DVS R++EV+   TKTG  LLDEALN+M  + P +I NWID
Sbjct: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203

Query: 146 LLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIK 205
           LLSGETWN  K + QLK VRER++KGLVDKG+L+    NF  FDM THP+ D   KE++K
Sbjct: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263

Query: 206 RRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAF 265
           +RI S+LV ++  L YN YFP +V FK+IR+L LIC AYGA+VL++ L +++Y+  D AF
Sbjct: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323

Query: 266 SRADEILAQFSQFPFALDKQTETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRM 325
            +A+++    S FP  LD++  +G+ V++ K++Q E++ +   SL LE VAGV +V  RM
Sbjct: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383

Query: 326 DTLL 329
           D+LL
Sbjct: 384 DSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  225 bits (573), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 116/284 (40%), Positives = 183/284 (64%), Gaps = 7/284 (2%)

Query: 48  TPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKR-FD 106
           TP+L LM+E+ L+ LKDKEGY+S W+  +SY LR C++IELALRGKIQ + +  +K+   
Sbjct: 62  TPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLA 121

Query: 107 VSERLVEVINATKTGEVLLDEALNLMKNDEP-LTIANWIDLLSGETWNFMKISYQLKQVR 165
             E  +EVI+ + TG+ LLD+ L LMK ++   ++++WI LLSGE+ NF+K SYQL  VR
Sbjct: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181

Query: 166 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYF 225
           +R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  + L   +YF
Sbjct: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241

Query: 226 PSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQ 285
           P +V ++++RT+ L C AYGA++L+      + E       RA  +L+ FS+FPF L++ 
Sbjct: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQ- 299

Query: 286 TETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329
               +  +LN++V +E+  + + + QLE VAG  +V + +DT+L
Sbjct: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>Skud_15.482 Chr15 complement(842032..843042) [1011 bp, 336 aa] {ON}
           YOR313C (REAL)
          Length = 336

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 255 SLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKE 297
           +LDY    RA S A   +A  ++ PFA    T T  + NL+K+
Sbjct: 244 ALDYNFMTRALSAASHQVADVAKLPFAYGYHTNTVYNKNLDKQ 286

>ABL179C Chr2 complement(69348..71570) [2223 bp, 740 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL234C
           (GYP7)
          Length = 740

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 111 LVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAK 170
           L +  N+    E+  DE    M+   PL+ A W  L  G      ++S   ++++ER+  
Sbjct: 311 LAKEFNSDGDIEISEDELNTAMERTHPLSKAEWDSLFDG----MGRLSLSAQEIKERIFH 366

Query: 171 GLVDKGVLRTEMKNFFLFDMP 191
           G +    LR  +  F L   P
Sbjct: 367 GGIKDNQLRRRVWPFLLGVFP 387

>KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {ON}
           Anc_8.349 YLR143W
          Length = 702

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 18/132 (13%)

Query: 143 WIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMKNFFL----FDMPTHPITDT 198
           ++ L+SG   +F  I + LKQ  E +A G +       E+ +F      FD+ ++  +  
Sbjct: 3   FVALVSGGKDSFFNILHCLKQGHELIALGNLYPSENEQEIDSFMFQTVGFDIVSYYSSCI 62

Query: 199 SCKEAIKRRILSVLVSRNMQLNYNEY----------FPSSVRFKLIRTLSLICGA----Y 244
           S   AI R  +    S+N++LNY +           F  +++FK     ++  GA    Y
Sbjct: 63  SKTIAIHRWPIVKNTSKNVKLNYTQTQDDEIEQLFEFLKNLQFKYPELEAVSVGAILSSY 122

Query: 245 GANVLENVLSSL 256
             N +ENV + L
Sbjct: 123 QRNRVENVCNRL 134

>NDAI0A00320 Chr1 (45071..46564) [1494 bp, 497 aa] {ON} Anc_1.33
          Length = 497

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 209 LSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFS-- 266
           L VL +    ++ ++ + ++  F L      + G Y   VL NVL  +D  KR   F+  
Sbjct: 294 LKVLPTTKYDVDIDQKYSANPGFHLFE--KRVSGMYLGEVLRNVL--VDLHKRGLIFAQY 349

Query: 267 RADEILAQFSQFPFALDKQTETGISVNLNKEVQEEVVS 304
           R ++ L    Q PF LD +  + I ++ +  ++E  +S
Sbjct: 350 RTEKQLPHRLQTPFELDSEVLSHIEIDDSTGLRETELS 387

>ZYRO0F07172g Chr6 (579706..581226) [1521 bp, 506 aa] {ON} conserved
           hypothetical protein
          Length = 506

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 76  ISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVI 115
           IS+AL+  I  E+ +  ++  +ND  RK F V  R V+++
Sbjct: 245 ISFALKNLITEEIEVNKEVSQVNDGQRKEFLVPRRFVDLL 284

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,578,465
Number of extensions: 1432895
Number of successful extensions: 4714
Number of sequences better than 10.0: 38
Number of HSP's gapped: 4831
Number of HSP's successfully gapped: 38
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)