Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0F15862g5.443ON1241124164760.0
Kwal_55.213935.443ON1233124349280.0
SAKL0G02728g5.443ON1237121140850.0
ZYRO0G01606g5.443ON1305125735240.0
TDEL0D025805.443ON1272122535000.0
Ecym_45145.443ON1246124432980.0
Suva_8.1765.443ON1270125132790.0
YOR124C (UBP2)5.443ON1272122232730.0
Kpol_1062.235.443ON1266124132710.0
Smik_15.3015.443ON1272124932510.0
NCAS0H021005.443ON1269123532310.0
Skud_15.2865.443ON1278123432240.0
KLLA0E02377g5.443ON1220124331450.0
TPHA0E017105.443ON1283124831080.0
NDAI0C015505.443ON1295122630990.0
TBLA0A064705.443ON1320125930670.0
KAFR0D050705.443ON1227121730450.0
KNAG0B041905.443ON1262121730280.0
CAGL0K10252g5.443ON1267128027950.0
ACL164C5.443ON138980821630.0
Kpol_1016.15.443ON1251121518310.0
TPHA0J026205.443ON1225124815990.0
TBLA0C012001.369ON503491263e-06
SAKL0D10120g1.369ON492591245e-06
KLTH0H13354g1.369ON495971183e-05
TDEL0D024001.369ON494531148e-05
Kwal_34.162681.369ON449971139e-05
Ecym_27171.369ON483331131e-04
KLLA0A10791g1.369ON4841161121e-04
ZYRO0G01188g1.369ON500521122e-04
CAGL0M13783g5.18ON11961291095e-04
Smik_2.497.390ON745651077e-04
AEL029W1.369ON446331050.001
Ecym_46857.390ON778421040.002
TDEL0G004105.18ON11861571030.002
NCAS0D006001.369ON4931001010.003
YBL067C (UBP13)7.390ON747681010.004
Smik_7.3141.369ON499531000.004
Suva_2.507.390ON750671000.005
KNAG0C019401.369ON49933990.006
NDAI0A016707.390ON84682990.006
KAFR0I026005.18ON121395990.007
Smik_13.4318.742ON47148970.008
Skud_6.941.369ON49953970.008
TBLA0C070205.18ON1247133980.009
Kpol_534.231.369ON49634970.009
Kpol_1003.532.307ON78848970.011
TPHA0A025101.369ON50534960.011
CAGL0K10494g1.369ON49533960.011
YFR010W (UBP6)1.369ON49933960.012
KAFR0C045201.369ON49975960.013
NDAI0H035501.369ON50253950.015
Suva_5.2177.390ON75490960.015
Klac_YGOB_Anc_5.18b5.18ON116658960.017
KAFR0L017307.390ON70184950.017
Smik_5.2447.390ON74999950.019
KLTH0B09944g5.18ON1189163950.019
TPHA0G008502.307ON78251940.022
SAKL0H00418g5.18ON119095940.023
CAGL0H10582g2.307ON79048940.027
YMR304W (UBP15)5.18ON1230111940.027
Suva_13.4955.18ON123095940.029
TBLA0D010708.742ON48364930.030
Suva_6.831.369ON50033920.034
AGL357W5.18ON1166102930.035
Skud_13.4785.18ON123195930.036
Smik_13.5215.18ON123195930.038
Ecym_56715.18ON117695930.039
TPHA0L022905.18ON119396920.040
NCAS0G036802.307ON48248920.041
KAFR0C004103.270ON76926920.045
TPHA0P006807.390ON72779920.046
Skud_5.2237.390ON74890920.046
NCAS0D023905.18ON121195920.047
KNAG0F012202.69ON78466910.048
NDAI0G007802.307ON48663910.050
NDAI0B034302.307ON85648910.053
KNAG0B023707.390ON75340910.054
TDEL0B020805.712ON102530910.055
KAFR0A075802.69ON80266910.060
NCAS0A143707.390ON72990910.062
NDAI0I025305.18ON119783900.070
YMR223W (UBP8)8.742ON47148890.078
KNAG0L022005.712ON1161126900.082
Skud_13.3928.742ON47348890.083
SAKL0E07106g2.307ON79149890.085
Suva_13.4078.742ON47148890.087
TBLA0E017605.712ON121233900.087
KNAG0A054502.307ON76449890.088
KLLA0D08459g2.69ON75066890.090
Kpol_513.255.18ON119060890.093
KLLA0A00396g5.712ON101226890.096
TPHA0A025401.137ON128631890.10
ZYRO0D07062g5.18ON1193162880.12
AGR370W7.390ON74068880.14
ABL145W2.69ON74966880.14
Smik_4.1152.307ON79048870.15
Skud_4.1332.307ON78748870.15
Kwal_55.196455.712ON97026870.15
Suva_4.1252.307ON79348870.15
YDL122W (UBP1)2.307ON80948870.16
TPHA0E008707.390ON71537870.16
Kwal_27.114442.307ON75748870.17
TDEL0A011002.69ON66166870.17
TPHA0D046605.712ON104526870.18
KLTH0G10934g2.307ON75870870.18
Kpol_1045.417.390ON712110870.18
KAFR0A069102.307ON67848860.19
Kwal_26.95985.18ON119158870.19
ZYRO0A05962g8.742ON46583860.20
NCAS0B061302.307ON77048860.20
NDAI0F002005.712ON110560860.21
Suva_14.1562.69ON78866860.21
Suva_9.305.712ON106251860.21
CAGL0J11352g2.69ON77166860.21
YIL156W (UBP7)5.712ON107151860.22
TPHA0D043508.202ON854136860.24
AGR389C2.307ON77549860.24
NCAS0G001705.712ON103026860.25
KLLA0E20351g7.390ON69742850.25
Skud_2.387.390ON74837850.26
SAKL0D03322g3.270ON76528850.26
Smik_14.1442.69ON76366850.27
TDEL0G023702.307ON74751850.28
Ecym_40095.712ON151727850.29
TBLA0B060802.307ON82463850.30
TBLA0B097602.69ON89866850.31
CAGL0H06721g5.712ON108138850.31
Kwal_27.108427.390ON71142840.32
CAGL0L01639g1.137ON114754850.33
KAFR0D021605.712ON84627850.33
Skud_10.221.137ON125533850.33
YER098W (UBP9)7.390ON75490840.33
Kpol_2001.541.137ON122325850.33
Kpol_1018.937.390ON75531840.34
Smik_9.135.712ON106026840.37
Skud_14.1482.69ON77666840.42
TDEL0C056401.137ON117873840.44
CAGL0M11198g8.742ON46164830.46
TDEL0B036708.742ON46349820.48
ZYRO0A02420g2.307ON74548830.50
TBLA0D006207.390ON117131830.51
KNAG0J008003.270ON76540830.51
Skud_9.125.712ON106426830.53
Kwal_33.144302.69ON51166820.53
KLTH0C06732g7.390ON71442830.54
CAGL0A04477g7.390ON770100820.63
SAKL0F12430g7.390ON75452820.63
KNAG0E012905.18ON119649820.65
TDEL0C015707.390ON76576820.68
SAKL0E13002g2.69ON73966820.69
KLTH0E00814g5.712ON97426820.73
SAKL0E15136g5.712ON103726820.74
NDAI0E008108.742ON49348810.79
ZYRO0B16544g5.712ON104426810.93
SAKL0H04994g8.742ON45448800.98
CAGL0I05522g7.390ON724102801.0
ZYRO0C17908g1.137ON120426801.0
Smik_10.371.137ON124726801.0
NCAS0E026107.390ON71742801.1
AFR296C5.712ON116926801.1
YJL197W (UBP12)1.137ON125426801.1
Ecym_62488.742ON46664791.1
KNAG0C035807.390ON77631801.1
Suva_6.2761.137ON125640801.2
KLLA0C06974g8.742ON446101791.4
KAFR0F015601.137ON117125791.6
KAFR0K018107.390ON71442781.8
KLLA0E08801g2.307ON77148781.9
Skud_11.3385.712ON71226781.9
Kwal_26.91518.742ON45464772.0
Kwal_14.20088.188ON42463772.0
CAGL0G02563gsingletonON63125772.1
TDEL0D035503.270ON78054772.2
Skud_2.1773.270ON78224772.3
KLTH0F03674g1.137ON119826772.3
YDL103C (QRI1)2.348ON47792772.4
KAFR0C025908.188ON97886772.5
KAFR0A042108.742ON44048763.0
NCAS0I031401.137ON120123763.2
TBLA0E025703.270ON78528763.2
KLLA0C03476g1.137ON125247763.2
KNAG0D019308.188ON98665763.3
Kpol_1055.318.202ON82291763.4
KNAG0C021801.137ON123129763.7
CAGL0G05247g8.188ON94776754.1
Suva_4.2953.270ON78225754.2
Ecym_81401.137ON126424754.7
KAFR0H001505.712ON65626744.8
Smik_5.3188.202ON90996745.4
Smik_2.1893.270ON78223736.6
AFR551W8.742ON46964737.4
NDAI0E041807.390ON82765738.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0F15862g
         (1241 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  2499   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1902   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1578   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...  1362   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1352   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1274   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  1267   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  1265   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  1264   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  1256   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1249   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  1246   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...  1216   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1201   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1198   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1186   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1177   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1170   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1081   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   837   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   709   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   620   0.0  
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    53   3e-06
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    52   5e-06
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    50   3e-05
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    49   8e-05
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    48   9e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    48   1e-04
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    48   1e-04
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    48   2e-04
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    47   5e-04
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    46   7e-04
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    45   0.001
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    45   0.002
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    44   0.002
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    44   0.003
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    44   0.004
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    43   0.004
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    43   0.005
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    43   0.006
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    43   0.006
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    43   0.007
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    42   0.008
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    42   0.008
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    42   0.009
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    42   0.009
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    42   0.011
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    42   0.011
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    42   0.011
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    42   0.012
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    42   0.013
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    41   0.015
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    42   0.015
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    42   0.017
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    41   0.017
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    41   0.019
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    41   0.019
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    41   0.022
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    41   0.023
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    41   0.027
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    41   0.027
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    41   0.029
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    40   0.030
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    40   0.034
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    40   0.035
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    40   0.036
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    40   0.038
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    40   0.039
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    40   0.040
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    40   0.041
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    40   0.045
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    40   0.046
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    40   0.046
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    40   0.047
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    40   0.048
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               40   0.050
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     40   0.053
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    40   0.054
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    40   0.055
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    40   0.060
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    40   0.062
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    39   0.070
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    39   0.078
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    39   0.082
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    39   0.083
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    39   0.085
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    39   0.087
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    39   0.087
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    39   0.088
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    39   0.090
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    39   0.093
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    39   0.096
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    39   0.10 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    39   0.12 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    39   0.14 
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    39   0.14 
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    38   0.15 
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    38   0.15 
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    38   0.15 
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    38   0.15 
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    38   0.16 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    38   0.16 
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    38   0.17 
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    38   0.17 
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    38   0.18 
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    38   0.18 
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    38   0.18 
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    38   0.19 
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    38   0.19 
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    38   0.20 
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    38   0.20 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      38   0.21 
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    38   0.21 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    38   0.21 
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    38   0.21 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    38   0.22 
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    38   0.24 
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    38   0.24 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      38   0.25 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    37   0.25 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    37   0.26 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    37   0.26 
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    37   0.27 
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    37   0.28 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    37   0.29 
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    37   0.30 
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    37   0.31 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    37   0.31 
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    37   0.32 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    37   0.33 
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    37   0.33 
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    37   0.33 
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    37   0.33 
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    37   0.33 
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    37   0.34 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    37   0.37 
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    37   0.42 
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    37   0.44 
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    37   0.46 
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    36   0.48 
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    37   0.50 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    37   0.51 
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    37   0.51 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    37   0.53 
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    36   0.53 
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    37   0.54 
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    36   0.63 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    36   0.63 
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    36   0.65 
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    36   0.68 
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    36   0.69 
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    36   0.73 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    36   0.74 
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    36   0.79 
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    36   0.93 
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    35   0.98 
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    35   1.0  
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    35   1.0  
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    35   1.0  
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    35   1.1  
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    35   1.1  
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    35   1.1  
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    35   1.1  
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    35   1.1  
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    35   1.2  
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    35   1.4  
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    35   1.6  
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    35   1.8  
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    35   1.9  
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    35   1.9  
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    34   2.0  
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    34   2.0  
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    34   2.1  
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    34   2.2  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    34   2.3  
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    34   2.3  
YDL103C Chr4 complement(275148..276581) [1434 bp, 477 aa] {ON}  ...    34   2.4  
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    34   2.5  
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    34   3.0  
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    34   3.2  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    34   3.2  
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    34   3.2  
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    34   3.3  
Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {O...    34   3.4  
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    34   3.7  
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    33   4.1  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    33   4.2  
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    33   4.7  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    33   4.8  
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    33   5.4  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    33   6.6  
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    33   7.4  
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    33   8.3  

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 2499 bits (6476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1213/1241 (97%), Positives = 1213/1241 (97%)

Query: 1    MFKDFSGSEAPVYEPADSISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLD 60
            MFKDFSGSEAPVYEPADSISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLD
Sbjct: 1    MFKDFSGSEAPVYEPADSISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLD 60

Query: 61   EIKAELAYRNSNGHDILYSALHSGVLKLPVLEYSRKPVPDPFSIGHLLDQVVLKTRYEYE 120
            EIKAELAYRNSNGHDILYSALHSGVLKLPVLEYSRKPVPDPFSIGHLLDQVVLKTRYEYE
Sbjct: 61   EIKAELAYRNSNGHDILYSALHSGVLKLPVLEYSRKPVPDPFSIGHLLDQVVLKTRYEYE 120

Query: 121  SRTCPGLNKVSVFMGVLVSPSIVPREPEDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQY 180
            SRTCPGLNKVSVFMGVLVSPSIVPREPEDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQY
Sbjct: 121  SRTCPGLNKVSVFMGVLVSPSIVPREPEDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQY 180

Query: 181  HMLSELHPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEFSHEDLATFSPDS 240
            HMLSELHPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEFSHEDLATFSPDS
Sbjct: 181  HMLSELHPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEFSHEDLATFSPDS 240

Query: 241  IRRRFAEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQ 300
            IRRRFAEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQ
Sbjct: 241  IRRRFAEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQ 300

Query: 301  IEPAWLTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFL 360
            IEPAWLTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFL
Sbjct: 301  IEPAWLTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFL 360

Query: 361  GKMAVALMSKDDVAQDSRARSFHLYQISYSPSFFFHLLGETRGVMDYGTQEIDKNYHFIN 420
            GKMAVALMSKDDVAQDSRARSFHLYQISYSPSFFFHLLGETRGVMDYGTQEIDKNYHFIN
Sbjct: 361  GKMAVALMSKDDVAQDSRARSFHLYQISYSPSFFFHLLGETRGVMDYGTQEIDKNYHFIN 420

Query: 421  LSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEA 480
            LSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEA
Sbjct: 421  LSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEA 480

Query: 481  LDSALSLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQIL 540
            LDSALSLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQIL
Sbjct: 481  LDSALSLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQIL 540

Query: 541  QFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRR 600
            QFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRR
Sbjct: 541  QFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRR 600

Query: 601  SMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSP 660
            SMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSP
Sbjct: 601  SMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSP 660

Query: 661  DQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQY 720
            DQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQY
Sbjct: 661  DQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQY 720

Query: 721  YFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTD 780
            YFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTD
Sbjct: 721  YFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTD 780

Query: 781  MVHTENRYVTPTKELAYLAFAPSNIEVEFEGTPSSGSVXXXXXXXXXXXXXXXXVIDLTS 840
            MVHTENRYVTPTKELAYLAFAPSNIEVEFEGTPSSGSV                VIDLTS
Sbjct: 781  MVHTENRYVTPTKELAYLAFAPSNIEVEFEGTPSSGSVGEAEDEEEGAIKETTEVIDLTS 840

Query: 841  VPNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQLENALE 900
            VPNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQLENALE
Sbjct: 841  VPNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQLENALE 900

Query: 901  MGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRT 960
            MGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRT
Sbjct: 901  MGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRT 960

Query: 961  KIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDGDVNRSVAIKELPAVLQIQIQRVY 1020
            KIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDGDVNRSVAIKELPAVLQIQIQRVY
Sbjct: 961  KIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDGDVNRSVAIKELPAVLQIQIQRVY 1020

Query: 1021 YDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLD 1080
            YDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAA            QRSLLD
Sbjct: 1021 YDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAATLKKELVTLKEKQRSLLD 1080

Query: 1081 KNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIA 1140
            KNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIA
Sbjct: 1081 KNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIA 1140

Query: 1141 FLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAP 1200
            FLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAP
Sbjct: 1141 FLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAP 1200

Query: 1201 ESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRVTTKCAS 1241
            ESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRVTTKCAS
Sbjct: 1201 ESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRVTTKCAS 1241

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1902 bits (4928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 906/1243 (72%), Positives = 1053/1243 (84%), Gaps = 12/1243 (0%)

Query: 1    MFKDFSGSEAPVYEPADSISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLD 60
            MFKDF  SE   YE  +  S P  +  L DG   +D GK LLY DAG+LFPFKTSERLLD
Sbjct: 1    MFKDFPDSEHTEYEVGNEGSAPGLESNLNDGQPIKDTGKTLLYADAGNLFPFKTSERLLD 60

Query: 61   EIKAELAYRNSNGHDILYSALHSGVLKLPVLEYSRKPVPDPFSIGHLLDQVVLKTRYEYE 120
            +IK ELAY+NS  HDILYS LH GVL+LP+LEYSRKP  D ++IGHL+DQVVLKTRYEY+
Sbjct: 61   DIKLELAYKNSIEHDILYSELHKGVLRLPILEYSRKPTDDVYNIGHLVDQVVLKTRYEYD 120

Query: 121  SRTCPGLNKVSVFMGVLVSPSIVPREPEDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQY 180
            S+TCPGLNK++VFMGVL++ S +P+  +D+  A +YHLK+TVKTR+HLE TRKQAGV QY
Sbjct: 121  SKTCPGLNKITVFMGVLLNSSQMPKIYDDVTQASVYHLKVTVKTRLHLERTRKQAGVPQY 180

Query: 181  HMLSELHPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEFSHEDLATFSPDS 240
            H+L ELHP DK+DL L +  DP L+DS MYVSSDTNKL+CIEIFKPEFS  DL  F PD+
Sbjct: 181  HLLPELHPFDKEDLLLTDAEDPHLIDSVMYVSSDTNKLICIEIFKPEFSQADLTEFCPDA 240

Query: 241  IRRRFAEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQ 300
            I++R++ AC K+PDLDP+ +PSQAECFSTLLKIFKGPLNRR P+DVLKTISADNKFLNSQ
Sbjct: 241  IKKRYSSACDKYPDLDPDMIPSQAECFSTLLKIFKGPLNRRGPEDVLKTISADNKFLNSQ 300

Query: 301  IEPAWLTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFL 360
            ++P WLTE+F F+LC+   ++E  +A+E+QPPDLT+YV+++SVR+LRE YTRKCLEL+FL
Sbjct: 301  LDPKWLTEKFAFKLCQANDTDEAGSAMEFQPPDLTNYVDDVSVRELRESYTRKCLELIFL 360

Query: 361  GKMAVALMSKDDVAQDSRARSFHLYQISYSPSFFFHLLGETRGVMDYGTQEIDKNYHFIN 420
            GKM+ +LM+K+D+A+DSRARSF LYQ S S SFFFHLL ETRGVMDYG+QEID+NY+F+N
Sbjct: 361  GKMSSSLMTKEDIAKDSRARSFQLYQTSNSLSFFFHLLNETRGVMDYGSQEIDRNYNFMN 420

Query: 421  LSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEA 480
            LS+C+YY+DKDIIKNYETQA LD ENIGIYFDAL +IAN KGSY LI YCRKQDVVGKEA
Sbjct: 421  LSSCYYYTDKDIIKNYETQALLDRENIGIYFDALTYIANLKGSYALIAYCRKQDVVGKEA 480

Query: 481  LDSALSLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQIL 540
            LDSALSLFGID SDT L T+PD+LLLG+YRKE SQ S QK ++LKN+LRL+AKAK S  L
Sbjct: 481  LDSALSLFGIDPSDTSLMTIPDELLLGVYRKECSQGSTQKHATLKNALRLLAKAKNSSTL 540

Query: 541  QFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRR 600
            QFY AYEPYDN +QAYSLLEV+ESVDVD+IQTAYT+KV DSPGLKIDCDRAIYT+AV++R
Sbjct: 541  QFYAAYEPYDNVHQAYSLLEVDESVDVDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKR 600

Query: 601  SMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSP 660
            SMPLFNFL EQCP F EFYSADKLTY +AL+LLQVNENASDD+ILEVFQRKW+ E V SP
Sbjct: 601  SMPLFNFLVEQCPVFEEFYSADKLTYHDALSLLQVNENASDDIILEVFQRKWNHETVLSP 660

Query: 661  DQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQY 720
            DQFL SSSALTKIGQVRNSLLINRYLETG IDV CLPA NWPTGLNNIGNTCYLNSLLQY
Sbjct: 661  DQFLKSSSALTKIGQVRNSLLINRYLETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQY 720

Query: 721  YFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTD 780
            YFCISPLRQ IV+YQKTL+EFH SIG+L SKRRIGGREVSE+EVERS+QFVYQLRDLFTD
Sbjct: 721  YFCISPLRQFIVDYQKTLAEFHDSIGNLGSKRRIGGREVSESEVERSVQFVYQLRDLFTD 780

Query: 781  MVHTENRYVTPTKELAYLAFAPSNIEVEFEGTPSSGSVXXXXXXXXXXXXXXXXVIDLTS 840
            M+HTE+R+VTP KELAYLAFAPSNIEVEFEGTP+                    VIDLT+
Sbjct: 781  MIHTESRFVTPRKELAYLAFAPSNIEVEFEGTPT-------VEPAKENSENDVEVIDLTA 833

Query: 841  VPNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQD--AAEAIGTSTRVAKISSDQLENA 898
               A +D++ML P  SE++++  Q     +D    D  A E + +STRVAKIS+DQLENA
Sbjct: 834  EGEASEDVDMLKPAESETQVVTTQL---NEDTVMNDVIATEPMVSSTRVAKISTDQLENA 890

Query: 899  LEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKV 958
            LEMGRQQDVTECIGNVLFQLESAS+P  LD+DGEQ+DLIK+LFFGKL+Q L PL DP+K+
Sbjct: 891  LEMGRQQDVTECIGNVLFQLESASDPINLDSDGEQRDLIKELFFGKLKQDLAPLKDPSKI 950

Query: 959  RTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDGDVNRSVAIKELPAVLQIQIQR 1018
            RTKIERFVSLLVNVGDHPK+VYDALDQYFK+DVLQLEDGDV R++AIKELP VLQIQIQR
Sbjct: 951  RTKIERFVSLLVNVGDHPKNVYDALDQYFKDDVLQLEDGDVKRTLAIKELPVVLQIQIQR 1010

Query: 1019 VYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSL 1078
            VYYDRE+FMPFKSIEPLPF D+IYMDRYMDT+D  M +KR+EAA            Q++L
Sbjct: 1011 VYYDREKFMPFKSIEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYKNELESLKLRQKAL 1070

Query: 1079 LDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHR 1138
            L+KNG+GMSFK+SLLET+RFL+S VLE N IE   K+ +++ I+SMLLKID EL+ +Y R
Sbjct: 1071 LEKNGNGMSFKTSLLETERFLESGVLEQNAIEIQKKDSALKAIESMLLKIDNELSEIYSR 1130

Query: 1139 IAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTE 1198
            I  L+QKLSSHFD+FK+ GYSLFAVFIHRGEASYGHYW+YIKD  +NGIWRKYNDE+VTE
Sbjct: 1131 ITALDQKLSSHFDNFKELGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTE 1190

Query: 1199 APESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRVTTKCAS 1241
            APE+EVFNF+EGNTATPYFLVYVKNG ES+I+PLHRV   C S
Sbjct: 1191 APENEVFNFTEGNTATPYFLVYVKNGHESEIQPLHRVIANCES 1233

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1578 bits (4085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 763/1211 (63%), Positives = 942/1211 (77%), Gaps = 21/1211 (1%)

Query: 36   DNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHSGVLKLPVLEYSR 95
            D+GK LLYP     FPFKTS+RLLD+I++++ + NS  HDILYS LH+GVL+LP+LEYSR
Sbjct: 34   DDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLHNGVLRLPMLEYSR 93

Query: 96   KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIVPREPEDLAAAPI 155
            K    P S+G+LLDQV LKT+YEYES+TCP LNK++VFMGVLV   I P   +D+   PI
Sbjct: 94   KKTTQPCSVGYLLDQVTLKTKYEYESKTCPELNKINVFMGVLVDQHIRPESLDDVINVPI 153

Query: 156  YHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEESDPSLLDSAMYVSSDT 215
            YHLK+TVKTR+HLE  +K  GV  YH++ +LH  DKQD+F+  ES+  L+DSA YVSSDT
Sbjct: 154  YHLKITVKTRLHLERVKKHVGVTHYHLIDQLHSFDKQDIFMTTESE-QLVDSATYVSSDT 212

Query: 216  NKLVCIEIFKPEFSHEDLATFSPDSIRRRFAEACGKFPDLDPEKVPSQAECFSTLLKIFK 275
            N+L+ IEIFKPEF+ EDLA FS + ++ R+A AC KF DLDP  VP+Q EC +TL KIFK
Sbjct: 213  NRLLRIEIFKPEFTKEDLAIFSQEKVKERYASACEKFQDLDPTSVPTQVECLNTLFKIFK 272

Query: 276  GPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEYQPPDLT 335
            GPLNRRS +D+LKTISADNKFLNSQI+P+WLTE++ F+L ET   E  E   E++PPDLT
Sbjct: 273  GPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEETGELIREFEPPDLT 332

Query: 336  DYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRARSFHLYQISYSPSFFF 395
            DYV + SVR  RE YTRKCLEL+FLGK +  L+ KD +++DS++RSF+LYQ ++S SF+F
Sbjct: 333  DYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKSRSFNLYQTNFSTSFWF 392

Query: 396  HLLGETRGVMDYGTQE-IDKNYHFINLSACHYYSDKDIIKNYETQARLDPENIGIYFDAL 454
            HLLG+ R   D+  Q+  D +YHFINLSA  YYSDKDIIKNYETQ  LDPEN+GIYFDAL
Sbjct: 393  HLLGDGRNFQDHNLQQPFDNDYHFINLSASSYYSDKDIIKNYETQISLDPENVGIYFDAL 452

Query: 455  NFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDDLLLGIYRKESS 514
            N+IAN KG YQLI YC KQ++VGKEALD AL++FGID+ DTD+ ++ D+LLL IY+ E  
Sbjct: 453  NYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKDTDVKSITDELLLSIYKNELK 512

Query: 515  QASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAY 574
             AS QKR+ LKN+LRL+AK K+S+ L+F+  YEPY +T +AY LLE+ ESVD+DIIQTAY
Sbjct: 513  AASVQKRTDLKNALRLLAKFKESKKLKFHVDYEPYTSTSKAYQLLEIGESVDLDIIQTAY 572

Query: 575  TVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQ 634
            T++V D+PGLKIDCDRA+YT+AV++RS+ LFNFL ++CP F EFY+ D  +Y+EAL+LLQ
Sbjct: 573  TIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQECPIFQEFYNIDNWSYKEALSLLQ 632

Query: 635  VNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSLLINRYLETGIIDVS 694
            VNENA+DDVILE+FQRKW QEP++SPDQFLI  +ALTK+G  RNS LIN +++TGI+DVS
Sbjct: 633  VNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALTKLGIERNSKLINNFIDTGIVDVS 692

Query: 695  CLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFH---QSIGHLESK 751
            CLPAGNWPTGLNNIGNTCYLNSLLQYYF ISPLR  ++ YQK L+ F     + G   SK
Sbjct: 693  CLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLNYQKMLNCFRDIEDATGGEISK 752

Query: 752  RRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAPSNIEVEFEG 811
            RRIG REVS+ EVERS+QFVYQLRDLF DMVHT+ R+VTPTKELAYLAFAPSNIEVEFE 
Sbjct: 753  RRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERFVTPTKELAYLAFAPSNIEVEFE- 811

Query: 812  TPSSGSVXXXXXXXXXXXXXXXXVIDLTSVPNAEQDIEMLDPVPSESEMIVEQFVDSPKD 871
               + ++                +IDL     A   I+      S+S ++       P++
Sbjct: 812  ---APTITTVAPEDLDERTNKLDIIDL-----AADGIDNETEKGSKSSLLDVHNQQKPEE 863

Query: 872  DKKQ------DAAEAIGTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASEPT 925
              +          EA+  S RVAKISSDQLEN LE+GRQQDVTECIGNVLFQLESAS+P 
Sbjct: 864  QTEDIIMGGTQEEEAVNASMRVAKISSDQLENTLELGRQQDVTECIGNVLFQLESASDPW 923

Query: 926  CLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQ 985
             L+ D EQ DLIK+LF+GK++Q L P+ +P+K+RTKIERFVSLLVN+GDHPKD+YDALD 
Sbjct: 924  SLEEDNEQHDLIKELFYGKIKQHLIPVKNPSKIRTKIERFVSLLVNIGDHPKDIYDALDL 983

Query: 986  YFKNDVLQL-EDGDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMD 1044
            YFK+D+LQL EDG+V R+VA+  LP +LQIQIQRVYYDRERFMPFKSIEPLPF ++IYMD
Sbjct: 984  YFKDDLLQLDEDGEVKRTVAVTNLPKILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMD 1043

Query: 1045 RYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLDKNGSGMSFKSSLLETKRFLQSDVL 1104
            RYMDT+DPVML KR++              Q  LL KN +G+SFK SLL+TK+FLQS+VL
Sbjct: 1044 RYMDTDDPVMLAKRDDTKKLKEELRALKDRQHQLLSKNDTGLSFKGSLLQTKKFLQSEVL 1103

Query: 1105 ENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVF 1164
            + ++I   NK   +  IDSM+ KID EL+S+Y +I  LE ++++ F++F + GYSLFA F
Sbjct: 1104 DKHEIAVENKGALVCHIDSMITKIDGELSSLYQKITALEVQIANQFNEFTKIGYSLFAAF 1163

Query: 1165 IHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFLVYVKNG 1224
            IHRGEASYGHYWIYIKD  KNGIWRKYNDESVTE P+SEVFNF+EGNTATPYFLVY+K G
Sbjct: 1164 IHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEVPQSEVFNFTEGNTATPYFLVYIKEG 1223

Query: 1225 QESQIEPLHRV 1235
             E +IEPL RV
Sbjct: 1224 HEDEIEPLKRV 1234

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 1362 bits (3524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1257 (55%), Positives = 884/1257 (70%), Gaps = 47/1257 (3%)

Query: 24   DDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHS 83
            +D G  +   TQD+GK  LYP+A + FPFKT++RLLD+I  +L++ NS+ H ILYS L +
Sbjct: 46   EDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSN 105

Query: 84   GVLKLPVLEYSRK-PVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSI 142
            G+LK PVL YSRK      +++G L+DQVVL+T++EY+S +CP  N + VFMGVL+  + 
Sbjct: 106  GILKSPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQ 165

Query: 143  VPREP-EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHML--SELHPSDKQDLFLAEE 199
                   +LA  PI+HLK+TVKTR  LE T+K+AG+  YH L  SE+HP DKQDL   + 
Sbjct: 166  QNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDS 225

Query: 200  SDPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKFPDLDPE 258
             DP LLD A+YVSSD+NKL+ IEIFKPEF S E+   F  +SI  R+  AC +F  LDP 
Sbjct: 226  KDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPT 285

Query: 259  KVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQ 318
            ++P+Q +C +TL KIFKGPLNR+S ++  KTI+ +N  LNS I+P WLT ++ F+L   +
Sbjct: 286  RIPTQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEK 345

Query: 319  ASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSR 378
              E  E  LEY PPDLT+Y  +  VR+LRE +TR+CLEL+FLG++++ L+S++ V ++ +
Sbjct: 346  DEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPK 405

Query: 379  A-RSFHLYQISYSPSFFFHLLGETRGVMDY-GTQEIDKNYHFINLSACHYYSDKDIIKNY 436
              R F + Q ++S  F+F LLGE R +     +  +D ++HFI+LSAC+ Y D+DII+NY
Sbjct: 406  VYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNY 465

Query: 437  ETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTD 496
            E Q  LDPEN+G+Y DALNFIAN KG+YQLI YC KQD VG+EALD AL +F ID+ + D
Sbjct: 466  EAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFD 525

Query: 497  LSTVPDDLLLGIYRKESSQASQQKR-SSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQA 555
               + D +LL IY+ ES+      R + LKNSLRL+AK KKS  L+FY  YEPY N  QA
Sbjct: 526  PHNLNDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQA 585

Query: 556  YSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAF 615
            Y +LEV+ESVD DIIQTAYTVKV DSPGLKIDCDRA+YTIAV  RS+ LFNFL +Q   F
Sbjct: 586  YEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEF 645

Query: 616  NEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQ 675
             E++  D+ +YQ+AL++LQVNENA DD ILE+FQRKW++EPV   DQFL    AL+KIG 
Sbjct: 646  QEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGF 705

Query: 676  VRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQ 735
             RNS LI+ +++TG +D SCLPA NWPTGLNNIGNTCYLNSLLQYYF IS LRQ +++Y+
Sbjct: 706  ERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYR 765

Query: 736  KTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKEL 795
             T+  F  +  +  + RRIGGRE++EAEVERS+QFVYQLRDLF  M+H ++R VTP KEL
Sbjct: 766  NTVQHFLNNQEY--ASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKEL 823

Query: 796  AYLAFAPSNIEVEFE----------------------GTPSSGSVXXXXXXXXXXXXXXX 833
            AYLAF PS + VEFE                        PS                   
Sbjct: 824  AYLAFVPSGLGVEFELPNASQANANAPVEKENYVNIDSEPSPPPNDEPLLIDLDDDSDPN 883

Query: 834  XVIDLTSVPNAEQDIEMLD-PVPSESEMIVE-QFVDSPKDDKKQDAAE------------ 879
                L    N +  I   D     E+++ V+    DSP +++K   A+            
Sbjct: 884  NHSKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAV 943

Query: 880  AIGTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQ 939
            A+ TSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESAS+P  L  D EQ DL+KQ
Sbjct: 944  AMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQ 1003

Query: 940  LFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GD 998
            LF+G ++Q + PL D T+VRTK ERF+SLLVN+GDHPKD+YDALD YF+++ L+LE+ GD
Sbjct: 1004 LFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGD 1063

Query: 999  VNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKR 1058
            V R+VA+ + P +LQIQIQRVYYDRERFMPFKS+ PLPF ++IYMDRY DT +PV++ ++
Sbjct: 1064 VKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRK 1123

Query: 1059 EEAAXXXXXXXXXXXXQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSI 1118
             E              QR LL KN  G+S K +L+ET  FL+SDVLE   I+  N+    
Sbjct: 1124 RETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLA 1183

Query: 1119 QTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIY 1178
            Q +D+++L I++EL+ +YH I  LE K+S  FDDFK  GYSLFAVFIHRGEASYGHYWIY
Sbjct: 1184 QELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIY 1243

Query: 1179 IKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRV 1235
            IKD  K+GIWRKYNDE++TE PESEVFNFSEGNTATPYFLVYVK G E +IEPL RV
Sbjct: 1244 IKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRV 1300

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1352 bits (3500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1225 (54%), Positives = 879/1225 (71%), Gaps = 28/1225 (2%)

Query: 30   DGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHSGVLKLP 89
            D  + +D+GK +LY +  + FPFKTS+RLLD++  +LA+ NS  HDILYS LH+G+LK P
Sbjct: 53   DTLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAP 112

Query: 90   VLEYSRKPVP-DPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVS-PSIVPREP 147
            VL YSR+     P+S G L+DQ+ L+T +EY S +CPG NK++V+MGVL+  P       
Sbjct: 113  VLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITS 172

Query: 148  EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSE--LHPSDKQDLFLAEESDPSLL 205
              L+   +YHLK+TVKTR  LEHT+K+AGV  YH +SE  LH  D+QDL   + +DP L+
Sbjct: 173  STLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLEF-DPTDPRLV 231

Query: 206  DSAMYVSSDTNKLVCIEIFKPEFSHED-LATFSPDSIRRRFAEACGKFPDLDPEKVPSQA 264
            D A+YVSSDTNKLV IE+F PEF  E+    +S  +I+ R++EAC +F  LDP ++P+QA
Sbjct: 232  DHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQA 291

Query: 265  ECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPE 324
            +C +TLLKIF+GPLNR++ ++ LKTI++DN  LNS+I P WLT ++ F+L   +     E
Sbjct: 292  DCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGE 351

Query: 325  TALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRARSFHL 384
            +  E++PP+LT+Y+ +  VR+LRE + RKC+EL+FLGK A+ L+ KD        R+F+ 
Sbjct: 352  SYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFNA 411

Query: 385  YQISYSPSFFFHLLGETRGVMDYGTQE-IDKNYHFINLSACHYYSDKDIIKNYETQARLD 443
             QI++S + +F +LGE R +  + +   +D NY+FINLSAC YY D+DIIKNYE Q  LD
Sbjct: 412  IQIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALD 471

Query: 444  PENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDD 503
            PEN GIYFDAL +IAN KG+YQL+ YC KQDVVG+EALD AL LFGID+ D D++T+ D 
Sbjct: 472  PENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDS 531

Query: 504  LLLGIYRKES-SQASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVN 562
            LL+ IY+ E+ +  ++ + + LKN+LRL+AK KKS  L+F+  YEPY N  +AY +LEV+
Sbjct: 532  LLVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYEILEVD 591

Query: 563  ESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSAD 622
            ESVD DII+TAY++ + DSPGLKIDCDRA+YTI V +RS+ L N+L +QCP F  +Y   
Sbjct: 592  ESVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPG 651

Query: 623  KLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSLLI 682
             L Y EAL++LQ+NENA D+ +LEVFQRKWHQE     D  L   +ALTKIG  RNS LI
Sbjct: 652  TLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLI 711

Query: 683  NRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFH 742
              +++TG ID SCLPA NWPTGLNNIGNTCYLNSLLQYYF ++PLR+ ++EYQ+T+  F 
Sbjct: 712  LHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFR 771

Query: 743  QSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAP 802
               G+    RRIGGREVSEAEVERS+QFVYQLRDLF  M++++ R VTP KELAYLAFAP
Sbjct: 772  HHTGN--ELRRIGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAP 829

Query: 803  SNIEVEFEGTPSSGSVXXXXXXXXXXXXXXXXVIDLTSVPNAEQDIEMLDPVP----SES 858
            SN EVEFE T    +V                +  L   P    D +   P+     S +
Sbjct: 830  SNFEVEFEPT----TVNAQHEVSKIAESTNNDI--LMYGPTNRSDNDQTGPIELDSDSGN 883

Query: 859  EMIVEQFVDSPKDDKKQDAAEA-------IGTSTRVAKISSDQLENALEMGRQQDVTECI 911
            E I       P ++ K+D   +       I TSTRVAKISSDQLENALEMGRQQDVTECI
Sbjct: 884  EDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTECI 943

Query: 912  GNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVN 971
            GNVLFQLESAS+P  LD D EQ DL+KQLF+GK++Q + PL   T+++TKIER++SLLVN
Sbjct: 944  GNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVN 1003

Query: 972  VGDHPKDVYDALDQYFKNDVLQL-EDGDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFK 1030
            +GDHPKD+YDALD YF ++ L + E GDV R+VA+ E P +LQIQIQRVYYDRERFMPFK
Sbjct: 1004 IGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFK 1063

Query: 1031 SIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLDKNGSGMSFKS 1090
            SIEPLPF + +YMDRY D++DP M++K++E+             Q+ LL  N  G+S K+
Sbjct: 1064 SIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKA 1123

Query: 1091 SLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHF 1150
            + +ET  +L+SD++++ +++  N +  I+ +   +  ID+EL S+YH IA LE  +   F
Sbjct: 1124 AYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQF 1183

Query: 1151 DDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEG 1210
            ++FK+ GYSLFAVFIHRGEASYGHYW+YIKD  KNG WRKYNDE++TE PE+EVFNF+EG
Sbjct: 1184 EEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEG 1243

Query: 1211 NTATPYFLVYVKNGQESQIEPLHRV 1235
            NTATPYFLVYV+ G E  IEPL R+
Sbjct: 1244 NTATPYFLVYVRQGHEHDIEPLKRI 1268

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1274 bits (3298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1244 (52%), Positives = 866/1244 (69%), Gaps = 37/1244 (2%)

Query: 17   DSISKPIDDGGLE-DGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHD 75
            D   + + +G +E +    ++ GK +LYP     +PFKTS+RLLD+I++ L++       
Sbjct: 8    DGRVRLVGNGVVECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF------- 60

Query: 76   ILYSALHSGVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGL------N 128
            +L     +GVLK P+L+YS+ +     +SIG+LLDQV+L+T YEY S    G       +
Sbjct: 61   VLEGVRGNGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLGGSGGGGGDKHS 120

Query: 129  KVSVFMGVLVSPSIVPREPEDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHP 188
            K++VFMG+L  P +     +D+     YHL++TVKTR+HLE  ++Q G+ QYH++++LHP
Sbjct: 121  KINVFMGLLCDPMVKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHP 180

Query: 189  SDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEFSHEDLATFSPDSIRRRFAEA 248
            +DKQDL   E+ D  ++DSA YVSS TN+LV IEI KPEF+ E+ + F+PDSIR+R+   
Sbjct: 181  ADKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEFTAEEWSEFTPDSIRKRYLSI 240

Query: 249  CGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTE 308
            C K+PDL+ E VP+QAEC +TL K+FK PL+R+  DD LKTISA+NK LNSQ++P WL +
Sbjct: 241  CEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVD 300

Query: 309  RFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALM 368
            +F F+LCE Q  E+     EY+PPD T+YVN+ +VR LRE Y RK LEL+F+GK ++ L+
Sbjct: 301  KFGFELCEVQ-EEDGRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL 359

Query: 369  SKDDVAQDSRARSFHLYQISYSPSFFFHLLGETRGVMDYGTQE---IDKNYHFINLSACH 425
             K+ VA  S+ RSF LYQ  +S +F+F LLGE     D+  Q+    D N HFINLS  +
Sbjct: 360  PKEVVAASSKLRSFQLYQTHFSHTFWFQLLGEF-DRNDFNQQQQHPYDTNPHFINLSVNY 418

Query: 426  YYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSAL 485
            YY D+DII+NYE+Q  LDP+N GIY+D L FIAN KGS+QL+T+  KQ++VG+EAL+SAL
Sbjct: 419  YYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSAL 478

Query: 486  SLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQILQFYTA 545
             LF ID S+TD   +PD++LL  Y++E    + ++ + L+N+LRL+AK K+S+ L+FY  
Sbjct: 479  RLFHIDPSETDPKQIPDEMLLSCYKEECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVE 538

Query: 546  YEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLF 605
             EP+    QAYS+LE++ESVD+DII+TAYT+KV+D+PGLK+DCDRA+YT+A+++RSM LF
Sbjct: 539  LEPFQQESQAYSILEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLF 598

Query: 606  NFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLI 665
            N+L ++CP F +FY     +Y  AL  LQVN NA+DD+ILE+F+RKW +EPV SPDQFL 
Sbjct: 599  NYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLN 658

Query: 666  SSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCIS 725
               AL KI   RNS LIN +LETGIID + L +GNWPTGLNNIGNTCYLNSLLQYYF IS
Sbjct: 659  LKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTIS 718

Query: 726  PLRQSIVEYQKTLSEFHQSIGH--LESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVH 783
            PLR  I  Y+ T S+   ++      +KRRIGGR V++ EVERS+QFVYQLRDLF DM H
Sbjct: 719  PLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAH 778

Query: 784  TENRYVTPTKELAYLAFAPSNIEVEFEGTPSSGSVXXXXXXXXXXXXXXXXVIDLT---- 839
            ++ R VTP++ELAYL+F+PS   VEFE                        V D++    
Sbjct: 779  SKERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFDISIEGS 838

Query: 840  --SVPNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIG------TSTRVAKIS 891
                  A +DI   D + ++ E        S    +K ++   I       TST VAKIS
Sbjct: 839  NVETEAAAEDIIADDNIDTKDESSSLSPSTSTSSSQKGNSMSNIVEENEPITSTCVAKIS 898

Query: 892  SDQLENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTP 951
             DQLEN LE+GRQQDVTECIGNVL+Q+ESAS P   D   EQ DL+KQLF+GKL+Q L P
Sbjct: 899  PDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIP 958

Query: 952  LNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDGD--VNRSVAIKELP 1009
            + +P K RTK ERF+SLLVNVGDHPKD+YDALD YF++D+L L D +  V RSVA++ELP
Sbjct: 959  IENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELP 1018

Query: 1010 AVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXX 1069
             +LQIQIQRVYYDRE+ MPFKS EPLPF + +YMDRYM + +  +L K++E+        
Sbjct: 1019 TILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLE 1078

Query: 1070 XXXXXQRSLLDKNGSGMSFKSSLLETKRFLQSDVL-ENNDIESPNKEQSIQTIDSMLLKI 1128
                 ++ +L KN +G++ K SL ETK FL+S VL E+       K   I+ +DS  L+I
Sbjct: 1079 AIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEI 1138

Query: 1129 DEELASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIW 1188
            D+EL+++  +I  +E  +S  FD F   GY+LFAVFIHRGEASYGHYW+YIKD   +GIW
Sbjct: 1139 DKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIW 1198

Query: 1189 RKYNDESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPL 1232
            RKYNDESVTE PESEVF+F+E NTATPYFLVY+K+G E +IEPL
Sbjct: 1199 RKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPL 1242

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 1267 bits (3279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/1251 (51%), Positives = 852/1251 (68%), Gaps = 54/1251 (4%)

Query: 23   IDDGGLEDGGSTQ-------DNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHD 75
            IDD  L +  ++Q       D+GK LLYPD  +  P KTS+RLLD+I  + A+ NS    
Sbjct: 34   IDDCPLYEASASQQSTRADVDDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPS 93

Query: 76   ILYSALH-SGVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVF 133
            ++   L  SG+LK  +L YS  +    P ++G L DQVVL+T+ EY+S +CP  NK+ V 
Sbjct: 94   VIERGLQTSGILKKSMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVL 153

Query: 134  MGVLVSPSIVPREP---EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSD 190
              V+ +PS+  ++    +D+   PIYHLK+TVK R  LE  +K  GV Q+H L  LH  D
Sbjct: 154  QAVIFNPSLPEQQIAAFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYD 213

Query: 191  KQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEAC 249
              DL   + SDP+L D  +YVS DTNKL+ IEIF PEF S E+  +F+  +I++R+ + C
Sbjct: 214  LADLSTFDSSDPNLKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVC 273

Query: 250  GKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTER 309
             K   L+  + PSQ +CF TL KIFKGPL R+S  D +KTI + N  LN+ + P WLT +
Sbjct: 274  LKNESLNENETPSQPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSK 333

Query: 310  FQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMS 369
            + FQ       E  E+  EY PPD+ DYV +  +RK+RE Y RKCL+L+F G+++ +L++
Sbjct: 334  YGFQASSEIDEETNESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQLSASLLA 393

Query: 370  KDDVAQDSRA-RSFHLYQISYSPSFFFHLLGETRG--VMDYGTQE---IDKNYHFINLSA 423
             + + +++++ +     Q S+S   +F LLGE+R   ++++  Q    +D   HFINLS 
Sbjct: 394  PNSLLKNTKSVKGLSSIQTSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSV 453

Query: 424  CHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDS 483
             HYY+D+DII+NYE  + LDPENIG+YFDAL +IAN KG+YQ+I YC KQD++G+EAL++
Sbjct: 454  SHYYTDRDIIRNYEALSSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALEN 513

Query: 484  ALSLFGIDASDTDLSTVPDDLLLGIYRKESS---QASQQKRSSLKNSLRLIAKAKKSQIL 540
            AL +F ID  D D++ + +  LL IY+ E+S   +A+    ++LKN+LRL+AK  KS  L
Sbjct: 514  ALMVFKIDPKDYDIAELNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKL 573

Query: 541  QFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRR 600
            +FY  +EPY    QAY  L ++ESVD DII+TAY++K+ DSPGLK+DCDRA+YTIA+S+R
Sbjct: 574  KFYVDHEPYRALSQAYDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKR 633

Query: 601  SMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSP 660
            S+ LFNFL ++CP F  +Y  +KL YQEAL LLQVNENASD+ IL++F+ KW  E V  P
Sbjct: 634  SLDLFNFLTDECPQFQNYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEP 693

Query: 661  DQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQY 720
            DQFLI  +ALTKI   RNS LI  +L TG ID + LP  NWPTG+NNIGNTCYLNSLLQY
Sbjct: 694  DQFLILKAALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQY 753

Query: 721  YFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTD 780
            YF I+PLR  I+ YQKTL+ F+  + + E  RR+GGRE+SE EVERSIQF++QLR+LF  
Sbjct: 754  YFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYA 813

Query: 781  MVHTENRYVTPTKELAYLAFAPSNIEVEF--EGTPSSGSVXXXXXXXXXXXXXXXXVIDL 838
            MVH+  R VTP+KELAYLAFAPSN+EVEF  EG   S                       
Sbjct: 814  MVHSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKESNDATILKEEE------------- 860

Query: 839  TSVPNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEA-------------IGTST 885
            T   NA   I   DP+  + E+      D  KD+   +  E+             + + T
Sbjct: 861  TGGANA---INEQDPILIDFEVDENTNGDVEKDENNHEKTESNDVEIIMTDDATDLASPT 917

Query: 886  RVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKL 945
            RVAKISSDQLENALEMGRQQDVTECIGNVLFQ+ES SEP   D D EQ DLIKQLF+G  
Sbjct: 918  RVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTT 977

Query: 946  RQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQL-EDGDVNRSVA 1004
            +Q + PL+   KVRTK+ERF+SLLVN+GDHPKD+YDA D YF+++ L + E GDV R+VA
Sbjct: 978  KQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVA 1037

Query: 1005 IKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXX 1064
            +   P +LQ+QIQRVYYDRERFMPFKSIEPLPF++ IYMDRY DT++  +L K+EE    
Sbjct: 1038 VTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQL 1097

Query: 1065 XXXXXXXXXXQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSM 1124
                      QR LL+++GSG++ K + LET + L+S ++EN  +   +K+  I+T+ + 
Sbjct: 1098 KQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNK 1157

Query: 1125 LLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGK 1184
            +  ID EL S+Y  I  LE K+S  FDDFK+ GYSLF+VFIHRGEASYGHYWIYIKD  +
Sbjct: 1158 VTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQ 1217

Query: 1185 NGIWRKYNDESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRV 1235
            NG+WRKYNDE+++E PE EVFNF+EGNTATPYFLVYVK GQE+ IEPL R+
Sbjct: 1218 NGVWRKYNDETISEVPEEEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRI 1268

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 1265 bits (3273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/1222 (51%), Positives = 838/1222 (68%), Gaps = 27/1222 (2%)

Query: 36   DNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHS-GVLKLPVLEYS 94
            D+GK LLYPD  +  P KTS+RLLD+I  +  + NS    ++   L S G+LK  +L YS
Sbjct: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113

Query: 95   R-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIVPREP---EDL 150
              +    P  +G L DQVV +T+ EY+S +CP  NK+ VF  V+ +PS+  ++    +D+
Sbjct: 114  TFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDI 173

Query: 151  AAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEESDPSLLDSAMY 210
               PIYHLK++VK R  LE  +K  GV Q+H L  LH  D+ DL   + SDP+LLD  +Y
Sbjct: 174  VKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIY 233

Query: 211  VSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKFPDLDPEKVPSQAECFST 269
            VS DTNKL+ IEIFKPEF S E+  +F+ D+I++R+   C K   LD  + PSQ +CF T
Sbjct: 234  VSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYT 293

Query: 270  LLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEY 329
            L KIFKGPL R+S  +  KTI + N  LN+ + P WLT ++ FQ       E  E   EY
Sbjct: 294  LFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEY 353

Query: 330  QPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRA-RSFHLYQIS 388
             PPD+ DYVN+L  RK+RE + RKCL+L+F G+++ +L++ +   +++++ +     Q S
Sbjct: 354  VPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTS 413

Query: 389  YSPSFFFHLLGETRGVMDYGTQE-----IDKNYHFINLSACHYYSDKDIIKNYETQARLD 443
            +S   +FHLLGE+R  +   + E     +D   HFINLS  HYY+D+DII+NYE+ + LD
Sbjct: 414  FSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLD 473

Query: 444  PENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDD 503
            PENIG+YFDAL +IAN KG+YQLI YC KQD++G+EAL++AL +F I+  + ++S + + 
Sbjct: 474  PENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEA 533

Query: 504  LLLGIYRKESSQASQ---QKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLE 560
             LL IY+ E+S  SQ      ++LKN+LRL+AK  KS  L+FY  +EPY    QAY  L 
Sbjct: 534  TLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLS 593

Query: 561  VNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYS 620
            ++ESVD DII+TAY+VK+ DSPGLK+DCDRA+YTIA+S+RS+ LFNFL E+CP F+ +Y 
Sbjct: 594  IDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYG 653

Query: 621  ADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSL 680
             +KL YQEAL LLQVNENASD+ IL++F++KW  E V  PDQFLI  +ALTKI   RNS 
Sbjct: 654  PEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNST 713

Query: 681  LINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSE 740
            LI  +L TG ID + LP  NWPTG+NNIGNTCYLNSLLQYYF I+PLR+ ++EYQKT+  
Sbjct: 714  LITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773

Query: 741  FHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAF 800
            F+  + +    RRIGGRE+S  EVERSIQF+YQLR+LF  MVHT  R VTP+KELAYLAF
Sbjct: 774  FNDHLSNSGHIRRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAYLAF 833

Query: 801  APSNIEVEFE----GTPSSGSVXXXXXXXXXXXXXXXXVIDLTSVPNAEQDIEMLDPVPS 856
            APSN+EVEFE           V                + D + +     D+EM D +  
Sbjct: 834  APSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLI-----DLEMEDGLNG 888

Query: 857  ESEMIVEQFVDSPKDDKKQDAAEAIGTS--TRVAKISSDQLENALEMGRQQDVTECIGNV 914
            +      +  +   D +  +  +  G +  TRVAKISSDQLENALEMGRQQDVTECIGNV
Sbjct: 889  DVGTDANRKKNESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNV 948

Query: 915  LFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGD 974
            LFQ+ES SEP   D D EQ DL+KQLF+G  +Q + PL+   KVRTK+ERF+SLL+N+GD
Sbjct: 949  LFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGD 1008

Query: 975  HPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIE 1033
            HPKD+YDA D YFK++ L +E+ GDV R+VA+   P +LQ+QIQRVYYDRER MPFKSIE
Sbjct: 1009 HPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIE 1068

Query: 1034 PLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLDKNGSGMSFKSSLL 1093
            PLPF++ IYMDRY DTE+P++L K++E              QR LL ++ SG++ K + L
Sbjct: 1069 PLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFL 1128

Query: 1094 ETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDF 1153
            E+ + L+SD ++   ++       I+T+ + +  ID EL  +Y+ I  LE+K+S  FDDF
Sbjct: 1129 ESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDF 1188

Query: 1154 KQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTA 1213
            K+ GYSLF+VFIHRGEASYGHYWIYIKD  +NGIWRKYNDE+++E  E EVFNF+EGNTA
Sbjct: 1189 KEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTA 1248

Query: 1214 TPYFLVYVKNGQESQIEPLHRV 1235
            TPYFLVYVK GQE  IEPL R+
Sbjct: 1249 TPYFLVYVKQGQEGDIEPLKRI 1270

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 1264 bits (3271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/1241 (51%), Positives = 852/1241 (68%), Gaps = 26/1241 (2%)

Query: 16   ADSISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHD 75
             +S S  +D  G     S +D+GK LLYPDA  L PFKTSERLLDEI   + Y   +  D
Sbjct: 32   VNSSSMDLDSCGDATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKD 91

Query: 76   ILYSALHSGVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFM 134
              ++   +G+LK  +L YS+ +    PFS+G ++DQ++L+T++EY+S TCP  N + V +
Sbjct: 92   ESFNEFSNGLLKKQLLSYSKSRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRL 151

Query: 135  GVLVSPSIVPREP-EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQD 193
            GVL+  +  P    +D+A   IYHLK+TVK R  LE T++  GV +YH+L  LHP D+QD
Sbjct: 152  GVLIDTNHQPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQD 211

Query: 194  LFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKF 252
            L   +  DP L+D A+YVS DTNKLV +EIF+PEF S E+  + +  +I+ R  +A  K+
Sbjct: 212  LLNFDPKDPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKY 271

Query: 253  PDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQF 312
              LD +++P+Q +C +T+ KIFKGPL R+S D+ +KT+S+DN  LNSQ+ P WL  ++ F
Sbjct: 272  DTLDKDEIPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGF 331

Query: 313  QLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDD 372
            Q       E  E  ++Y PP+L D+  +  VRK RE  TRKCLEL++LGK++++LM+ + 
Sbjct: 332  QELIETEEETEEQLIDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQ 391

Query: 373  VAQDSRA-RSFHLYQISYSPSFFFHLLGETRGVMDYGTQ-EIDKNYHFINLSACHYYSDK 430
                S++ R+F+L Q S+S  F+  +L E + +       +++ +YH I+LSA ++Y+D+
Sbjct: 392  KESASKSLRTFNLLQTSFSTLFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDR 451

Query: 431  DIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGI 490
            DII+NYE Q +LDP NIGIYFD+L+FIAN +GSY LI YC KQD+VG+EAL+ AL  F +
Sbjct: 452  DIIQNYELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSL 511

Query: 491  DASDTDLSTVPDDLLLGIYRKESSQASQQ--KRSSLKNSLRLIAKAKKSQILQFYTAYEP 548
            D    DLS   D + + IY+ E         + ++L+N+LR++AK K S  L+FY  YEP
Sbjct: 512  DPDTIDLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEP 571

Query: 549  YDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFL 608
            Y +  +A+++LEV+ESVD DIIQTAY++KV D+PGLKIDCDRA+YT+AVS+RSM L NFL
Sbjct: 572  YSSIQRAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFL 631

Query: 609  AEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSS 668
             ++CP F +FY  D+ TY EAL  LQVNENA+DD ILE+FQR+W  + V   D+ L   S
Sbjct: 632  FQECPPFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKS 691

Query: 669  ALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLR 728
             LTKI   RNS LI+ YLETG+++  CLPA NWP GLNNIGNTCYLNSLLQYYFCISPLR
Sbjct: 692  VLTKIAFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLR 751

Query: 729  QSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRY 788
              + +YQKTL      +     KRRIGGRE+++ EVERS+QFVYQLRDLF +M+H+ +R 
Sbjct: 752  NYVADYQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRC 811

Query: 789  VTPTKELAYLAFAPSNIEVEFE---------GTPSSGSVXXXXXXXXXXXXXXXXVIDLT 839
            VTPTKELAYLAFAPSN+EVEF+         G    G +                + +  
Sbjct: 812  VTPTKELAYLAFAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEEN 871

Query: 840  S-VPNAEQD--IEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQLE 896
            S V N+ ++  IE+ D   S     VE+   +P   K  D      TSTRVAKIS DQLE
Sbjct: 872  SKVENSPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTD------TSTRVAKISFDQLE 925

Query: 897  NALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPT 956
            NALE+GRQQDVTECIGNVLFQLESAS P  L+ D EQ DLIK+LF+GK +Q + PL +  
Sbjct: 926  NALELGRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNN 985

Query: 957  KVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQ 1015
            ++R KIERFVSLLVNV DHPKDVYDALD YF ++ L +++ G+V +S+A+ E P +LQIQ
Sbjct: 986  EIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQ 1045

Query: 1016 IQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQ 1075
            IQRVYYDRERFMPFKSIEPLPF ++IYMDRY +T D  +LKK++E              Q
Sbjct: 1046 IQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQ 1105

Query: 1076 RSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASV 1135
            + LL +N  G+S K + +ET++FL SD LE   IE+ NK+  I  +   L  ID+EL  +
Sbjct: 1106 KELLSRNELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKL 1165

Query: 1136 YHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDES 1195
            Y+ I  +E K+   FD F+  GYSLFAVFIHRGEASYGHYW+YIKD  KNGIWRKYNDE+
Sbjct: 1166 YNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDET 1225

Query: 1196 VTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRVT 1236
            +TE PE+EVFNF+EGNTATPYFLVYVK    ++IEPL R+ 
Sbjct: 1226 ITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 1256 bits (3251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/1249 (51%), Positives = 858/1249 (68%), Gaps = 36/1249 (2%)

Query: 9    EAPVYEPADS-ISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELA 67
            E P+YE + S  S P+D           D+GK LLYPD  +  P KTS+RLLD+I  +  
Sbjct: 36   ECPLYETSASHQSAPVD----------FDDGKHLLYPDIATSLPLKTSDRLLDDILCDTI 85

Query: 68   YRNSNGHDILYSALHS-GVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCP 125
            + NS    ++   L + G+L+  +L YS  +    P ++G + DQVV++T+ EY+S +CP
Sbjct: 86   FLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCP 145

Query: 126  GLNKVSVFMGVLVSPSIVPREP---EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHM 182
              NK+ VF  V+++PS+  +     +D+   PIYHLK+TVK R  LE  +K  GV Q+H 
Sbjct: 146  KYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHS 205

Query: 183  LSELHPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSI 241
            +  LH  D+ D    + SDP+L+D  +YVS DTNKL+ IEIFKPEF S E+  +F+ ++I
Sbjct: 206  IDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAI 265

Query: 242  RRRFAEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQI 301
            +RR+++ C     LD    PSQA+CF TL KIFKGPL R+S  + +KTI + N  LN+ +
Sbjct: 266  KRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHL 325

Query: 302  EPAWLTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLG 361
             P WLT ++ FQ+      E  E   EY PPD+ DYV++L VRK+RE + RKCL+L+F G
Sbjct: 326  NPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWG 385

Query: 362  KMAVALMSKDDVAQDSRA-RSFHLYQISYSPSFFFHLLGETRGVMDYGTQE----IDKNY 416
            +++ +L++ +   +++++ +     Q S+S   +FHLLGE+R  +   + E    +D   
Sbjct: 386  QLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEP 445

Query: 417  HFINLSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVV 476
            HF+NLS  HYY+D+DII+NYE+ + LDP+NIG+YFDAL +IAN KG+YQLI YC KQD++
Sbjct: 446  HFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDII 505

Query: 477  GKEALDSALSLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKR---SSLKNSLRLIAK 533
            G+EAL++AL +F I+  + +++ + +  LL IY+ E+S  SQ      ++LKN+LRL+AK
Sbjct: 506  GQEALENALLVFKIEPKECNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAK 565

Query: 534  AKKSQILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIY 593
              KS  L+FY  +EPY    QAY  L ++ESVD DII+TAY+VK+ DSPGLK+DCDRA+Y
Sbjct: 566  YTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALY 625

Query: 594  TIAVSRRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWH 653
            TIA+S++S+ LFNFL ++CP F  +Y A++L YQEAL LLQVNENASD+ IL++F++KW 
Sbjct: 626  TIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWF 685

Query: 654  QEPVSSPDQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCY 713
             E V  PDQFL   +ALTKI   RNS LI+ +L TG ID + LP  NWPTG+NNIGNTCY
Sbjct: 686  DESVYEPDQFLTLKAALTKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCY 745

Query: 714  LNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQ 773
            LNSLLQYYF I+PLR+ I++YQKT+  F+  + +    RRIGGR++S+ EVERS+QF+YQ
Sbjct: 746  LNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQ 805

Query: 774  LRDLFTDMVHTENRYVTPTKELAYLAFAPSNIEVEFE---GTPSSG-SVXXXXXXXXXXX 829
            LR+LF  MVH+  R VTP+KELAYLAFAPSNIEVEFE     P+ G ++           
Sbjct: 806  LRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQE 865

Query: 830  XXXXXVIDLTSVPNAEQDIEMLDP--VPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRV 887
                   D  S+ +  +D    D    PS +E      V     D   D    + + TRV
Sbjct: 866  SCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTD----LNSLTRV 921

Query: 888  AKISSDQLENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQ 947
            AKISSDQLENALEMGRQQDVTECIGNVLFQ+ES SEP   D D EQ DL+KQLF+G  +Q
Sbjct: 922  AKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQ 981

Query: 948  VLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIK 1006
             + PL+   KVRTK+ERF+SLL+N+GDHPKD+YDA D YFK++ L +E+ GDV R+VA+ 
Sbjct: 982  SIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVT 1041

Query: 1007 ELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXX 1066
              P +LQ+QIQRVYYDRERFMPFKSIEPLPF++ IYMDRY DTE+P++L K+ E      
Sbjct: 1042 TFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQ 1101

Query: 1067 XXXXXXXXQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLL 1126
                    QR LL ++ SG++ K + LE+ + L+S V+E   +++  K   I T+ + + 
Sbjct: 1102 KLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVN 1161

Query: 1127 KIDEELASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNG 1186
             ID EL S+Y+ I  LE+K+S  FDDFK+ GYSLF+VFIHRGEASYGHYWIYIKD   NG
Sbjct: 1162 NIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNG 1221

Query: 1187 IWRKYNDESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRV 1235
            +WRKYNDE+V+E  E EVFNF+EGNTATPYFLVYVK GQE+ IEPL R+
Sbjct: 1222 VWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRI 1270

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1249 bits (3231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1235 (50%), Positives = 852/1235 (68%), Gaps = 42/1235 (3%)

Query: 36   DNGKALLYPDAGSLFPFKTSERLLDEIKAELAY------RNSNGHDILYSALHSGVLKLP 89
            D+GK LLYP+  + FP KT+ERL+D+I A+L++       N +  DI  + L +G+LK  
Sbjct: 36   DDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDI-DTMLGNGILKQS 94

Query: 90   VLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIVPREPE 148
            +L YS+ K  P  F +G L+DQV L+T+YEY+S TCP LNK+ VF GVL + S      +
Sbjct: 95   MLNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVLFNNSTQITNLD 154

Query: 149  DLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEESDPSLLDSA 208
            ++   PIYHLK+TVKTR HLE T+K AGV Q+H++ +LH  DKQD+      DP+LLD A
Sbjct: 155  EVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQLHVYDKQDIPTFNPEDPNLLDYA 214

Query: 209  MYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKFPDLDPEKVPSQAECF 267
            +YVS+DTNKL+ IE+FKPEF S +++ +F  ++I  R+ +AC +F  L+P + P+Q +C 
Sbjct: 215  IYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDTLNPNEPPTQLDCL 274

Query: 268  STLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETAL 327
            +TL K+FKGPL+R+S D+  KTI + NK LNS I P WLT ++ F +   +     + ++
Sbjct: 275  NTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFNIVVDEDLPNAQQSV 334

Query: 328  EYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRA-RSFHLYQ 386
            EY+PP+L +YV +  VR+LRE Y R+CL+L+F GK+++ L   D   ++S++ +S +  Q
Sbjct: 335  EYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPTLKNSKSYKSINALQ 394

Query: 387  ISYSPSFFFHLLGETRGVMDYGTQE---IDKNYHFINLSACHYYSDKDIIKNYETQARLD 443
             +++ +    L   +      G +    +D N+HFINLSAC++Y+D+D+I+NYE    LD
Sbjct: 395  TNFTITPLLQLFKGSGQNFLMGPESRSPLDFNFHFINLSACYHYTDRDVIRNYERLCHLD 454

Query: 444  PENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDD 503
            P+N+G+YFDALN+IAN KGSYQLI YC KQD+VG+EALD AL  F +D  + D++ + D 
Sbjct: 455  PQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKSFNLDPMEVDITKINDS 514

Query: 504  LLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVNE 563
            +LL +Y+ E  + S     +LKN++RL AK K S  L+FY  +EPY    QAY  L+++E
Sbjct: 515  VLLTLYKNEL-KISTSDIPNLKNAMRLFAKVKHSSKLKFYIDHEPYRRVAQAYETLDIDE 573

Query: 564  SVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSADK 623
            SVD DI+QTAY +KV DSPGL +DCDRA+YTIA+ +RS+ LF FL E+CP F E+Y  D+
Sbjct: 574  SVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFTFLIERCPDFQEYYCPDR 633

Query: 624  LTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSLLIN 683
             TY +AL++ QVNENA+D++I++ FQ +W  E V  P+ F+I   AL +IG  RNS LI+
Sbjct: 634  FTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVICVHALVEIGLQRNSSLIS 693

Query: 684  RYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQ 743
             +L+TG ID +CLP  +WP G+NNIGNTCYLNSLLQYYF I+PLR  +++Y KT+ +F  
Sbjct: 694  NFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYVLQYSKTIEDFKT 753

Query: 744  SIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAPS 803
               +  + RRIGGREVS  EVERSIQF+YQLRDLF  MV++  R VTP +ELAYLAFAPS
Sbjct: 754  LENNASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNERCVTPRRELAYLAFAPS 813

Query: 804  NIEVEFEGTPSSGSVXXXXXXXXXXXXXXXXVIDLTSVPNAEQDIEMLDPV-PSESEMIV 862
            NIEVEFE   +  +                      SV +   DI M D + P ++E   
Sbjct: 814  NIEVEFETNENQPATQQDNPEVTTAELGQDKDEKERSVDSG--DISMSDNITPKDAEEEE 871

Query: 863  EQFVDSPKDDKKQDAAEAI--------------------GTSTRVAKISSDQLENALEMG 902
            +Q  +S   +K QD +  +                    GTST+VAKISSDQLENALEMG
Sbjct: 872  DQVAES---NKNQDVSAIVSSPTKDIIMTDNTDTVVSNEGTSTKVAKISSDQLENALEMG 928

Query: 903  RQQDVTECIGNVLFQLESASEPTCL-DTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTK 961
            RQQDVTECIGNVLFQLES SEP  L + D EQ DL+KQLF+G+L Q + PL +P + R K
Sbjct: 929  RQQDVTECIGNVLFQLESGSEPLDLHENDNEQDDLVKQLFYGELEQTIVPLANPDQRRPK 988

Query: 962  IERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVY 1020
            +ERF+SLLVN+GDHP+D+YDALD YFK++ L++E+ GDV R+VA+ + P +LQIQIQRVY
Sbjct: 989  LERFLSLLVNIGDHPRDIYDALDLYFKDEYLKMEEYGDVKRTVAVTKFPTILQIQIQRVY 1048

Query: 1021 YDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLD 1080
            YDRE+FMPFKSIEPLPFE+ IYMDRY  T++P ++ ++ E              QR LL 
Sbjct: 1049 YDREKFMPFKSIEPLPFEEKIYMDRYSVTDNPELIARKNETLLMKEKLVELKKKQRDLLS 1108

Query: 1081 KNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIA 1140
            +N  G+S K S +E  + L SD LE+  I  P K++ + ++ ++   ID+EL  +Y  I+
Sbjct: 1109 RNSVGLSKKDSYIELGKLLSSDSLESQGIILPEKDEMVSSLKTLTAGIDDELNQLYAEIS 1168

Query: 1141 FLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAP 1200
             LE+ ++  F++FK  GYS+FAVFIHRGEASYGHYWIYIKD  +NGIWRKYNDE+V+E P
Sbjct: 1169 QLEETINGQFNEFKGIGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRKYNDETVSEVP 1228

Query: 1201 ESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRV 1235
            E EV+NF+EGNTATPYFLVYVK G+E +IEPL R+
Sbjct: 1229 EEEVYNFTEGNTATPYFLVYVKEGEEQEIEPLKRI 1263

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 1246 bits (3224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1234 (50%), Positives = 846/1234 (68%), Gaps = 25/1234 (2%)

Query: 26   GGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALH-SG 84
              L+      D+GK LLYPD  +  P KTS+RLLD++  +  + NS   +++   L  SG
Sbjct: 44   ASLQSAPVAVDDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSG 103

Query: 85   VLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIV 143
            +L+  +L YS  +    P ++G L DQV ++T+ EY+S +CP  NK+ VF  V+++PS+ 
Sbjct: 104  ILRESMLSYSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLS 163

Query: 144  PREP---EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEES 200
             ++    +D+   PIYHLK+TVK R  LE  +K  GV Q+H L  LH  D+ DL   + S
Sbjct: 164  EQQISSFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSS 223

Query: 201  DPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKFPDLDPEK 259
            DP L+D  +YVS DTNKL+ IEIF+PEF S E+  +F+ D+I++R+ + C K   L+ ++
Sbjct: 224  DPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKE 283

Query: 260  VPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQA 319
             PSQ +CF TL KIFKGPL R+S ++ +KTI + N  LN+ +   WLT ++ FQ      
Sbjct: 284  APSQPDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEID 343

Query: 320  SEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRA 379
             E  +   EY PPD+  YV + + RK+RE + +KCL+L+F G+++ +L++ +   +++++
Sbjct: 344  EETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKS 403

Query: 380  -RSFHLYQISYSPSFFFHLLGETRGVMDYGTQE-----IDKNYHFINLSACHYYSDKDII 433
             +     Q S+S S +FHLLGE+R  +   + E     +D   HFINLS  HYY+D+DII
Sbjct: 404  VKGLSSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDII 463

Query: 434  KNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDAS 493
            +NYE  + LDP+NIG+YFDAL +IAN KG+YQLI YC KQ+++G+EAL++AL  F ID  
Sbjct: 464  RNYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPK 523

Query: 494  DTDLSTVPDDLLLGIYRKESSQASQQKRSSL---KNSLRLIAKAKKSQILQFYTAYEPYD 550
            + +++ + +  LL IY+ E+S  S+   + L   KN+LRL+AK  KS  L+FY  +EPY 
Sbjct: 524  EFNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYR 583

Query: 551  NTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAE 610
               QAY  L ++ESVD DII+TAY++K+ DSPGLK+DCDRA+YTIA+S+RS+ LFNFL +
Sbjct: 584  ALSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTD 643

Query: 611  QCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSAL 670
            +CP F ++Y  +KL YQEAL LLQVNENASD+ +L++F++KW+ E V  PDQFLI  +AL
Sbjct: 644  ECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAAL 703

Query: 671  TKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQS 730
            T+I   RNS LI  +L TG ID + LP  NWPTG+NNIGNTCYLNSLLQYYF I+PLR+ 
Sbjct: 704  TRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRY 763

Query: 731  IVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVT 790
            I+EYQKTL  F+  + +    RRIGGRE+S  EVERSIQF+YQLR+LF  MVH+  R VT
Sbjct: 764  ILEYQKTLDNFNDHLSNSGHVRRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVT 823

Query: 791  PTKELAYLAFAPSNIEVEFEGTPSS-GSVXXXXXXXXXXXXXXXXVIDLTSVPNAEQDIE 849
            P+KELAYLAFAPSN+EVEFE   +  GS                          +  D+E
Sbjct: 824  PSKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLE 883

Query: 850  MLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIG-------TSTRVAKISSDQLENALEMG 902
            M D   S+ +  +E  V + + ++  D    +G       + TRVAKI SDQLENALEMG
Sbjct: 884  MEDKTNSDVDKDIEN-VKANEANEANDIEITVGENITDLASPTRVAKIGSDQLENALEMG 942

Query: 903  RQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKI 962
            RQQDVTECIGNVLFQ+ES SEP   D D EQ DLIKQLF+G  +Q + PL+   KVRTK+
Sbjct: 943  RQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKV 1002

Query: 963  ERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVYY 1021
            ERF+SLLVN+GDHPKD+YDA D YFK++ L +E+ GDV R+VA+   P +LQ+QIQRVYY
Sbjct: 1003 ERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYY 1062

Query: 1022 DRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLDK 1081
            DRERFMPFKSIEPLPF++ IYMDRY DTE+P++L K+EE              QR LLD+
Sbjct: 1063 DRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDR 1122

Query: 1082 NGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAF 1141
            + SG++ K + LE+ + L+S+++      S + +  I+ + S ++ ID EL S+Y+ I  
Sbjct: 1123 DESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINS 1182

Query: 1142 LEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPE 1201
            LE K+S  FDDF++ GYSLF+VFIHRGEASYGHYWIYIKD    G+WRKYNDE+++E  E
Sbjct: 1183 LEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQE 1242

Query: 1202 SEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRV 1235
             EVFNF+EGNTATPYFLVYVK GQES IEPL R+
Sbjct: 1243 EEVFNFNEGNTATPYFLVYVKQGQESDIEPLKRI 1276

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 1216 bits (3145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/1243 (50%), Positives = 828/1243 (66%), Gaps = 62/1243 (4%)

Query: 14   EPADSISKP---IDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRN 70
            E  DS+S+    +    LE      D+GK LLY D    FPFKT +R+LD+I+    +  
Sbjct: 14   EQRDSVSETAEVLRSKSLESFSDLVDDGKTLLYGDISKSFPFKTCDRILDDIRISPWFLK 73

Query: 71   SNGHDILYSALHSGVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNK 129
              G         S V+K P+L+YSR +    P+++ HL+DQV L++RY+Y+S TCPG N 
Sbjct: 74   KFG---------SSVMKQPMLQYSRERQQLQPWNLVHLIDQVNLRSRYDYDSMTCPGKNT 124

Query: 130  VSVFMGVLVSPSIVPREPEDLAAAP--IYHLKLTVKTRMHLEHTRKQAGVCQYHMLS--E 185
            +SV   +LV P+  P + +D+   P   +HLK+TVK R +LE+  +  G+  YH+L    
Sbjct: 125  ISVMFALLVDPNFTPNDFDDIDKFPEYFFHLKITVKRRSYLENFNRHVGITHYHVLEPES 184

Query: 186  LHPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEFSHEDLATFSPDSIRRRF 245
            LHP DK+D+F+ EE D  L+D +++VS+DTNKL+ +EI KPEF+ E+LA +    I  R+
Sbjct: 185  LHPFDKRDIFIMEEKDCRLVDQSIFVSADTNKLILVEIIKPEFNSENLAEYRTAKIEERY 244

Query: 246  AEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAW 305
              AC +F  L+P+ +PSQAEC  TL  IFK PL R+S +   K IS D+  LNSQI   W
Sbjct: 245  KNACQEFDLLNPDDIPSQAECLKTLFMIFKNPLQRKSANSEFKIISRDSVALNSQINTDW 304

Query: 306  LTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAV 365
            LT  F F L +T   +  ++  EY+PPDL DY+ +  VR +RE YTRK +E+V +GK ++
Sbjct: 305  LTTMFDFSLQKTAVEDNVQSGEEYKPPDLVDYITDFKVRGIREAYTRKSMEVVLIGKQSM 364

Query: 366  ALMSKDDVAQDSRARSFHLYQISYSPSFFFHLLGETRGVMDYGTQEI-----DKNYHFIN 420
             L ++    + + A+ F     S S +++F++L           Q I     D NYHFIN
Sbjct: 365  LLENELGTEKKTVAKCFSNQHFSASHTWWFNILNH---------QHIEPFPYDINYHFIN 415

Query: 421  LSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEA 480
            LS    Y DKDIIKNYETQ  LD ENI  YFDAL ++ N KGSYQLI YC KQDVVG E 
Sbjct: 416  LSVAFKYIDKDIIKNYETQIALDQENISHYFDALQYVTNAKGSYQLIAYCGKQDVVGYED 475

Query: 481  LDSALSLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQIL 540
            L++AL +FG+D +D D S +  + ++  Y     ++S  +R  L+N+LR++ K   SQ +
Sbjct: 476  LNNALQVFGLDPTDIDASLLDANTMIEYYNSHLLRSSDNQRKDLRNALRVLGKYLGSQKM 535

Query: 541  QFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRR 600
             F   YEPY N  QAY+LL+V+E+VD DIIQTAYT+ + D+PGLK D DRAI+TIA+ RR
Sbjct: 536  LFLVEYEPYYNVQQAYTLLKVDETVDDDIIQTAYTINIADAPGLKKDYDRAIFTIALDRR 595

Query: 601  SMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSP 660
            S+ L N L ++CP F ++Y+   ++Y EALN+++++ NASDDVILEVFQ+KW    ++ P
Sbjct: 596  SIFLLNVLTDECPEFAQYYNCTDISYDEALNIIEIDMNASDDVILEVFQKKWSHGIMTGP 655

Query: 661  DQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQY 720
            D  L    AL  IG  RNS LIN +L+TGI+DVSCLP   WP G+NN+GNTCYLNSLLQ+
Sbjct: 656  DYLLKLKMALQNIGFTRNSKLINHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQF 715

Query: 721  YFCISPLRQSIVEYQ----KTL--SEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQL 774
            +F I PLR  I+ Y     K L  SE+H       S+RRIGGREVS+ E  RS+QFVY L
Sbjct: 716  FFTIKPLRDFILNYDDDSAKLLDASEYH-------SRRRIGGREVSKQEELRSVQFVYHL 768

Query: 775  RDLFTDMVHTENRYVTPTKELAYLAFAPSNIEVEFEGTPSSGSVXXXXXXXXXXXXXXXX 834
            RDLF DM+HT +R VTPTKEL YLAFAPSN+EVEF G  +                    
Sbjct: 769  RDLFNDMIHTNSRCVTPTKELVYLAFAPSNVEVEF-GDDTVAQ---------------KE 812

Query: 835  VIDLTSVPNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQ 894
            +IDLT+    +           + ++I+ Q   +  + K    A     S +VAKIS+DQ
Sbjct: 813  LIDLTTDVVEDPTDTTRHLASCDDDIIMCQSPVALPEHKTSSEAGTQQYSVQVAKISADQ 872

Query: 895  LENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLND 954
            LEN LE+GRQQDVTECIGNVL QLE ASEP  L+ D EQ DL+KQLF+G+++Q L P+ND
Sbjct: 873  LENTLEIGRQQDVTECIGNVLAQLEIASEPLSLEDDLEQNDLVKQLFYGRIKQDLIPVND 932

Query: 955  PTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQ 1013
               VRTK ERF+SLLVN GDHPKD+YDALD YF+ND L LE+ GDV R+V+I ELPAVLQ
Sbjct: 933  EASVRTKYERFLSLLVNTGDHPKDIYDALDFYFQNDYLNLEEYGDVKRTVSISELPAVLQ 992

Query: 1014 IQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXX 1073
            IQIQRVYYDRE+FMPFKSIEPLPF +++YMDRYM TEDP +L + ++ A           
Sbjct: 993  IQIQRVYYDREKFMPFKSIEPLPFGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLKQ 1052

Query: 1074 XQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELA 1133
             QR LL +N  G++ KSSL+ETK+FLQS  L+ +DI++ N   SI  ID ++  IDEEL 
Sbjct: 1053 RQRKLLSQNEIGLTLKSSLIETKKFLQSGTLKAHDIDADNIPSSIAYIDILINNIDEELK 1112

Query: 1134 SVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYND 1193
            S++++I  LE  +S  F +FK  GYSLFAVFIHRGEASYGHYW+YIKD  KNGIWRKYND
Sbjct: 1113 SLFNKITDLETTISQQFSEFKHIGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYND 1172

Query: 1194 ESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQ-IEPLHRV 1235
            +SVTE P+SEVFNF+EGNTATPYFLVYV+ GQE + IEPL R+
Sbjct: 1173 DSVTEVPQSEVFNFTEGNTATPYFLVYVREGQEQETIEPLKRI 1215

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1201 bits (3108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1248 (49%), Positives = 859/1248 (68%), Gaps = 31/1248 (2%)

Query: 14   EPADSISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAY----- 68
            E +D I  P+   G E G +  D+G  LLY +  ++ P KTSER+LD+I + +       
Sbjct: 46   ELSDEIQVPVSVIGNEMGLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVIN 105

Query: 69   RNSNGHDILYS-ALHSGVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPG 126
               N + + Y+   ++ +LK P++EYS+ +    P SIG ++DQ+V+++++EY+S TCP 
Sbjct: 106  SKENCNTLRYNEQFNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPN 165

Query: 127  LNKVSVFMGVLVSPSIVPREPEDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSEL 186
             NK+ VFMGVL+  +      +DL+   I H+K+TVKTR  LE TR+  G+ ++H++ EL
Sbjct: 166  HNKIEVFMGVLIDSTQKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKEL 225

Query: 187  HPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRF 245
            HP D++DL   +++  +L+D A+YVS DTNKL+ IEIF PEF S E+   F+P+ I +R+
Sbjct: 226  HPFDQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRY 285

Query: 246  AEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAW 305
              +  +  +   E +P+  EC +TL K+FKGPL R+S +D +K I++DN  L   + P W
Sbjct: 286  LHSLAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEW 345

Query: 306  LTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAV 365
            L  ++ F +   +  E  +   EY+PPDLTDYV+N   RK+RE  TRKCLEL+F GKM +
Sbjct: 346  LVSKYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMI 405

Query: 366  ALMSKDDVAQDSRA-RSFHLYQISYSPSFFFHLLGETRGV----MDYGTQEIDKNYHFIN 420
             L+SK+++ + S++ R+F+L Q S+S SFF  LL + RGV     +     ID  YHFIN
Sbjct: 406  NLLSKEELEKSSKSLRTFNLLQTSFSTSFF-KLLIQERGVGLPIENQSNYNID--YHFIN 462

Query: 421  LSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEA 480
            LS  ++YS++DII+ +E  +++DP+NIG Y+D+L FIAN KGSYQLI YC K D+VG+E+
Sbjct: 463  LSVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQES 522

Query: 481  LDSALSLFGIDASDTDLSTVPDDLLLGIYRKE--SSQASQQKRSSLKNSLRLIAKAKKSQ 538
            L++A+  F +D S T LS++ D +++ IY+ E  +   SQ++  +L+N+L+++A  KKS+
Sbjct: 523  LETAIKTFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSK 582

Query: 539  ILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVS 598
             L+F+  YEPY NT  AY++LE++ES+D DIIQTAY++KV D+PGLK+DCDRA+YTIA++
Sbjct: 583  KLKFFVDYEPYLNTRTAYNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIA 642

Query: 599  RRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVS 658
            RRS+ LFNFL E    F E+Y+AD  +Y  AL+LLQVNENASD+ ILEVFQ+KW +E + 
Sbjct: 643  RRSISLFNFLLENNLIFQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMV 702

Query: 659  SPDQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLL 718
            + D  L   +ALTKI   RNS LI+ +LETG+ID SCLPA NWPTGLNNIGNTCYLNSLL
Sbjct: 703  AFDHLLKLKAALTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLL 762

Query: 719  QYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLF 778
            QYYF ISPLR  I+ Y KT+ +   ++      RR+GGR  +  EVERS+QFVYQLRDLF
Sbjct: 763  QYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLF 822

Query: 779  TDMVHTENRYVTPTKELAYLAFAPSNIEVEF---EGTPSSGSVXXXXXXXXXXXXXXXXV 835
            ++M+++ +R VTP KELAYLAFAPSN+EVEF   +G     ++                +
Sbjct: 823  SEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLL 882

Query: 836  IDLTSV--PNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSD 893
            +D  S    N   +  ++D   + S+ I E+ V      KK +  + + TSTRVAKIS D
Sbjct: 883  VDFDSNIGANGRDEKLLVDLDSNISDKIKEEEV------KKINTLKPV-TSTRVAKISPD 935

Query: 894  QLENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLN 953
            QLENALEMGRQQDVTECIGNVL QLESAS P  LD D EQ DL+K  F  K +Q + PL 
Sbjct: 936  QLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLE 995

Query: 954  DPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVL 1012
                 R KIERF+SLLVN+GDHPK++YDALD YF +++LQ+E+ G+V ++++I E P++L
Sbjct: 996  KSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSIL 1055

Query: 1013 QIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXX 1072
            QIQIQRVYYDRE+F+PFKSIEPLPF + +YMDRY + ++  ++  + +A           
Sbjct: 1056 QIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMK 1115

Query: 1073 XXQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEEL 1132
              Q+ LL +N  G+S K SL+ETKR L SDVL+NN I+ P K   I  I++ LL+ID EL
Sbjct: 1116 KRQKELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDREL 1175

Query: 1133 ASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYN 1192
             ++++ I  +E  +S+ F +F+   Y+LFAVFIHRGEASYGHYW YIKD  +N IWRKYN
Sbjct: 1176 TTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYN 1235

Query: 1193 DESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRVTTKCA 1240
            DE++TE P+SEVFNF EGNTATPYFLVYVKN     IEPL R+ + CA
Sbjct: 1236 DETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIVSDCA 1283

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1198 bits (3099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/1226 (50%), Positives = 824/1226 (67%), Gaps = 36/1226 (2%)

Query: 36   DNGKALLYPDAGSL-FPFKTSERLLDEIKAELAYRNSNGHDILYSALHSGVLKLPVLEYS 94
            D G  LLYPD G+  FP KTS R++D+I  +L++   NG ++   +  +G+L+  ++ YS
Sbjct: 76   DPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSF--INGPNL---SFKNGILQESMIMYS 130

Query: 95   RKPVPD-PFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVS-PSIVPREPEDLAA 152
            ++ + +  +  G ++DQV L+T+YEY S TCP  NK+ V  G+L++ PS +    E ++ 
Sbjct: 131  KERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISK 190

Query: 153  APIYHLKLTVKTRMHLEHTRKQAGVCQYHML--SELHPSDKQDLFLAEESDPSLLDSAMY 210
             PIYHLK+TVKTR  LE ++KQAG+ QYH+L   +LH  DK+DL   +  +P LLD A+Y
Sbjct: 191  VPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIY 250

Query: 211  VSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKFPDLDPEKVPSQAECFST 269
            VSSDTN+L+ IEIF  EF S E+  +F   +I+ R+ EAC KF  LDPE VP+  +C +T
Sbjct: 251  VSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNT 310

Query: 270  LLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEY 329
            +LK+ K PL R++ +D ++T+S++N  L+S   P WL E++ F           +  LEY
Sbjct: 311  VLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEY 370

Query: 330  QPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALM--SKDDVAQDSRA-RSFHLYQ 386
            +PPDL  YV    VR LRE+Y R+CL+L+F GK  V L     D   + S++ R+F+L  
Sbjct: 371  EPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFNLLN 430

Query: 387  ISYSPSFFFHLLGETRGVM------DYGTQEIDKNYHFINLSACHYYSDKDIIKNYETQA 440
             + S +  + LL +++         D  +  +D+N+HFINLS   YY+D+DIIKNYE   
Sbjct: 431  TTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLI 490

Query: 441  RLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTV 500
             LDP NIG YFDAL++IAN KGSYQLI YC KQDVVG+E ++ AL  F ID +  +L ++
Sbjct: 491  ALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLESI 550

Query: 501  PDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLE 560
             D LLL IY+ ES +       +LKN++RL AK + S  L+FY  +EPY N  QAY  LE
Sbjct: 551  DDSLLLSIYKNESVKEGAD-FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETLE 609

Query: 561  VNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYS 620
            ++ SVD DIIQTAY++K  D+PGLKIDCDRA+YTIA+ RRSM LFNFL E C  F  +Y+
Sbjct: 610  IDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYYN 669

Query: 621  ADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSL 680
              +  Y++AL +LQVNENA+D+VIL+ FQ KW  E +   DQFL    AL K+G  RNS 
Sbjct: 670  IGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSK 729

Query: 681  LINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSE 740
            LIN +L  G+ID SCLP  NWPTG+NNIGNTCYLNSLLQYYF ISPLR+ ++ Y KT  +
Sbjct: 730  LINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYED 789

Query: 741  FHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAF 800
            F+ +  + ++ RRIGGREV + EVERSIQF+YQLRDLF  M++T  R VTP +ELAYLAF
Sbjct: 790  FYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAF 849

Query: 801  APSNIEVEFEGTPSSGSVXXXXXXXXXXXXXXXXVI----DLTSVPNAE----QDIEMLD 852
            APSN+EVEFE   +                    +     DL      E    +DI M D
Sbjct: 850  APSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEASPTEDIYMTD 909

Query: 853  PVPSESEMIVEQFVDS-PKDDKKQDAAEAIGTSTRVAKISSDQLENALEMGRQQDVTECI 911
                +  +   +  D   K+D+  +    I  ST+VAKISSDQLENALEMGRQQDVTECI
Sbjct: 910  ----DDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTECI 965

Query: 912  GNVLFQLESASEPTCLD-TDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLV 970
            GNVL+QLES SEP  ++  D EQ DL+KQLF+G+++Q + PL+   + R K+ERF+SLLV
Sbjct: 966  GNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLV 1025

Query: 971  NVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVYYDRERFMPF 1029
            NVGDHP+D+YDALD YFK++ L +++ G+V R+VAI + P +LQ+QIQRVYYDRERFMPF
Sbjct: 1026 NVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPF 1085

Query: 1030 KSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLDKNGSGMSFK 1089
            KSIEPLPF   IYMDRY+DT DP +L+ RE  A            Q+ LL +N  G+S K
Sbjct: 1086 KSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSRK 1145

Query: 1090 SSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSH 1149
             +  ET  FLQS+ L+   I    +++    +      ID+EL+++Y++I  LE+ +S  
Sbjct: 1146 EAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETISHQ 1205

Query: 1150 FDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSE 1209
            F+ FK+ GYSLFAVFIHRGEASYGHYW+YIKD  +NGIWRKYNDE+V+E P+ EVFNF+E
Sbjct: 1206 FEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTE 1265

Query: 1210 GNTATPYFLVYVKNGQESQIEPLHRV 1235
            GNTATPYFLVYVK G E  IEPL R+
Sbjct: 1266 GNTATPYFLVYVKEGSEKDIEPLKRI 1291

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1186 bits (3067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/1259 (48%), Positives = 837/1259 (66%), Gaps = 65/1259 (5%)

Query: 36   DNGKALLYPDAGSLFPFKTSERLLDEIKAELAY---RNSNGHDILYSALH---------- 82
            D+GK +LY    +   FKT++RLLD++  +L+Y    NS+ H    +  +          
Sbjct: 62   DDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDNNHNNNNNT 121

Query: 83   --------------SGVLKLPVLEYSRKPVPD-PFSIGHLLDQVVLKTRYEYESRTCPGL 127
                          +G+L+LP  +YS+       F++G ++DQ+ L+TR+E++S TCP  
Sbjct: 122  SNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEFKSVTCPEF 181

Query: 128  NKVSVFMGVLVSPSIVPREPEDLAA-APIYHLKLTVKTRMHLEHTRKQAGVCQYHMLS-- 184
            N V V +GVL+      R    L    P+YH K+TVKTR +LE T+K  G+  +H++   
Sbjct: 182  NDVHVLLGVLMDN----RSQAPLGTFLPVYHFKITVKTRSYLEKTKKHVGISHFHLIDFD 237

Query: 185  ELHPSDKQDLFLAEE--SDPSLLDSAMYVSSDTNKLVCIEIFKPEFSH-EDLATFSPDSI 241
            +LH  DK+DL +     +  SLLDSA+++S DTNKLV +EIFKPEF+  E++ +FS +SI
Sbjct: 238  DLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELEEIESFSQESI 297

Query: 242  RRRFAEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQI 301
              R+  AC +FP+LD +K+P+Q EC +T+ KIFKGPLN ++ ++ LK I+ADN  LNS  
Sbjct: 298  AERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAINADNPLLNSHW 357

Query: 302  EPAWLTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLG 361
             P WL  ++ F        +  E   EY PP+L DY+N+++ R LRE Y RKCLEL+F+ 
Sbjct: 358  NPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYIRKCLELIFIS 417

Query: 362  KMAVALMSKDDVAQDSRA-RSFHLYQISYSPSFFFHLLGETRGVMDYGTQEIDKNYHFIN 420
            K  ++LM  +D+  +S+A RSF++ Q  ++ SF+   L E +  +D    ++D  YH+IN
Sbjct: 418  KRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYEHKPQLD-TYNKLDYEYHYIN 476

Query: 421  LSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEA 480
            L    YY+++DII+NY     LDP NIGIY+DAL +IA  K SYQLI++  KQDV+G+EA
Sbjct: 477  LLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQLISFVSKQDVIGQEA 536

Query: 481  LDSALSLFGIDASDTD-LSTVPDDLLLGIYRKESSQA--SQQKRSSLKNSLRLIAKAKKS 537
            L+ AL+LF ID +D+  +ST+ + ++  IY+ E  QA  S  + + +KN+LRL+AK K S
Sbjct: 537  LNQALTLFNIDNNDSSAISTLTESMIFTIYKTERKQANISSARLAEMKNALRLLAKYKHS 596

Query: 538  QILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAV 597
              L+FY  YEPY +  Q Y+ LEV+ESVD DIIQTAYT+KV D+PGLKIDCDRA+ T+A 
Sbjct: 597  DRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAPGLKIDCDRALLTVAT 656

Query: 598  SRRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPV 657
             R+S+ LF FL ++CP F EFY  D+  Y +ALN LQVNENA+D+ ILE+FQ++W  +  
Sbjct: 657  RRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDETILEIFQQRWSNDKS 716

Query: 658  SSPDQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSL 717
               D  L   SAL+KI   +NS LI+ +++TGI+D +CLP  NWP GLNNIGNTCYLNSL
Sbjct: 717  LDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWPAGLNNIGNTCYLNSL 776

Query: 718  LQYYFCISPLRQSIVEYQKTLSEFHQSI---GHLESKRRIGGREVSEAEVERSIQFVYQL 774
            LQYYF I PLR  I++YQ T+  F   I     LE +RRIGGREV+E EVERS+QF+YQ+
Sbjct: 777  LQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKRRRIGGREVNELEVERSVQFIYQV 836

Query: 775  RDLFTDMVHTENRYVTPTKELAYLAFAPSNIEVEFEGTPSSGSVXXXXXXXXXXXXXXXX 834
            RDLF +M+ ++ R V+P +ELAYLAF PSNIEVEFE   +   +                
Sbjct: 837  RDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTEDDMGDKSNAQDAVVLQDEA 896

Query: 835  VIDLTSVPNAEQDIEMLDPVPSESEMIVEQFVDSPK-----DDKKQDAA----------- 878
              D T +   E ++  L+P    S    +  +D+ +     D+K ++ +           
Sbjct: 897  KND-TDINLTEVNLIDLEPATKVSTSNDQPTMDAIEILTNSDNKSKELSKTNPFREVSPN 955

Query: 879  EAIGTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASEPTCLDT-DGEQQDLI 937
            E I  STRVAKISSDQLENA EMGRQQDVTECIGNVLFQLE+  +P  LD  D EQ DL+
Sbjct: 956  EDITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLFQLETGFDPISLDNEDNEQYDLV 1015

Query: 938  KQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED- 996
            K+LF+GK +Q + PLN  +  R K+ERF+SLLVN+ DHPKD+YDAL+QYF ++ L +E+ 
Sbjct: 1016 KELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDHPKDIYDALNQYFADEFLTMEEY 1075

Query: 997  GDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLK 1056
            GDV +++++ E P +LQIQIQRVYYDRERFMPFKSIEPLPFE  IYMDRY ++ DP ++ 
Sbjct: 1076 GDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEPLPFEQVIYMDRYAESSDPELIS 1135

Query: 1057 KREEAAXXXXXXXXXXXXQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQ 1116
            K+EE A            Q+ LL KN  G+S K +++ET +FL+S V+  N I++ NK+ 
Sbjct: 1136 KKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMMETIKFLKSPVILENGIDTTNKDV 1195

Query: 1117 SIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYW 1176
             ++ +   +  I+ EL+++Y++I  L+ ++   FDDFK+  YSLFAVFIHRGEASYGHYW
Sbjct: 1196 LVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDDFKKLAYSLFAVFIHRGEASYGHYW 1255

Query: 1177 IYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRV 1235
            +YIKD  KNGIWRKYNDESVTE PE EVFNF+EGNTATPYFLVYVK    S IEPL R+
Sbjct: 1256 VYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATPYFLVYVKQDSLSDIEPLKRI 1314

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1177 bits (3045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/1217 (49%), Positives = 833/1217 (68%), Gaps = 46/1217 (3%)

Query: 36   DNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHSGVLKLPVLEYS- 94
            D+GK LLYP  G   PFKT +RL+D+I  +LA+ N    D   S+   G+LK   L YS 
Sbjct: 36   DDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFIN----DSDLSSEFKGILKSSPLTYSK 91

Query: 95   -RKPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIV-PREPEDLAA 152
             R+ +   + +G  +DQ+ L+T+YEYES +CP  N+++VF GVL+  ++  P   + +A 
Sbjct: 92   RRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNMENPTSFDAVAE 151

Query: 153  APIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEESDPSLLDSAMYVS 212
             PIYHLK+TVKTR  LEH +K  G+  YH+++ELHP DKQDL   +ESD +L+D A YVS
Sbjct: 152  TPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESDENLIDFAAYVS 211

Query: 213  SDTNKLVCIEIFKPEFSHEDLATF-SPDSIRRRFAEACGKFPDLDPEKVPSQAECFSTLL 271
            SDTNKL+ IEIFKPEFS E+       + I  R+   C ++  L+ + +PSQ +CF TL 
Sbjct: 212  SDTNKLILIEIFKPEFSSEEEIESFKTEHITSRYQLVCEQYDSLNSDTIPSQVDCFRTLF 271

Query: 272  KIFKGPLNRRSPD-DVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEYQ 330
            ++FKGPL+R+S D D +KTI+A NK LNS ++  WL  ++ FQ    Q  E  +  LEY+
Sbjct: 272  RVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLEYE 331

Query: 331  PPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRA-RSFHLYQISY 389
            PPDL D+ N+  +RKLR+ YTRKCL+L F GK++  L+SK ++ +  ++ R F+      
Sbjct: 332  PPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMHTHT 391

Query: 390  SPSFFFHLLGETRGVM---DYGTQEIDKNYHFINLSACHYYSDKDIIKNYETQARLDPEN 446
            S +  F +  ++   +   D     +D NYHFINLS+ +YY+D+DII+NYET   +D  N
Sbjct: 392  STTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCNIDTNN 451

Query: 447  IGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDDLLL 506
             GIYFDAL +IAN KGSYQLI+YC KQDVVG+E L ++L + G+DA+  D+ ++ D LL 
Sbjct: 452  KGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLNDSLLF 511

Query: 507  GIYRKE--SSQASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVNES 564
             IY++E  +S+   Q+ + LK+++R++ K  +S+ LQF+  +EPY N   AY+LL+++ES
Sbjct: 512  SIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLLDIDES 571

Query: 565  VDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSADKL 624
            VD DI+QTAYT+++ DSPGLK+DCD+A+YTIA+  RS+ LFNFL EQCP F  +Y  D L
Sbjct: 572  VDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYYGPDCL 631

Query: 625  TYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSLLINR 684
            ++Q+AL+LLQVNENA+D++++++FQ++W Q+ ++  DQ LI  +ALTKI   +NS LI+ 
Sbjct: 632  SFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQLLILKAALTKIASEKNSKLISY 691

Query: 685  YLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQS 744
            +LETG+ID + L   NWP GLNNIGNTCYLNSLLQYYF I+PLR+ I+ Y+ ++S +   
Sbjct: 692  FLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYE-- 749

Query: 745  IGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAPSN 804
            I    +KRRIGGREVSE EVERSIQF+YQLRDLF DM+++++R +TP  ELAYLAFAPSN
Sbjct: 750  IDETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLAFAPSN 809

Query: 805  IEVEFEGTPSSGSVXXXXXXXXXXXXXXXXVIDLT----SVPNAEQDIEMLDPVPSESEM 860
            IEVEF    ++  V                ++DL+    +  N  Q++     V +E ++
Sbjct: 810  IEVEF----AASEVERTTVDLPFDKEGDIDLVDLSNDNLNTTNNAQEVTSDISVATEDKV 865

Query: 861  IVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLES 920
            +                     TST+ AKISSDQLENALEMGRQQDVTECIGNVL+Q+ES
Sbjct: 866  MT-------------------NTSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQMES 906

Query: 921  ASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVY 980
            AS+P  LD D EQ DLIK+LF+GK +Q + PL+D +K RTK E F SLLVN+ DHP+D+Y
Sbjct: 907  ASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIY 966

Query: 981  DALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFED 1039
            DAL+  F ++ L++++ GDV R+V+I   P +LQIQIQRVYYDRERFMPFKSIEPLPF +
Sbjct: 967  DALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSN 1026

Query: 1040 SIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLDKNGSGMSFKSSLLETKRFL 1099
            +IYMDRY   ++ ++  K+ E              Q  LL++N  G+S K S LET  FL
Sbjct: 1027 TIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYLETINFL 1086

Query: 1100 QSD-VLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGY 1158
              +  + +  +   N+ Q I+ +   +  ID EL+ +Y  I  +E K+   FD+F+  GY
Sbjct: 1087 SDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGY 1146

Query: 1159 SLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFL 1218
            SLFAVFIHRGEASYGHYW+YIKD  ++GIWRKYNDE+VTE  E EVFNF+EGNTATPYFL
Sbjct: 1147 SLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDETVTEVNEEEVFNFTEGNTATPYFL 1206

Query: 1219 VYVKNGQESQIEPLHRV 1235
            V+VK+  +  IEPL R+
Sbjct: 1207 VFVKDYYKGDIEPLKRI 1223

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1170 bits (3028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1217 (50%), Positives = 816/1217 (67%), Gaps = 29/1217 (2%)

Query: 36   DNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHD-ILYSALHSGVLKLPVLEYS 94
            D+GK LLY D  +  P KTS+RL+D+I  +L+    NG    L S    G+LKL  + YS
Sbjct: 52   DDGKHLLYTDLKNGSPMKTSDRLIDDILCDLSL---NGQSQCLLSEQSQGILKLLPIIYS 108

Query: 95   --RKPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIVPREPEDLAA 152
              R+ + +   +G LLDQV+ +T++EY S +CP  NK+ VF+GVL++ S      +D+  
Sbjct: 109  KQRQQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKLQVFLGVLLNVSSSFESTDDVVR 168

Query: 153  APIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEESDPSLLDSAMYVS 212
            +P++HLK+TVKTR  LE  +K AGV Q+  +  LH  DK+DL   +  D  L+D A+YVS
Sbjct: 169  SPLFHLKVTVKTRSQLELYKKHAGVSQFFSVDSLHSYDKEDLGTFDPEDTRLIDYAIYVS 228

Query: 213  SDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKFPDLDPEKVPSQAECFSTLL 271
            SDTNKLV IEIF PEF + E++ +F+ D IR+R+ + C +   L+PE +P+Q +C +TL 
Sbjct: 229  SDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDTCSRLDSLNPEDIPNQFDCLNTLY 288

Query: 272  KIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEYQP 331
            K FK P+N+  P   L+TI A N  LNS +   WLTER+ F L      E  +   EY+P
Sbjct: 289  KTFKNPINKTDPSAPLQTIKASNPILNSHMNANWLTERYGFTLL---PGENEDDEDEYEP 345

Query: 332  PDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALM---SKDDVAQDSRA-RSFHLYQI 387
            P+ T Y+ +  VRK++E Y RKCL+L+F  K+ + ++    +  +A  S++ +S     +
Sbjct: 346  PNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIEVVDNTQRSKLAASSKSFKSLSGIAV 405

Query: 388  SYSPSFFFHLLGETRGVMDYGTQE---IDKNYHFINLSACHYYSDKDIIKNYETQARLDP 444
              +    + L GE++        +    D NYHFI LSA ++Y+D+DII NYET + +D 
Sbjct: 406  QNTSKPLYQLFGESKNAFLNSNDQNYMWDTNYHFIALSASYHYNDRDIIMNYETYSVIDK 465

Query: 445  ENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDDL 504
             NIGIYFDA+ FIAN KGSYQL+ YC KQ++VG EAL++A+  F +D +  D++ +   L
Sbjct: 466  GNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHEALEAAMRAFKLDPAAIDINKLDISL 525

Query: 505  LLGIYRKES-SQASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVNE 563
            LL +Y+ E  S  +    S LKN+LR++AK K ++ ++FY  +EPY    QAY+ LEV+E
Sbjct: 526  LLSMYKHEQISNQNTSHLSDLKNALRVLAKFKDNRFVKFYVDHEPYKTVSQAYNELEVDE 585

Query: 564  SVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSADK 623
            SVD DIIQTAY++KV DSPGLKI+C RA+YTIA+++RSM LFN+L E+CP F +FY  +K
Sbjct: 586  SVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAINKRSMALFNYLIEECPEFQDFYGPEK 645

Query: 624  LTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSLLIN 683
             +Y++AL ++QVNENASD++IL++FQ+KW+ EP+   DQFL   +AL K+   +NS LI+
Sbjct: 646  YSYEQALAIIQVNENASDEMILQIFQKKWNDEPLVEYDQFLSLKAALLKLCIEKNSKLIS 705

Query: 684  RYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQ 743
             +L TG+ID SCLP  NWP GLNNIGNTCYLNSLLQYYF I+PLR  I  YQ T   F  
Sbjct: 706  HFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQSTTESFEA 765

Query: 744  SIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAPS 803
            +    +  RRIGGR+V  +EVERSIQF YQLRDLF  M+ + +R V+PT+ELAYLAF+PS
Sbjct: 766  TDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLFNGMIFSNSRCVSPTQELAYLAFSPS 825

Query: 804  NIEVEFEGTPSSGSVXXXXXXXXXXXXXXXXVIDLTSVPNAEQDIEML---DPVPSESEM 860
            NIEVEF+    +GS                    LT +P   +D+ M    +P   ++ +
Sbjct: 826  NIEVEFD----AGSGIASESGGTFSLNGKDTDAPLTDMP-LNEDVTMTEAGEPQLDDTGL 880

Query: 861  IVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLES 920
            +     D P D  K  A E I +ST+VAKI SDQLENALE+GRQQDVTECIGNVL+QLES
Sbjct: 881  LAPVEADVPVDQMKL-AKEVINSSTKVAKIGSDQLENALELGRQQDVTECIGNVLYQLES 939

Query: 921  ASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVY 980
            AS+P  LD D EQ DLIK LF+GK RQ + PL++ T VR+K ERF+SLLVNV DHPKD+Y
Sbjct: 940  ASDPIKLDEDNEQYDLIKHLFYGKTRQDIVPLSNSTDVRSKYERFLSLLVNVSDHPKDIY 999

Query: 981  DALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFED 1039
            DALD YF  + L LE+ GDV R+VAI E P +LQIQIQRVYYDRERFMPFKSIEP+PF  
Sbjct: 1000 DALDSYFMEEYLTLEEYGDVRRTVAITEFPTILQIQIQRVYYDRERFMPFKSIEPIPFNS 1059

Query: 1040 SIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLDKNGSGMSFKSSLLETKRFL 1099
            ++YMDRY  T+DPVML KR E +            Q+ LL +N  G+S K +  ET + L
Sbjct: 1060 TLYMDRYAATDDPVMLTKRRETSELKTRLRECKVRQQELLSRNDMGLSRKEAYTETMKML 1119

Query: 1100 QSDVLEN-NDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGY 1158
            QSD LE    +   ++   +  +  M+  IDEEL  +Y  I  LE ++   FD F++ GY
Sbjct: 1120 QSDFLEQVPSVRGEDQTAVVSGLSDMVASIDEELVQLYTEIGQLETQIDHQFDSFQKVGY 1179

Query: 1159 SLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFL 1218
            SLFAVFIHRGEASYGHYW+Y+KD   +GIWRKYNDE+V+E PE EVFNF+EGN ATPYFL
Sbjct: 1180 SLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVPEEEVFNFTEGNNATPYFL 1239

Query: 1219 VYVKNGQESQIEPLHRV 1235
            V VK   E  IEPLHR+
Sbjct: 1240 VLVKQTHEQDIEPLHRI 1256

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1081 bits (2795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/1280 (46%), Positives = 816/1280 (63%), Gaps = 92/1280 (7%)

Query: 16   ADSISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHD 75
            AD   +PI      D  + +D+G+ LLYP+ G+  P KTS+RLLD+I   + +       
Sbjct: 22   ADLQGEPIPSA---DVTNIEDDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGF------- 71

Query: 76   ILYSALHSGVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFM 134
             L S  +  +L    LEYS+ +P     ++G   DQV+++T+YEY S++CP  NK+ V M
Sbjct: 72   -LTSGDNKSILNSNTLEYSKQRPHIKGSAVGFFQDQVIIQTKYEYPSKSCPEHNKIFVIM 130

Query: 135  GVLVSPSIV----PREPEDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSD 190
            G+L+    +     ++  ++   PIYH+K++VK R  LE+++K  GV +Y+ L +LH  D
Sbjct: 131  GILIGTDYLEKAEKKQISEVTEIPIYHVKISVKVRSILENSKKLVGVSRYYKLDQLHDYD 190

Query: 191  KQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEFSHEDL-ATFSPDSIRRRFAEAC 249
            + D    + +D  LLDSA+Y + DTNK+V IEI+KPEF  ED   + S   I+ RFA+A 
Sbjct: 191  RVDFPSYDPTDSKLLDSALYATDDTNKIVLIEIYKPEFDPEDKDLSVSSVQIKNRFAQAK 250

Query: 250  GKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTER 309
             KFP L  E+ P+Q +  +TL K+FKGPL R+S D   K+I A++  L S + P+ L   
Sbjct: 251  EKFPQLAKEESPTQLDSINTLFKLFKGPLKRKSDDAPQKSIEAEHPLLISNMNPSALVTH 310

Query: 310  FQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMS 369
            F F       + E     EY  PDL +Y+ + +++KLR+ +TRKCLEL+  G + ++ + 
Sbjct: 311  FGFTY-----TNENIPGGEYMAPDLVNYLGDPNIQKLRDTFTRKCLELIAYGNIIISSLP 365

Query: 370  KDDVAQDSRARSFHLYQISYSPSF----FFHLLGE--TRGV--------MDYGTQEIDKN 415
            ++  +    ++ + + + +  P F    +  LLG+  +R +          Y  QE  K 
Sbjct: 366  QNITSTAEFSKKYRILR-TIQPEFSLFSWLQLLGDFKSRNIELLNVNEHKGYHLQEAQKR 424

Query: 416  YH---------FINLSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQL 466
             +         F NLS C +Y+++DII+NYE    LD  NIGIYFD+L+ +AN KGSYQL
Sbjct: 425  VYYSPFDIDSNFTNLSVCLHYAERDIIQNYERLITLDEPNIGIYFDSLSVVANRKGSYQL 484

Query: 467  ITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKR-SSLK 525
            ++YC KQDV+G+EAL ++L++FGID +   L ++ ++LLL +Y+ E  +     R S LK
Sbjct: 485  LSYCGKQDVIGQEALQNSLAVFGIDYTKVTLESLDENLLLSVYKHEWKENPDNNRISDLK 544

Query: 526  NSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLK 585
            N+LRL+AK   S  L+FY  YEPY    +AY LLE++ESVD DIIQTAYT+K+ D+PGLK
Sbjct: 545  NALRLLAKYFTSDYLKFYVDYEPYRIIQKAYDLLEIDESVDEDIIQTAYTIKINDAPGLK 604

Query: 586  IDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVIL 645
            IDCDRA+YTIA SRRS+ LFNFL +QCP F  +Y A  L Y ++  +LQ+NEN ++  +L
Sbjct: 605  IDCDRALYTIAYSRRSLMLFNFLFDQCPEFQRYYGAQSLGYHQSFEILQINENITEPNLL 664

Query: 646  EVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGL 705
             VFQ+KW    +  PDQ L   +ALTKI   RNS L+  +LETG I+ + LPA NWPTG+
Sbjct: 665  HVFQQKWKNTLLEEPDQLLKYRAALTKIALERNSNLLLNFLETGNINPNSLPAENWPTGI 724

Query: 706  NNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVE 765
            NNIGNTCYLNSLLQ+YF ISPLR+ IV+YQKT+++   +   + SKRRIGGR+V + E+E
Sbjct: 725  NNIGNTCYLNSLLQFYFAISPLREYIVQYQKTIADLSSNPDSIISKRRIGGRQVGKNEIE 784

Query: 766  RSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAPSNIEVEFEGT------------- 812
            RS+QF+YQLRDL+ DM+ +  R VTP +ELAYLAFAPS+I+VEFE               
Sbjct: 785  RSVQFLYQLRDLYNDMIFSSQRCVTPKRELAYLAFAPSSIDVEFENAKTKSPISNIEGSN 844

Query: 813  --------PSSG-----SVXXXXXXXXXXXXXXXXVIDLTSVPNAEQDIEMLDPVPSESE 859
                    PS+G     ++                 I+   + +   DIEMLD       
Sbjct: 845  STTDSQPMPSTGENIDHNMDIEQEERNNEEINSTNNIESNDLVSNNHDIEMLD------- 897

Query: 860  MIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLE 919
                       D + +   E   T+ +VAKI  +QLENALE+GRQQDVTECIGNVLFQLE
Sbjct: 898  ----------TDKENEGNMEIEDTAIKVAKIDPEQLENALELGRQQDVTECIGNVLFQLE 947

Query: 920  SASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDV 979
            S+S PT L  D EQ DLIK+LFFG+  Q + PL   +  RTK+ERFVSLLVN+ DHPKDV
Sbjct: 948  SSSSPTSLSEDHEQNDLIKELFFGETNQHIKPLKADSVTRTKVERFVSLLVNIADHPKDV 1007

Query: 980  YDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFE 1038
            YDALD YFK + L +E+ G+V R +AIK+ P +LQIQIQRVYYDRERFMP+KSIEPLPFE
Sbjct: 1008 YDALDLYFKEEYLTMEEYGEVKRELAIKKFPTILQIQIQRVYYDRERFMPYKSIEPLPFE 1067

Query: 1039 DSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLDKNGSGMSFKSSLLETKRF 1098
              IY+DRY DT+D  +L+KREE A            Q+ LL +N  G+S + +  ET  F
Sbjct: 1068 SDIYLDRYADTDDVKLLQKREETAELKRQLRSFKERQKELLSRNELGLSRRDAYKETANF 1127

Query: 1099 LQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGY 1158
            L+S+VL+N +I   + +     ++    K+ +EL+ +Y +I  LE+K++  FDDF + GY
Sbjct: 1128 LRSEVLQNTNISISDPDLLATKLEESASKVADELSDLYVKITNLEEKINHQFDDFTEHGY 1187

Query: 1159 SLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFL 1218
            +LFAVFIHRGEASYGHYW+YIKD   N IWRKYNDE+VTE PE EV NF+EGNTATPYF+
Sbjct: 1188 TLFAVFIHRGEASYGHYWVYIKDF-VNSIWRKYNDETVTEVPEEEVMNFTEGNTATPYFI 1246

Query: 1219 VYVKNGQESQIEPLHRVTTK 1238
            V+VK G E  IEPL R+  K
Sbjct: 1247 VFVKKGHEKDIEPLKRMIEK 1266

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/808 (51%), Positives = 560/808 (69%), Gaps = 17/808 (2%)

Query: 36  DNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHSGVLKLPVLEYSR 95
           D+G+ +LY +     P KTS+RLLD+++  ++  +  G +         VL+ P+LEY+R
Sbjct: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL-SEEGRE---------VLRAPMLEYAR 70

Query: 96  KPV-PDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIVPREPEDLAAAP 154
           +      +S+G+LLDQVVL+T +EY SRTC   N+V VFMGVL  P       ++L    
Sbjct: 71  QRANARTWSVGYLLDQVVLQTSFEYTSRTC-AQNRVHVFMGVLCDPGQRFASQDELVNYR 129

Query: 155 IYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEESDPSLLDSAMYVSSD 214
           IYHL++TVK R  LE  R+  GV QYH++ ELHP DK D  L E+ DP+++DSA YV+S 
Sbjct: 130 IYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVASG 189

Query: 215 TNKLVCIEIFKPEFSHEDLATFSPDSIRRRFAEACGKFPDLDPEKVPSQAECFSTLLKIF 274
           TN+LV IE+ +PEF  ++L  F+ + IR R+ E C + PDLDP  +PSQAEC +TL K+F
Sbjct: 190 TNRLVRIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVF 249

Query: 275 KGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEYQPPDL 334
           K PL+R+   D LKTISADNK LNSQ+E  WL  +F F+LCE +  E+ +   EY+PPD 
Sbjct: 250 KNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIE--EDGQKIYEYKPPDF 307

Query: 335 TDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRARSFHLYQISYSPSFF 394
           T++V N  VR+ RE Y RK LEL+FLGK ++ L+ KD V  +S+ RSF LYQ  +S SF+
Sbjct: 308 TEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLYQTHFSHSFW 367

Query: 395 FHLLGE-TRGVMDYGTQEIDKNYHFINLSACHYYSDKDIIKNYETQARLDPENIGIYFDA 453
           +HL+GE      +      D NYHF++LS+ +YYSD+DIIKNYE Q  LDP N  IY+D 
Sbjct: 368 YHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANASIYYDD 427

Query: 454 LNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDDLLLGIYRKES 513
           L+F+AN KGS QL+TY  KQ+VVG EAL SAL LF +D S TD   + D+ LL  Y++  
Sbjct: 428 LSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLLESYKEVC 487

Query: 514 SQASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTA 573
             +  QK + L+N+LRL+A+ K+S  L+FY   EP+ N  QAY LLE++ESVD+DII+TA
Sbjct: 488 KDSGPQKHADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLLEIDESVDIDIIETA 547

Query: 574 YTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLL 633
           Y++KV+D+PGLK+DC RA+YT+AV++RS+ LFN L +QCP F++FY    L+YQ AL  L
Sbjct: 548 YSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQSALQYL 607

Query: 634 QVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSLLINRYLETGIIDV 693
            VN NA+DD+ILE+FQRKW  +P+ SP+Q L    ALTKIG  RNS LIN +LETG++D+
Sbjct: 608 HVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLETGLVDI 667

Query: 694 SCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSE-FHQSIGHLE-SK 751
           + LPAGNWPTG+NNIGNTCYLNSLLQYYF ISPLR+ I+ Y  T S   + ++   +  +
Sbjct: 668 NYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASNLLNNAVSSSDMGR 727

Query: 752 RRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAPSNIEVEFEG 811
           RRIGGR +S+AEVERS+QFVYQLR LF +MVH+  RYVTPT+EL YL+F+PS+ EVEFE 
Sbjct: 728 RRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSSTEVEFEP 787

Query: 812 TPSSGSVXXXXXXXXXXXXXXXXVIDLT 839
            P +                   VID++
Sbjct: 788 VPPAVGTASNALVANEVYNEDTEVIDIS 815

 Score =  413 bits (1062), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 221/386 (57%), Positives = 273/386 (70%), Gaps = 6/386 (1%)

Query: 855  PSESEMIVEQFVDSPKDDKKQDAAEAIG--TSTRVAKISSDQLENALEMGRQQDVTECIG 912
            P E    VE   DS KD     + EA G  TST VAKISSDQLEN LE+GRQQDVTECIG
Sbjct: 1003 PLEDRQAVEN-DDSGKDITMVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIG 1061

Query: 913  NVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNV 972
            NVL+Q+ESAS P  LD +GEQ DL+KQLF+GKL+Q L PL  P + RTKIERF+SLLVN+
Sbjct: 1062 NVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNI 1121

Query: 973  GDHPKDVYDALDQYFK--NDVLQLEDGDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFK 1030
            GDHPKD+YDALD YFK     L  +DG V RSVA+ ELP +LQIQIQRVYYDRE+FMPFK
Sbjct: 1122 GDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFK 1181

Query: 1031 SIEPLPFEDSIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLDKNGSGMSFKS 1090
            S EPLPF + +YMDRY+ T++  +  K+++A             +R LL KN  G++  +
Sbjct: 1182 STEPLPFGEKLYMDRYLATDNAELNAKKQQAIGLREELERLRERRRRLLAKNDHGVTLSA 1241

Query: 1091 SLLETKRFLQSDVLENNDIESPNKEQSIQT-IDSMLLKIDEELASVYHRIAFLEQKLSSH 1149
            +L +T+RFL +  L +   +   +  +  + +D++ + +DEELA++   IA ++  ++  
Sbjct: 1242 ALADTRRFLDAAELTSGSRQLQEQYHATTSHLDALRVALDEELAALDAHIASVQDAIAHR 1301

Query: 1150 FDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSE 1209
            FD F   GYSL AVFIHRGEASYGHYW+YIKD    GIWRKYNDESVTE PESEVF+FSE
Sbjct: 1302 FDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSE 1361

Query: 1210 GNTATPYFLVYVKNGQESQIEPLHRV 1235
             NTATPYFLVYVK   E  IEPL R+
Sbjct: 1362 ENTATPYFLVYVKEAHELDIEPLKRL 1387

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/1215 (37%), Positives = 675/1215 (55%), Gaps = 111/1215 (9%)

Query: 52   FKTSERLLDEIKAELAYRNSNGHDILYSALHSGVLKLPVLEYSR-KPVPDPFSIGHLLDQ 110
            FKTS+R++D+I  +L++ NS+  +I    L+ G+L+LP  +YS+ +     + I +L ++
Sbjct: 106  FKTSDRIIDDILIDLSFINSSADEIKELGLNKGILRLPTTDYSKFRSSFSEYKIINLSNK 165

Query: 111  V-VLKTRYEYESRTCPGLNKVSVFMGVLVSPSIVPR-EPEDLAA----APIYHLKLTVKT 164
              ++  R+EYES+T    NK+  F  +L  P      + E +A        YHLK+++KT
Sbjct: 166  NNLINYRFEYESKTNHQDNKILEFFSILHKPKDASNLDYESMAKFWSQNEFYHLKVSIKT 225

Query: 165  RMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIF 224
            R  LE ++K   +  ++++ E +  DK D       +P+LLD A+++SS+TNK+V +EIF
Sbjct: 226  RNQLELSKKHTPIQHFYVIDEFNEEDKLDFINFNPDNPNLLDYAIFISSNTNKVVLVEIF 285

Query: 225  KPEFSHEDLATFSPDSIRRRFAEACGKFPDLDPE-KVPSQAECFSTLLKIFKGPLNR--- 280
            K EF+  D      D    +      K+ + + + K+P+Q +    L+  F    N    
Sbjct: 286  KSEFNLNDKLIILDD---LQVLNNYEKYKNSNHKLKLPTQTDVLLVLMYCFNKQQNFDNI 342

Query: 281  RSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEYQPPDLTDYVNN 340
             S +D +K    D+K +   + P+WLTERF  +       +E E+ +        +  NN
Sbjct: 343  HSSEDEIKL--KDSKAIKISLNPSWLTERFSLKF------QEDESLI------FMNLRNN 388

Query: 341  LSVRKLREE----YTRKCLELVFLGKMAVALMSKDDVAQDSRARSFHLYQISYSPSFFFH 396
            L++ K  +     +TR  LEL  L K A   + K +    +  +      I+ S SF+  
Sbjct: 389  LNLIKKEKRRFDVFTRCLLELFVLIKSAPQKLVKCNSKDTNIIKVVDTISINSSLSFWSQ 448

Query: 397  LLGETRGVMDYGT-QEIDKNYHFINLSACHYYSDKDIIKNYETQARLDPENIGIYFDALN 455
            +LGE + ++      +  K+  FINLS    Y++ +I+KNYE    L+P+ IG+YFD+L 
Sbjct: 449  ILGEYKSILSQNNFNQYSKHAEFINLSILPTYTESEIVKNYEILTILNPDKIGVYFDSLK 508

Query: 456  FIANFKGSYQ-LITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDDLLLGIYRKESS 514
            F++     Y+ L  Y  K +++G E  + +L +F +D    + +   D +L   Y     
Sbjct: 509  FVSQCLTQYENLADYVNKNEIIGNEEFNQSLKIFKMDK--LEFTNCSDSVLWEKYLTYYE 566

Query: 515  QAS-QQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTA 573
              +     + L+NS++ ++  K S IL+F   YEPY N   A+  L ++ESVD D I  +
Sbjct: 567  DKNFDYNHAILRNSIKSLSIVKNSPILKFLCKYEPYKNPDNAFVTLNIHESVDSDTIIVS 626

Query: 574  YTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLL 633
            YT K+ D    K   D+A+ TIA+ R+ + LF+ L E C  F   Y +  + Y+ AL  +
Sbjct: 627  YTTKINDMKDKKQHLDKALLTIAIDRKDLSLFHTLYENCKDFVNLYHSMNIEYKTALQAI 686

Query: 634  QVNENASDDVILEVFQRKWHQEPVSSPDQF-------LISSSALTKIGQVRNSLLINRYL 686
              +E  SD+ ++  F+++W++  V++ D F       L     +  I   RNSLL+N Y+
Sbjct: 687  DSSELNSDNELILSFKKRWYRIDVNN-DTFGDDTVNLLTLRKVMMVISSNRNSLLLNNYI 745

Query: 687  ETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIG 746
            E GI++   LP+ +WP GLNNIGNTCYLNSLLQYYF ISPLR+ ++ +     +  + + 
Sbjct: 746  EYGIVNPKFLPSKSWPVGLNNIGNTCYLNSLLQYYFAISPLREYLINFNDIELD-GREMK 804

Query: 747  HLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAPSNIE 806
            +LE KRR+GGR +S AE  RSIQFVYQLRDL+ +MVH+ +R V+P  +LAYLAFAPS+  
Sbjct: 805  NLE-KRRVGGRNLSIAEFHRSIQFVYQLRDLYGEMVHSSSRKVSPRLQLAYLAFAPSDTP 863

Query: 807  VEF-EGTPSSGSVXXXXXXXXXXXXXXXXVIDLTSVPNAEQDIEMLDPVPSESEMIVEQF 865
            +EF +G  ++                   +  L S  N   D +    + S+SE  +  F
Sbjct: 864  IEFRDGIQNAIGKNDYYSDKTNGGSESSSIKGLNS--NLNSDSDADSSLDSDSESSLLTF 921

Query: 866  VDSPKDDKKQDAAEAIGTSTR-----VAKISSDQLENALEMGRQQDVTECIGNVLFQLES 920
             + P           I TST      + KISS QLE  LEMG QQDVTECI NVLFQ+E+
Sbjct: 922  DNLP----------IIKTSTTNLPTLIPKISSSQLETTLEMGSQQDVTECIENVLFQIEA 971

Query: 921  ASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVY 980
            AS P  +D D EQ DL+KQLFFGK  Q + P N+ +KV  K ERF+SLLV+V D P+D+Y
Sbjct: 972  ASNPISIDEDNEQVDLVKQLFFGKTEQKIKPFNEVSKVHPKRERFLSLLVSVSDKPRDIY 1031

Query: 981  DALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFED 1039
            DALD YFK++V  +E+ G V +S+ I   P +LQ+QIQRVYYD E+ +PFK +EPL F +
Sbjct: 1032 DALDTYFKDEVFDMEEYGKVKKSLTISSFPTILQVQIQRVYYDIEKGVPFKDLEPLRFSE 1091

Query: 1040 SIYMDRYMDTEDPVMLKKREEAAXXXXXXXXXXXXQRSLLDKNGSGMSFKSSLLETKRFL 1099
            S+Y+DRY +  D  + +K+ E A                L K   G      L+  K+  
Sbjct: 1092 SLYLDRYANDIDEKLAEKKIEVAS---------------LKKRLKG------LITIKK-- 1128

Query: 1100 QSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGYS 1159
                    ++E  N    I+TI                 I  +E K+ + F +F + GYS
Sbjct: 1129 --------ELEKKNDNVEIRTISK--------------EINDVETKIDTAFSEFHKHGYS 1166

Query: 1160 LFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFLV 1219
            LFAVFIHRG+A++GHYWIYIKD   +G WRKYND  VTE    EVFNFSEGN++TPYFLV
Sbjct: 1167 LFAVFIHRGQATFGHYWIYIKDFKNHGTWRKYNDHEVTEILPIEVFNFSEGNSSTPYFLV 1226

Query: 1220 YVKNGQESQIEPLHR 1234
            Y+KNG E  +EPL R
Sbjct: 1227 YIKNGSEFDVEPLKR 1241

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1248 (33%), Positives = 654/1248 (52%), Gaps = 118/1248 (9%)

Query: 27   GLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHSGVL 86
             +E   ++ D+G  LLY +      FKTS+R+LD+I  ++A+ + +           GVL
Sbjct: 60   NVEKNDTSIDDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFMSLDSEKSDDIDFKDGVL 119

Query: 87   KLPVLEYS--RKPVPDPFSIGHL-LDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIV 143
             LP ++YS  RK +  PF I     +  V+  + +++S T P  N ++   G+LV P I 
Sbjct: 120  NLPTIKYSLWRKYIK-PFKIILFNTNNPVVDVKLQHKSVTSPKNNTITELYGLLV-PKI- 176

Query: 144  PREPE------DLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSE---LHPSDKQDL 194
            PR  E       + + P+Y +++TVKTR  LEH +K   +  Y +L +   LH  DK D 
Sbjct: 177  PRRSELNTFDEYIRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDF 236

Query: 195  FLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEFSHEDL-ATFSPDSIRRRFAEACGKFP 253
                +    LLD ++Y+SSDTNK++ IEIFKP F+  +L    S  S+  R  E      
Sbjct: 237  PKFNKDSKDLLDFSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNELDNLHE 296

Query: 254  DLDPEK----VPSQAECFSTLLKI----FKGPLNRRSPDDVLKTISADNKFLNSQIEPAW 305
            +L P+     V  Q +    LL       KG   R         + +D+  L + ++  W
Sbjct: 297  ELQPDYNDAIVEEQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLGTYVDIKW 356

Query: 306  LTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAV 365
            L E F  ++ E +  +     L+       D  N  +  K  ++ TR  +EL++LGK+  
Sbjct: 357  LEENFDIKVKEQKRKDHVSITLDEALKLSFDDPNPKNQAKF-DKITRYAMELMYLGKVLQ 415

Query: 366  ALMSKDDVAQDSRARS-FHLYQISYSPSFFFHLLGETRGVMD---YGTQEIDKNYHFINL 421
            +  S ++  ++    + F   ++ ++ SF+  +L E + +       T+ +D+  HFINL
Sbjct: 416  SFYSNEEEIEEYMEDTIFKQVKVHHTTSFWTQILNEYQSIFSSQKTSTRCVDE--HFINL 473

Query: 422  SACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIA-NFKGSYQLITYCRKQDVVGKEA 480
                  S+KDII NYE Q R DP+N   YF++L +++  F     L  YC++  ++ K A
Sbjct: 474  CIDSNVSEKDIITNYEIQLRTDPDNDSKYFESLKYVSRKFPDYIVLEKYCKENVIISKAA 533

Query: 481  LDSALSLFGIDA----SDTDLSTVPDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKK 536
               AL +F        +   +S + D     +  + ++    Q R  L +S   +A  KK
Sbjct: 534  YLHALEIFKYSEEYFNAIEHVSEIWDKYTELV--QSNNNNDDQYRVDLVDSFYSLATVKK 591

Query: 537  SQILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIA 596
            S  L + T YEP+ +   AY  L V+  +D + I  AYT+++ + P  KI  DRA++ IA
Sbjct: 592  SSPLIYITKYEPFFHPVTAYLKLNVDAKLDSENIVLAYTMQIREVPEHKIQFDRALFAIA 651

Query: 597  VSRRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEP 656
            + R  + L   L + C AFNE  S   LT  +A  ++ + + +S+  I+  F + W +  
Sbjct: 652  IQRHDLSLLYVLKQNCSAFNECISNIILTSDDAFEIIGMPKTSSELSIINTFTKYWKETD 711

Query: 657  VSSPDQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNS 716
             S+P  F+++S+AL ++ + R S L+  + E G ++   + +  WPTG+NNIGNTCYLNS
Sbjct: 712  DSNPVNFILASAALREVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLNS 771

Query: 717  LLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRD 776
            LLQYYF I+  R+ I  YQ   S+   S   + SKRR+GGRE+   E+ RS+QF+YQ++D
Sbjct: 772  LLQYYFSITLFREFIENYQSIESDLLNSNAEM-SKRRVGGREIQNNEINRSVQFIYQVQD 830

Query: 777  LFTDMVHTENRYVTPTKELAYLAFAPSNIEVEFEGTPSSGSVXXXXXXXXXXXXXXXXVI 836
            LF  MVHT++R VTP+ +LAYLAFAP+N E++F+      S                 + 
Sbjct: 831  LFKLMVHTKSRKVTPSNQLAYLAFAPNNAEIKFKHKSELES----SEEHQLTTSHSIALS 886

Query: 837  DLTSVPNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTR-VAKISSDQL 895
              TS+ +++ D +  D                        +  +   S R VA ++ D L
Sbjct: 887  SATSISHSDIDTQDHDI-----------------------SLNSTSYSNRLVAMVTRDDL 923

Query: 896  ENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDP 955
            E  LE+G QQDVTECI  VL+Q+E+ S P  LD D EQ DL+K+LF+G+  Q + P+   
Sbjct: 924  ETTLEIGNQQDVTECINTVLYQVETGSMPLYLDADNEQMDLVKELFYGETIQEICPIKKF 983

Query: 956  TKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQI 1014
             K   K E + SLLVN+ D P D+Y+ LD+YF ++ + +E+ G+V ++++I +LP +L I
Sbjct: 984  IKGHEKRELYSSLLVNILDSPTDLYEVLDEYFADEYMSMEEYGEVKKTLSITKLPTILNI 1043

Query: 1015 QIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYM---DTEDPVMLKKREEAAXXXXXXXXX 1071
            QIQRVYYD+E+ +P+K    LPF++ I++DRY+     E+ V+ K R             
Sbjct: 1044 QIQRVYYDKEKLVPYKCGTALPFKNEIFLDRYIKGNKKENDVLEKAR------------- 1090

Query: 1072 XXXQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEE 1131
                          +  K + ++ +      V E N +     ++ I T D +     EE
Sbjct: 1091 --------------LELKLAKVKYREL----VSEYNSVNKSISDRIITTYDRI-----EE 1127

Query: 1132 LASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKY 1191
            L +V       + K+           YSLFAVFIHRG+AS+GHYW+YI+D  +NGIWRKY
Sbjct: 1128 LNAVIEEEVTKDAKIR----------YSLFAVFIHRGQASFGHYWVYIRD-FENGIWRKY 1176

Query: 1192 NDESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRVTTKC 1239
            ND  VT A E E+F   +G+ +TPYFL YV + ++S ++PL R  T+ 
Sbjct: 1177 NDHQVTGAHEDEIFKCVDGDISTPYFLAYVDSSKKSIVKPLVRDVTRA 1224

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 5/49 (10%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLS-----EFHQSI 745
           P GL N+GNTCYLN+ LQ  F I PLR+ I+ Y+++ S     E HQ I
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSVSPADEVHQKI 156

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y+L  +  H+G  S  GHY  +I+D     IW K+ND+ VT   + ++   + G  +   
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKIETLAGGGESDSA 493

Query: 1217 FLVYVK 1222
             ++  K
Sbjct: 494  LILLYK 499

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%)

Query: 683 NRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEF 741
           NR++E     V      + P GL N+GNTCY+N+ LQ  + I+PLR++I+ + K    F
Sbjct: 84  NRFIEDLDPSVQMQKLSSTPIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNF 142

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTA-TP 1215
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ V+   + ++ + + G  + + 
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVSVIEKEKIESLAGGGESDSA 482

Query: 1216 YFLVY 1220
              LVY
Sbjct: 483  LILVY 487

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 43/97 (44%), Gaps = 21/97 (21%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSE 761
           P GL N+GNTCY+NS LQ  + I PLR+ I+ +Q               + R G      
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPP------------KENRSG------ 146

Query: 762 AEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYL 798
              E+ IQ V +L+  F  +        TP   LA L
Sbjct: 147 ---EQHIQLVAELKRCFQQLRDRPQESTTPILLLATL 180

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTA-TP 1215
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ V+   + ++ + + G  + + 
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVSVIEKEKIESLAGGGESDSA 485

Query: 1216 YFLVY 1220
              L+Y
Sbjct: 486  LILIY 490

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query: 698 AGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKT-----LSEFHQSI 745
           A + P G  N+GNTCYLN+ LQ  + I PLR  I++Y +      + E H+ I
Sbjct: 104 ANDLPIGFQNMGNTCYLNATLQALYRIEPLRDMILDYNQNSTTTPVDETHKKI 156

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTA-TP 1215
            Y L  V  H+G  S  GHY  +I+D      W  +ND+ V+  P+ ++   + G  + + 
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDEDKWYNFNDDKVSVVPKEKIEGLAGGGESDSA 484

Query: 1216 YFLVY 1220
              L+Y
Sbjct: 485  LILIY 489

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 43/97 (44%), Gaps = 21/97 (21%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSE 761
           P GL N+GNTCY+NS LQ  + I PLR  ++ Y                  ++   + SE
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNY------------------KVPREKPSE 100

Query: 762 AEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYL 798
              E+  Q V +LR  F  +       VTP   LA L
Sbjct: 101 ---EQHHQLVSELRRCFQQLKDKPQESVTPMLLLAML 134

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTA-TP 1215
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ V+   + ++ + + G  + + 
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVSIIEKEKIESLAGGGESDSA 439

Query: 1216 YFLVY 1220
              L+Y
Sbjct: 440  LILIY 444

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 25/33 (75%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           P G+ N+GNTCY+N+ LQ  F I PLR+ ++E+
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEF 133

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 47/116 (40%), Gaps = 30/116 (25%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSE 761
           P GL N+GNTCY N+ LQ  + I PLR+ ++ Y +   + H                   
Sbjct: 105 PMGLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPNPDLHG------------------ 146

Query: 762 AEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAPSNIEVEF-EGTPSSG 816
                  Q V QLR+ F      + +  TP   L  L      I  +F E  PS+G
Sbjct: 147 -------QLVIQLRNCFNAFAQRKEKEFTPIILLTVL----RKIYPQFAEKDPSTG 191

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTA-TP 1215
            Y+L  V  H+G  S  GHY  +++D      W KYND+ V      +V   + G  + + 
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKVYVVTREKVEQLAGGGESDSA 474

Query: 1216 YFLVY 1220
              L+Y
Sbjct: 475  LILIY 479

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 683 NRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           N+++E    +     + + P G  N+GNTCYLNS LQ  + I PLR+ I+ Y
Sbjct: 88  NQFIEDLAPEEQLQRSSDLPIGFQNMGNTCYLNSTLQALYRIKPLRELILSY 139

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTA-TP 1215
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ V+   + ++ + S G  + + 
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKEKIESLSGGGESDSA 490

Query: 1216 YFLVY 1220
              L+Y
Sbjct: 491  LILIY 495

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 30/129 (23%)

Query: 1130 EELASVYHRIAFLEQ-KLSSHFDDFKQEG-----YSLFAVFIHRGEASYGHYWIYIKDSG 1183
            +++  V  R  F E   LS + +D K+E      Y+L  V +H G+ S GHY+  IK  G
Sbjct: 405  DQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVYNLHGVLVHAGDISTGHYYTLIK-PG 463

Query: 1184 KNGIWRKYNDESVTEAPESEVFNFSEGNTATP-----------------------YFLVY 1220
                W +++DE V +  +++VF  + G  A P                       Y LVY
Sbjct: 464  LEDQWYRFDDERVWKVTKNQVFEENYGLDALPDDKLRTMTREQYQEYVLARHTSAYMLVY 523

Query: 1221 VKNGQESQI 1229
            +++ +E Q+
Sbjct: 524  IRSDREDQL 532

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 82/179 (45%), Gaps = 24/179 (13%)

Query: 886  RVAKISSDQLE-------NALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIK 938
            +V+K   D LE       ++ E   Q DV E    ++ +LE+  + T +      + ++ 
Sbjct: 257  QVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTSV------EGMLN 310

Query: 939  QLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDG- 997
            ++F GK++  +  + D     +++E F  L +NV +  K + ++ D Y + ++L  E+  
Sbjct: 311  EIFVGKMKSYIKCI-DVDYESSRVEDFWDLQLNVKNM-KGLKESFDNYIEIELLNGENQY 368

Query: 998  --------DVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMD 1048
                    D  + V  +  P VL +Q++R  YD       K  +   F ++I +  Y++
Sbjct: 369  QAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLE 427

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + +
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQ 233

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY-QKTLSEFHQSIGHLESKRRIGGREVSEA 762
           G  N GNTCY NS+LQ  + +SPLR++I+++ +K +   H     +   R    R  +EA
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENILQFPEKPIESGHPRKNEMRGNR---PRIFTEA 197

Query: 763 EVERS 767
             ERS
Sbjct: 198 SFERS 202

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (72%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           P G+ N+GNTCY+N+ LQ  + I PLR+ I+ +
Sbjct: 59  PMGIVNMGNTCYMNATLQGLYGIVPLREQILAF 91

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTA-TP 1215
            Y L  V  H+G  S  GHY  +++D   +  W K+ND+ VT   + ++ + + G  + + 
Sbjct: 377  YDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVTAIEKEKIESLAGGGESDSA 436

Query: 1216 YFLVY 1220
              L+Y
Sbjct: 437  LILIY 441

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 3/42 (7%)

Query: 696 LPAGNWPT---GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           LP G+  T   GL N GNTCY NS+LQ  F +S LR +I+ Y
Sbjct: 123 LPCGDGSTKVFGLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 1135 VYHRIAF-LEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYN 1192
            ++++I + L+ K+ +  D    + Y L  + IH G    +GHY    K       W  Y+
Sbjct: 613  LFNKIYYPLKLKVCTKSDTIVCKNYELNGIVIHMGGGPQHGHYVAICKHDMFG--WLLYD 670

Query: 1193 DESVTEAPESEVFNF--SEGNTATPYFLVY 1220
            DE+V    E  VF F   E +  T Y L +
Sbjct: 671  DETVESIDEETVFKFVGDEKDMTTAYVLFF 700

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 74/157 (47%), Gaps = 19/157 (12%)

Query: 904  QQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLN-DPTKVRTKI 962
            Q DV E    ++ +LE+  + T ++        I +LF GK++  +  +N D   VRT  
Sbjct: 282  QHDVQELNRILMDRLETRMKGTSVEGK------INELFVGKMKSYIRCINVDYQSVRT-- 333

Query: 963  ERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDG---------DVNRSVAIKELPAVLQ 1013
            E F  + +NV +  +D+  + + Y + +++  E+          D  + V  +  P VL 
Sbjct: 334  EDFWDIQLNVKNM-RDLQTSFENYIEVELMDGENQYAAQGHGLQDAKKGVVFESFPPVLH 392

Query: 1014 IQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTE 1050
            +Q++R  YD       K  +   F DSI +  YMD+E
Sbjct: 393  LQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSE 429

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP 1215
            Y L  V +H G+ S GHY+  IK S K+  W +++D+ V  A + ++F+ + G    P
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPSTKDE-WYRFDDDRVWRATKKQIFDDNFGFDRLP 496

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 44/100 (44%), Gaps = 16/100 (16%)

Query: 657 VSSPDQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNS 716
           + +PD  LIS    T           N ++E    D       + P GL N+GNTCY+N+
Sbjct: 72  LGTPDADLISKPKGT-----------NHFIEDLTPDQQMQKFDSNPIGLQNMGNTCYMNA 120

Query: 717 LLQYYFCISPLRQSIVEYQKTLS----EFHQSIGHLESKR 752
            LQ  F +  +R  I+ Y    +    E H  I  LE KR
Sbjct: 121 TLQALFRVDSIRDLILNYDPAKASPQDEMHHKIV-LEMKR 159

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y+L  +  H+G  S  GHY  +I+D      W K+ND+ V+   + ++   + G  +   
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVSVVEKEKIEALAGGGESDSA 483

Query: 1217 FLVYVK 1222
             ++  K
Sbjct: 484  LILMYK 489

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 8/68 (11%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGRE---VS 760
           G  N GNTCY NS+LQ  + +S LR++I+++ K   E  Q       K+ + G++    +
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPKKSRESDQP-----RKKEMRGKKPRIFT 195

Query: 761 EAEVERSI 768
           EA  E+SI
Sbjct: 196 EASFEKSI 203

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRI 754
           P G  N+GNTCYLN+ LQ  + ++ LR+ I+ Y  +    +  +   E+ ++I
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNNGVQDEETHKQI 160

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ V+   + ++ + + G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1217 FLVYVK 1222
             ++  K
Sbjct: 490  LILMYK 495

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 6/67 (8%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGH--LESKRRIGGREVSE 761
           G  N GNTCY NS+LQ  + +S LR++I+++ +   E +QS  H    +K RI     +E
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPEKPIESNQSRKHDMKGNKPRI----FTE 197

Query: 762 AEVERSI 768
           A  E+S+
Sbjct: 198 ASFEKSV 204

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           P G  N+GNTCYLN+ LQ  F +  LR+ I+ Y
Sbjct: 107 PIGFKNMGNTCYLNATLQSLFRMDQLRELILNY 139

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVT 1197
            Y+L  V  H+G  S  GHY  +I+D     +W K+ND+ V+
Sbjct: 430  YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVS 470

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 1142 LEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAP 1200
            L   ++S FD   ++ Y L  V IH G +  +GHY    K+  K G W  ++DE+V    
Sbjct: 676  LTLNVASTFDSSIEKAYELTGVVIHMGSSPQHGHYVSLCKND-KFG-WLLFDDETVESVS 733

Query: 1201 ESEVFNFS--EGNTATPYFLVY 1220
            ES V  F+    N AT Y L Y
Sbjct: 734  ESTVLEFTGDPNNQATAYVLFY 755

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRI 754
           G  N GNTCY NS+LQ  + +   R +++EY   L   + +I      RRI
Sbjct: 173 GYENFGNTCYCNSVLQCLYNLYEFRLNMLEYSDHLPHNYANI----ENRRI 219

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 24/95 (25%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF------------ 1205
            Y L  V +H G+ S GHY+  IK S ++  W +++DE V +  +++VF            
Sbjct: 431  YKLHGVLVHAGDISTGHYYAMIKPSTEDQ-WYRFDDEKVWKVTKTQVFDENFGLDRIPDD 489

Query: 1206 -----------NFSEGNTATPYFLVYVKNGQESQI 1229
                       N+      + Y LVY++  QE+ +
Sbjct: 490  EVRLMSREQYQNYLLARHTSAYMLVYIREDQEADL 524

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 77/163 (47%), Gaps = 20/163 (12%)

Query: 904  QQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIE 963
            Q DV E    ++ +LE+  + T +      +D + ++F G+++  +  +N   +  +++E
Sbjct: 272  QHDVQELNRILMDRLENKMKGTPV------EDKLNEIFVGRMKSYIKCINVDYE-SSRVE 324

Query: 964  RFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDG---------DVNRSVAIKELPAVLQI 1014
             F  L +NV +  KD+  + + Y + +++  E+          D  + V  +  P VL +
Sbjct: 325  EFWDLQMNVKN-LKDLKSSFENYIEIELMNGENQYAAQDYGLQDAEKGVIFESFPPVLHL 383

Query: 1015 QIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMD---TEDPVM 1054
            Q++R  YD       K  +   F DSI +  Y+D   TED  M
Sbjct: 384  QLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEM 426

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + +
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYQ 223

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y L  +  HRG  + GHY  + K SG  G W K+ND  VT   + EV 
Sbjct: 411  YELIGIVSHRGTVNEGHYIAFCKISG--GQWFKFNDSVVTSIAQGEVL 456

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRI 754
           P G  N+GNTCYLN+ LQ  + +  LR  I+ Y  +    +  +   E+ ++I
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNSGVQDEETHKQI 160

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ V+   + ++ + + G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1217 FLVYVK 1222
             ++  K
Sbjct: 490  LILMYK 495

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 59/133 (44%), Gaps = 32/133 (24%)

Query: 1130 EELASVYHRIAFLEQ-KLSSHFDD---FKQEG---YSLFAVFIHRGEASYGHYWIYIKDS 1182
            ++L  V  R  F E   LS + D     KQ+G   Y+L  V +H G+ S GHY+  IK +
Sbjct: 461  DQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNNYNLHGVLVHTGDISTGHYYAMIKPT 520

Query: 1183 GKNGIWRKYNDESVTEAPESEVFNFSEGNTATP-----------------------YFLV 1219
              +  W +++DE V    + +VF+ + G    P                       Y LV
Sbjct: 521  TDDK-WYRFDDEKVWRVTKKQVFDENFGLNRLPEDTLRKMTRKEYQDYLIARHTSAYMLV 579

Query: 1220 YVKNGQESQI-EP 1231
            YVK+  E+ I EP
Sbjct: 580  YVKDLAENGILEP 592

 Score = 36.2 bits (82), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 78/169 (46%), Gaps = 28/169 (16%)

Query: 904  QQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIE 963
            Q DV E    ++ +LES  + T ++  G+  D+    F GK++  +  +N   +  +++E
Sbjct: 338  QHDVQELNRILMDRLESRMKGTSVE--GKLTDV----FVGKMKSYIKCVNIDYE-SSRVE 390

Query: 964  RFVSLLVNVGDHPKDVYDALDQYFKNDV-LQLEDG------------DVNRSVAIKELPA 1010
             F  + +NV        + L   F+N + ++L DG            D  + V  +  P 
Sbjct: 391  DFWDIQLNVKG-----LEGLANAFENYIEVELMDGENQYAAQDYGLQDAKKGVVFESFPE 445

Query: 1011 VLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKRE 1059
            VL +Q++R  YD       K  +   F ++I +  YMD E   +LKK++
Sbjct: 446  VLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKE---VLKKQK 491

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 17/31 (54%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R  + +
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLVYQ 289

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (70%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQ 735
           P GL N+GNTCY+NS LQ  + +  LR  +++Y+
Sbjct: 108 PIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYK 141

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTA-TP 1215
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ V+     ++   + G  + + 
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVSVVEREKIEALAGGGESDSA 486

Query: 1216 YFLVY 1220
              L+Y
Sbjct: 487  LILIY 491

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            YSL +V +H G  +YGHY  + K     G W + +DESVT   E+EV 
Sbjct: 687  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDESVTIVDEAEVL 731

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQ 735
           P G  N+GNTCY+NS LQ  F +  L+  I+ Y+
Sbjct: 108 PIGFQNMGNTCYMNSTLQALFRVDVLKDMILNYK 141

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTA-TP 1215
            Y L  +  H+G  S  GHY  +I+D      W K+ND+ V+E  + ++   + G  + + 
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEKDKIEQLAGGGESDSA 495

Query: 1216 YFLVYVKNG 1224
              L+Y   G
Sbjct: 496  LILIYKGMG 504

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           P GL N+GNTCYLN+ LQ  F    L+  I++Y
Sbjct: 108 PLGLQNMGNTCYLNATLQALFRADELKDLILQY 140

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ V+   + ++   + G  +   
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVSPIEKEKIEALAGGGESDSA 485

Query: 1217 FLVYVK 1222
             ++  K
Sbjct: 486  LILLYK 491

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           P G  N+GNTCYLN+ LQ  + ++ LR  I+ Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLRDMILNY 140

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ V+   + ++ + + G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1217 FLVYVK 1222
             ++  K
Sbjct: 490  LILMYK 495

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500 bp,
            499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 7/75 (9%)

Query: 1143 EQKLSSHFDDFKQEG------YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDES 1195
            +Q+   HF +  Q G      Y L  +  H+G  S  GHY  +I+D     IW K+ND+ 
Sbjct: 409  KQEFKKHFPENLQTGENPSSVYDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDK 468

Query: 1196 VTEAPESEVFNFSEG 1210
            V+   + ++ + + G
Sbjct: 469  VSIIEKEKIESLAGG 483

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           P G  N+GNTCYLN+ LQ  + I  LR +++ +
Sbjct: 106 PIGFKNMGNTCYLNATLQALYRIDDLRDAVLNF 138

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 683 NRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQ 735
           N ++E    D       + P G  N+GNTCY+N+ LQ  +    +RQ I++Y+
Sbjct: 91  NHFIEDLSPDQQLQKMDSTPIGFQNMGNTCYMNATLQALYRTDDIRQMILDYK 143

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y+L  +  H+G  S  GHY  +++D      W K+ND+ VT   + ++   + G  +   
Sbjct: 433  YNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVTVVEKEKIEALAGGGESDSA 492

Query: 1217 FLVYVK 1222
             ++  K
Sbjct: 493  LILMYK 498

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 1135 VYHRIAF-LEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYN 1192
            ++++I + L   +SS FD    + Y L  V IH G    +GHY    K+  K G W  Y+
Sbjct: 580  LFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSGPQHGHYVCICKNE-KFG-WLLYD 637

Query: 1193 DESVTEAPESEVFNFS--EGNTATPYFLVY 1220
            DE+V    E  V  F+   G+  T Y L Y
Sbjct: 638  DETVESVSEETVLKFTGHSGDQTTAYVLFY 667

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 686 LETGIIDVSCLPAGNWPT---GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           L T I D+  +P G+      G  N GNTCY NS+LQ  + I   R +++ Y
Sbjct: 118 LFTSITDL--MPYGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 167

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP 1215
            Y L  V +H G+ S GHY+  I+    +G W +++D+ V +A + +VF  + G    P
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQPDA-HGSWYRFDDDRVIKATDKQVFEENFGKAKLP 487

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 74/157 (47%), Gaps = 16/157 (10%)

Query: 904  QQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIE 963
            Q DV E    ++ +LE   + T ++        I +LF GK++  +  +N   +  +++E
Sbjct: 276  QHDVQELNRILMDRLEHRMKGTSVEGK------INELFVGKMKSCIKCINVDYE-SSRVE 328

Query: 964  RFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDGDVNR--------SVAIKELPAVLQIQ 1015
             F  + +NV D  K++ ++ +QY + +++  E+    +         V  +  P VL +Q
Sbjct: 329  DFWDIQLNVKDM-KNLQESFEQYIEVELMNGENQYAAQDHGLQDAQKVVFESFPPVLHLQ 387

Query: 1016 IQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDP 1052
            ++R  YD       K  +   F +SI +  Y+D+  P
Sbjct: 388  LKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAP 424

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 40/84 (47%), Gaps = 21/84 (25%)

Query: 688 TGIIDV---SCLPAGNWPT---GLNNIGNTCYLNSLLQYYFCISPLRQSIV--------- 732
           T I+DV   + +P G+      G  N GNTCY NS+LQ +F  S  R S++         
Sbjct: 106 TAILDVKESNLMPYGDGSNKIFGYENFGNTCYCNSILQCFFNHSVFRTSMLSFPSSNSDG 165

Query: 733 EYQKTLSEFHQSIGHLESKRRIGG 756
           E  +TL  F +      SKR I G
Sbjct: 166 ERARTLETFGR------SKRNING 183

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 3/76 (3%)

Query: 1146 LSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEV 1204
            +SS FD    + Y L +  IH G+   YGHY    K   +   W  ++DE+V    E  V
Sbjct: 547  VSSTFDSKLSKRYELASAVIHLGDGPQYGHYISLCK--TETFGWLLFDDETVEAVDEQTV 604

Query: 1205 FNFSEGNTATPYFLVY 1220
             +F+  N+ T Y L Y
Sbjct: 605  LSFTGENSDTAYVLFY 620

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 10/99 (10%)

Query: 1135 VYHRIAF-LEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYN 1192
            ++++I + L   +SS FD    + Y L  V IH G    +GHY    K+  K G W  Y+
Sbjct: 575  LFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSGPQHGHYVCICKNE-KFG-WLLYD 632

Query: 1193 DESVTEAPESEVFNFSE--GNTATPYFLVYVKNGQESQI 1229
            DE+V    E  V  F+   G+  T Y L Y    +ESQ+
Sbjct: 633  DETVESIREETVLQFTGHPGDQTTAYVLFY----KESQV 667

 Score = 36.2 bits (82), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 696 LPAGNWPT---GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           +P G+      G  N GNTCY NS+LQ  + I   R +I++Y
Sbjct: 124 MPYGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 78/163 (47%), Gaps = 20/163 (12%)

Query: 904  QQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIE 963
            Q DV E    ++ +LE+  + T      E +  + +LF GK++  +  +N   +  +++E
Sbjct: 281  QHDVQELNRILMDRLETRMKGT------EVEGALNELFVGKMKSYIRCINVDYE-SSRVE 333

Query: 964  RFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDG---------DVNRSVAIKELPAVLQI 1014
             F  + +NV +  K V ++ D Y + +++  E+          D  + V  +  P+VL +
Sbjct: 334  DFWDIQLNVKN-LKGVQESFDNYVEVEIMDGENQYAAQDYGLQDAKKGVVFESFPSVLHL 392

Query: 1015 QIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKK 1057
            Q++R  YD       K  +   F ++I +  Y+   DP +LKK
Sbjct: 393  QLKRFEYDFNYDQLVKINDRYEFPETIDLSPYL---DPDVLKK 432

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 26/96 (27%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIK-DSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP- 1215
            Y+L  V +H GE S GHY+  IK D G    W +++D+ V    + + F+ + G+   P 
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDVGDQ--WFRFDDDKVWRVTKEQAFDENFGHEPLPD 496

Query: 1216 ----------------------YFLVYVKNGQESQI 1229
                                  Y LVY++   E  +
Sbjct: 497  DKLRSLTREQYQNYLIARQTSAYMLVYIREDMEKNV 532

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSI 731
           GL N G TCYLNSLLQ YF     R+ +
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV 230

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
           YDL122W
          Length = 782

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 670 LTKIGQVRNSLLINRYLET-GIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719
           +  +  +RN+  +NR+L +   +D + L  G    GL N GNTC++NS+LQ
Sbjct: 52  MNNLSSIRNNSTLNRFLPSYNSMDDTILKRGGHIAGLVNDGNTCFMNSVLQ 102

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            YSL +V +H G  +YGHY  + +     G W + +DESV    E+EV 
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAFRR---YRGCWWRISDESVYIVEEAEVL 718

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP-- 1215
            Y L  V +H G+ S GHY+  IK S ++  W +++D+ V    +++VF  + G+   P  
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIEDQ-WYRFDDDKVWRVTKNQVFEENFGHVRLPDE 501

Query: 1216 ---------------------YFLVYVKNGQESQI 1229
                                 Y LVYV+   E +I
Sbjct: 502  KLRTFTREQYQNYLISRQTSAYMLVYVRKDMEDKI 536

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 74/160 (46%), Gaps = 25/160 (15%)

Query: 904  QQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIE 963
            Q DV E    ++ +LE+  + T  D DG+    + ++F GK+R  +  +N   +  +++E
Sbjct: 285  QHDVQELNRILMDRLENKMKGT--DVDGK----LNEVFVGKMRSYIKCVNVDYE-SSRVE 337

Query: 964  RFVSLLVNVGDHPKDVYDALDQYFKNDV-LQLEDG------------DVNRSVAIKELPA 1010
             F  + +NV +        L + FKN + +++ DG            D  + V  +  P 
Sbjct: 338  DFWDIQLNVKN-----LRGLQESFKNYIEVEMMDGENQYAAQGYGLQDAKKGVVFESFPP 392

Query: 1011 VLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTE 1050
            VL +Q++R  YD       K  +   F +SI +  Y+D E
Sbjct: 393  VLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPE 432

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + +
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLVYQ 236

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y+L +V +H G  +YGHY  Y K     G+W + +DESV    E+EV 
Sbjct: 689  YALRSVIVHYGTHNYGHYIAYRK---FRGVWWRISDESVYVVDEAEVL 733

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 24/111 (21%)

Query: 1142 LEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPE 1201
            L++ L S   D     Y+L  V +H G+ S GHY+  IK  G    W +++DE V    +
Sbjct: 433  LKKTLDSENKDKNPYVYNLHGVLVHSGDISTGHYYTLIK-PGVEDQWYRFDDERVWRVTK 491

Query: 1202 SEVFNFSEGNTATP-----------------------YFLVYVKNGQESQI 1229
             +VF  + G    P                       Y LVY++  QE  +
Sbjct: 492  KQVFQENFGCDRLPDEKVRTMTRGEYQNYIIQRHTSAYMLVYIRQEQEEDL 542

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 24/95 (25%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP-- 1215
            Y+L  V +H G+ S GHY+  IK  G    W +++DE V    + +VF  + G    P  
Sbjct: 448  YNLHGVLVHSGDISTGHYYTLIK-PGVEDQWYRFDDERVWRVTKKQVFQENFGCDRLPDE 506

Query: 1216 ---------------------YFLVYVKNGQESQI 1229
                                 Y LVY++  QE  +
Sbjct: 507  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQDQEQDL 541

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217
            Y L  +  HRG  + GHY  Y K +  +G+W ++ND  V + P  ++           Y 
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTKTA--DGVWYQFNDSVVMKVPLEQMLK------EQAYL 474

Query: 1218 LVYV 1221
            L+Y 
Sbjct: 475  LIYT 478

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 702 PTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           P G  N+GNTCYLN+ LQ  + +  +R  I+ Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1158 YSLFAVFIHRGEAS-YGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ VT   + ++ + + G  +   
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVTAVEKEKIESLAGGGESDSA 490

Query: 1217 FLVYVK 1222
             ++  K
Sbjct: 491  LILMYK 496

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 26/102 (25%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF------------ 1205
            Y+L  V +H G+ S GHY+  IK  G    W +++D+ V    + +VF            
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIK-PGLEDAWYRFDDDKVWRVTKKQVFEQNFGFDKLSEY 485

Query: 1206 -----------NFSEGNTATPYFLVYVKNGQESQIEPLHRVT 1236
                       N+      + Y LVY++   ES I  L  VT
Sbjct: 486  DLRSLTKEQYQNYLIARQTSAYMLVYIREDMESTI--LQEVT 525

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            GL N G TCYLNSLLQ Y+     R+ + +
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLVYQ 220

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 70/160 (43%), Gaps = 25/160 (15%)

Query: 904  QQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIE 963
            Q DV E    ++ +LE+  + T      E +  +  LF GK++  +  +N   +  +++E
Sbjct: 269  QHDVQELNRILMDRLENKMKGT------EVEGKLNGLFVGKMKSYIKCVNVDYE-SSRVE 321

Query: 964  RFVSLLVNVGDHPKDVYDALDQYFKNDV-LQLEDG------------DVNRSVAIKELPA 1010
             F  + +NV          L Q F+N + +++ DG            D  + V  +  P 
Sbjct: 322  DFWDIQLNVKG-----LKGLQQSFENYIEVEMMDGENQYAAQGHGLQDAKKGVLFESFPP 376

Query: 1011 VLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTE 1050
            VL +Q++R  YD       K  +   F +SI +  Y+D E
Sbjct: 377  VLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPE 416

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 24/95 (25%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP-- 1215
            Y+L  V +H G+ S GHY+  IK  G    W +++DE V    + +VF  + G    P  
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIK-PGVEDQWYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1216 ---------------------YFLVYVKNGQESQI 1229
                                 Y LVY++  QE  +
Sbjct: 508  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL 542

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 24/95 (25%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP-- 1215
            Y+L  V +H G+ S GHY+  IK  G    W +++DE V    + +VF  + G    P  
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIK-PGVEDQWYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1216 ---------------------YFLVYVKNGQESQI 1229
                                 Y LVY++  QE  +
Sbjct: 508  KVRTMTREDYQNYIIQRHTSAYMLVYIRQEQEEDL 542

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 24/95 (25%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF------------ 1205
            Y+L  V +H G+ S GHY+  IK  G +  W +++D+ V +  + +VF            
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIK-PGLDDKWYRFDDDKVWQVTKKQVFEQNFGFDRLPEY 494

Query: 1206 -----------NFSEGNTATPYFLVYVKNGQESQI 1229
                       N+      + Y LVY+K   E  I
Sbjct: 495  ELRSLSKEQYQNYLIARQTSAYMLVYIKEDMEPTI 529

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 73/160 (45%), Gaps = 25/160 (15%)

Query: 904  QQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIE 963
            Q DV E    ++ +LE+  + T      E +  + ++F GK++  +  +N   +  +++E
Sbjct: 278  QHDVQELNRILMDRLENKMKAT------EVEGKLNEIFVGKMKSYIKCVNVEYE-SSRVE 330

Query: 964  RFVSLLVNVGDHPKDVYDALDQYFKNDV-LQLEDG------------DVNRSVAIKELPA 1010
             F  + +NV        + L+Q F+N + +++ DG            D  + V  +  P 
Sbjct: 331  DFWDIQLNVKG-----LNGLNQAFENYIEVEMMDGENQYAAQRYGLQDAKKGVVFESFPP 385

Query: 1011 VLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTE 1050
            VL +Q++R  YD       K  +   F +SI +  Y+D E
Sbjct: 386  VLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPE 425

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSI 731
            GL N G TCYLNSLLQ Y+     R+ +
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 227

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 41/96 (42%), Gaps = 26/96 (27%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIK-DSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP- 1215
            Y L  V +H G+ S GHY+  IK D G    W +++DE V +    +VF+ + G    P 
Sbjct: 448  YKLHGVLVHTGDISTGHYYTMIKPDLGDQ--WYRFDDERVWKVDRKQVFDENFGLDKLPD 505

Query: 1216 ----------------------YFLVYVKNGQESQI 1229
                                  Y LVYVK+  E +I
Sbjct: 506  SELRGMTKEEYQSYLITRHTSAYMLVYVKDEVEEEI 541

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 71/160 (44%), Gaps = 25/160 (15%)

Query: 904  QQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIE 963
            Q DV E    ++ +LE+  + T ++        + +LF GK++  +   N   +  +++E
Sbjct: 288  QHDVQELNRILMDRLETRMKGTKVEGK------LSELFVGKMKSYIKCKNVDYE-SSRVE 340

Query: 964  RFVSLLVNVGDHPKDVYDALDQYFKNDV-LQLEDG------------DVNRSVAIKELPA 1010
             F  + +NV D        L Q F+N + ++L DG            D  + V  +  P 
Sbjct: 341  EFWDIQLNVKD-----LKNLQQSFENYIEVELMDGENQYAAPDFGLQDAYKGVVFESFPK 395

Query: 1011 VLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTE 1050
            VL +Q++R  YD       K  +   F DSI +  Y+D +
Sbjct: 396  VLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKD 435

 Score = 35.8 bits (81), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 239

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y L AV IH G  +YGHY  Y K   +   W + +DESV E  E EV 
Sbjct: 422  YDLKAVIIHYGTHNYGHYISYRKFMNQ---WWRISDESVIEVDEMEVL 466

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 20/26 (76%)

Query: 697 PAGNWPTGLNNIGNTCYLNSLLQYYF 722
           P GN+  GL N+GN+CYLNS+LQ  F
Sbjct: 313 PNGNFGCGLINLGNSCYLNSILQALF 338

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 7/79 (8%)

Query: 1146 LSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPE--- 1201
            +SS FDD   + Y L ++ +H GE+   GHY    K   K+  W  Y+DE+V    +   
Sbjct: 575  ISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCKH--KSYGWLIYDDETVQAVSDELV 632

Query: 1202 SEVFNFSEGNTATPYFLVY 1220
            S + N +E  +AT Y L Y
Sbjct: 633  SRILN-NEQRSATAYLLFY 650

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 17/35 (48%)

Query: 698 AGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIV 732
            G    G  N G TCY NS+LQ  F I   R  I+
Sbjct: 101 VGERVFGFQNFGYTCYCNSILQALFNIGSFRDGII 135

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 1135 VYHRIAF-LEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYN 1192
            ++++I + L   +SS FD    + Y L  V IH G    +GHY    K+  K G W  Y+
Sbjct: 569  LFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSGPQHGHYVCICKNE-KFG-WLLYD 626

Query: 1193 DESVTEAPESEVFNFSE--GNTATPYFLVY 1220
            DE+V    E  V  F+   G+  T Y L Y
Sbjct: 627  DETVESIREETVLKFTGHPGDQTTAYVLFY 656

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 686 LETGIIDVSCLPAGNWPT---GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           L T + D+  +P G+      G  N GNTCY NS+LQ  + IS  R +++ Y
Sbjct: 108 LFTAMTDL--MPYGDGSNKVFGYENFGNTCYCNSVLQCLYNISEFRCNVLRY 157

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP-- 1215
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE V +  + +VF  + G    P  
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQDQ-WYRFDDEKVWKVTKKQVFEENFGMNKLPEE 502

Query: 1216 ---------------------YFLVYVKNGQESQI 1229
                                 Y LVY++  +E ++
Sbjct: 503  EIRGMTREQYQNYLITRHTSAYMLVYIREDKEPEV 537

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 82/183 (44%), Gaps = 32/183 (17%)

Query: 886  RVAKISSDQLE-------NALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIK 938
            +V+ I  D LE       ++ E   Q DV E    ++ +LE+  + T ++        + 
Sbjct: 261  QVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTPVEGK------LN 314

Query: 939  QLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDV-LQLEDG 997
            +LF GK++  +  +N   +  +++E F  L +NV +        L++ FKN + ++L +G
Sbjct: 315  ELFVGKMKSYIKCINVDYE-SSRVEDFWDLQLNVKN-----LKGLEESFKNYIEIELMNG 368

Query: 998  ------------DVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDR 1045
                        D  + V  +  P +L +Q++R  YD       K  +   F +SI +  
Sbjct: 369  ENQYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSP 428

Query: 1046 YMD 1048
            YMD
Sbjct: 429  YMD 431

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + +
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYQ 237

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G W  Y+DE + +  E +V   S       Y
Sbjct: 645  YQLISVVVHEGRSLSSGHYIAHCKQP--DGSWSTYDDEYINKITERDVLRESNA-----Y 697

Query: 1217 FLVYVK 1222
            +LVY +
Sbjct: 698  YLVYTR 703

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217
            YSL ++ +H G   YGHY  Y +   +   W + +DESV +  E EVF      +A+  F
Sbjct: 428  YSLKSIVVHYGSHDYGHYISYRRFEDQ---WWRISDESVLKVDEDEVF------SASGIF 478

Query: 1218 LVY 1220
            +V+
Sbjct: 479  IVF 481

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            YSL +V +H G  +YGHY  + K     G+W + +DE+V    E+EV 
Sbjct: 722  YSLRSVIVHYGTHNYGHYIAFRK---YRGVWWRISDETVYIVDEAEVL 766

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 691 IDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719
           +D + L  G +  GL N GNTC++NS+LQ
Sbjct: 116 MDSNVLNHGGYIAGLLNDGNTCFMNSVLQ 144

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 39.7 bits (91), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY-QKTLSEFH 742
           G  N GNTCY NS+LQ  F ++  R SI+++ ++   E H
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQFPERAPDELH 154

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 5/68 (7%)

Query: 1141 FLEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEA 1199
            FLE  ++S FD    + Y L  V +H G    +GHY    K    N  W  ++DE+V   
Sbjct: 580  FLE--VASKFDPSVSKKYELTGVVLHMGGGPQHGHYVSVCKTD--NFGWLFFDDETVETL 635

Query: 1200 PESEVFNF 1207
             E +V NF
Sbjct: 636  DEPQVLNF 643

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIV 732
           TGL N+GNTCY+NS+LQ  F  +  R   V
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATTKFRDLFV 637

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 39.7 bits (91), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G+W  Y+DE + +  + EV   +       Y
Sbjct: 673  YQLISVVVHEGRSLSSGHYVAHCKQP--DGLWATYDDEYINKISDKEVLRETNA-----Y 725

Query: 1217 FLVYVK 1222
            +LVY +
Sbjct: 726  YLVYSR 731

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 6/90 (6%)

Query: 1135 VYHRIAF-LEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYN 1192
            +++++ + L+  ++S FD    + Y L  V IH G +  +GHY    K+  K G W  ++
Sbjct: 564  LFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMGGSPQHGHYVSLCKND-KFG-WLLFD 621

Query: 1193 DESVTEAPESEVFNFS--EGNTATPYFLVY 1220
            DE+V    E  V  F+    N AT Y L Y
Sbjct: 622  DETVESVTEKTVLEFTGDSSNQATAYVLFY 651

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 696 LPAG---NWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           LP G   N   G  N GNTCY NS+LQ  + ++ LR +++EY
Sbjct: 127 LPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 8/83 (9%)

Query: 1130 EELASVYHRIAFLEQKLSSHFDDFKQEG-------YSLFAVFIHRGEASYGHYWIYIKDS 1182
            ++L  +  R  F E   +S + + K++G       Y+L  V +H G+ S GHY+  IK  
Sbjct: 403  DQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCIYNLHGVLVHTGDISTGHYYAMIKPD 462

Query: 1183 GKNGIWRKYNDESVTEAPESEVF 1205
             ++  W +++DE V +  + +VF
Sbjct: 463  LEDQ-WYRFDDEKVWKVTKKQVF 484

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSI 731
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 229

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 73/153 (47%), Gaps = 24/153 (15%)

Query: 886  RVAKISSDQLE-------NALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIK 938
            +V++I  D LE       ++ E   Q DV E    ++ +LE+      L T  E +  + 
Sbjct: 255  QVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENR----MLGTPVEGK--LS 308

Query: 939  QLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDG- 997
            +LF GK++  +  +N   +  +++E F  L +NV +  K + D+ + Y + +++  E+  
Sbjct: 309  ELFVGKMKSYIKCVNVEYE-SSRVEDFWDLQLNVKN-LKCLKDSFENYIEIELMNGENQY 366

Query: 998  --------DVNRSVAIKELPAVLQIQIQRVYYD 1022
                    D  + V  +  P +L +Q++R  YD
Sbjct: 367  AAQDFGLQDAEKGVIFESFPPILHLQLKRFEYD 399

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y L  +  H+G  + GHY  + K SG  G W K+ND  V+   + EV 
Sbjct: 411  YELIGIVSHKGTVNEGHYIAFCKISG--GQWFKFNDSMVSSISQEEVL 456

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 39.3 bits (90), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 57/126 (45%), Gaps = 23/126 (18%)

Query: 620 SADKLTYQEALNLL--QVNENASDDVILEVF-QRKWHQEPVSSPDQFLISSSALTKIGQV 676
           S  +  +Q  LN +  Q+ E A +D  L+V   ++  QEP  S    L  + ++  I Q 
Sbjct: 623 SQHRAPFQSNLNFVTGQILE-ADEDTALQVAPTKRIQQEPFRSATNGLHETYSIPTIEQN 681

Query: 677 RNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIV--EY 734
            N      Y+   I            TGL N+GNTCY+NS++Q  F     R   +  +Y
Sbjct: 682 PNI-----YVSLSI------------TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKY 724

Query: 735 QKTLSE 740
           ++ L E
Sbjct: 725 KEFLKE 730

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 38.9 bits (89), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y L  +  H+G  + GHY  + K SG  G W K+ND  V+   + EV 
Sbjct: 413  YELIGIVSHKGTVNEGHYIAFCKISG--GQWFKFNDSMVSSISQEEVL 458

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFN 1206
            YSL +V +H G  +YGHY  + K     G W + +DE+V    E+EV +
Sbjct: 708  YSLRSVIVHYGTHNYGHYIAFRK---HRGFWWRISDETVYIVDEAEVLS 753

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y L  +  H+G  + GHY  + K SG  G W K+ND  V+   + EV 
Sbjct: 411  YELIGIVSHKGTVNEGHYIAFCKISG--GQWFKFNDSMVSSISQEEVL 456

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 39.3 bits (90), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQ 735
           TGL N+GNTCY+NS+LQ  F  +  R   + ++
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRNIFLSHK 785

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFN 1206
            YSL +V +H G  +YGHY  + K     G W + +DE+V    E+EV +
Sbjct: 624  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVGIVTEAEVLS 669

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 666 SSSALTK--IGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719
           +SS +T+  +  V  +  +  Y     +D   L  G +  GL N GNTC++NS+LQ
Sbjct: 27  TSSKITRFVLKMVNQAKRMTSYYSAPSMDDVILKRGGFVAGLVNDGNTCFMNSVLQ 82

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 38.9 bits (89), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G W  Y+DE + +  E ++    E N    Y
Sbjct: 639  YQLISVVVHEGRSLSSGHYIAHCKQP--DGSWATYDDEYINKISEKQLLK--EPNA---Y 691

Query: 1217 FLVYVK 1222
            FLVY +
Sbjct: 692  FLVYTR 697

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 38.9 bits (89), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 1156 EGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP 1215
            + Y L  V +H G+ S GHY+  IK + ++  W +++DE V +  + +VF+ + G    P
Sbjct: 439  KNYKLHGVLVHTGDISTGHYYAMIKPTLEDQ-WYRFDDEKVWKVDKKQVFDENFGLDRLP 497

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 86/188 (45%), Gaps = 27/188 (14%)

Query: 886  RVAKISSDQLENALEMG-------RQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIK 938
            +V+K   D LE     G        Q DV E    ++ +LE+  + T  + +G+    + 
Sbjct: 258  QVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRMKGT--NVEGK----LN 311

Query: 939  QLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDG- 997
            ++F GK++  +   N   +  +++E F  + +NV +  K + ++ + Y + +++  E+  
Sbjct: 312  EIFVGKMKSYIRCKNVDYE-SSRVEDFWDIQLNVKNF-KSLQESFENYIEVELMNGENQY 369

Query: 998  --------DVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDT 1049
                    D  + V  +  PAVL +Q++R  YD       K  +   F D I +  YMD 
Sbjct: 370  AAPDFGLQDAYKGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDK 429

Query: 1050 EDPVMLKK 1057
            E   +LKK
Sbjct: 430  E---LLKK 434

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSI 731
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 232

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 38.9 bits (89), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+GNTCY+NS+LQ  F  S  R
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFR 613

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%), Gaps = 2/31 (6%)

Query: 698 AGNWPTGLNNIGNTCYLNSLLQYYFCISPLR 728
            GN   GLNN+GNTCY+NS LQ    I P+R
Sbjct: 395 VGN--VGLNNLGNTCYMNSALQCLAHIPPIR 423

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 74/162 (45%), Gaps = 19/162 (11%)

Query: 899  LEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLN-DPTK 957
            +E   Q DV E    ++ +LE+  + T ++        + ++F GK++  +  +N D   
Sbjct: 277  VEAFTQHDVQELNRILMDRLETRMKGTTVENK------LNEIFVGKMKSFIKCINVDYES 330

Query: 958  VRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDG---------DVNRSVAIKEL 1008
             RT  E F  + +NV +  K + D+ + Y + +++  E+          D  + V  +  
Sbjct: 331  ART--EDFWDIQMNVKN-LKGLKDSFENYIEVELMDGENQYAAQDYGLQDAKKGVVFESF 387

Query: 1009 PAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTE 1050
            PAVL +Q++R  YD       K  +   F + I +  YMD +
Sbjct: 388  PAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKD 429

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP 1215
            Y L  V +H G+ S GHY+  IK  G    W +++DE V +  + + F+ + G    P
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIK-PGLEDQWYRFDDERVWKVSKKQAFDENFGFDRLP 496

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + +
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQ 233

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 670 LTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPT---GLNNIGNTCYLNSLLQYYFCISP 726
           L + G+ R+ +    +      D   LP G+      GL N GNTCY NS+LQ  + +  
Sbjct: 63  LQQTGEGRDGVQELLFARPAGKDRRLLPFGDGTPKVFGLENYGNTCYCNSVLQCLYNLKE 122

Query: 727 LRQSIVEY 734
           LR ++++Y
Sbjct: 123 LRVNVLKY 130

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G W  Y+DE + +  E  V           Y
Sbjct: 638  YQLISVVVHEGRSLSSGHYIAHCKQ--PDGTWATYDDEYINKITERNVL-----KEVNAY 690

Query: 1217 FLVYVK 1222
            +LVY +
Sbjct: 691  YLVYTR 696

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            YSL +V +H G  +YGHY  + K     G W + +DE+V    E+EV 
Sbjct: 682  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 726

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 677 RNSLLINRYLETGI---IDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719
           RN+  ++R+L       +D   L  G +  GL N GNTC++NS+LQ
Sbjct: 72  RNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQ 117

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            YSL +V +H G  +YGHY  + K     G W + +DE+V    E+EV 
Sbjct: 683  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 727

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 691 IDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719
           +D   L  G +  GL N GNTC++NS+LQ
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQ 117

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+GNTCY+NS+LQ  F     R
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFR 581

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            YSL +V +H G  +YGHY  + K     G W + +DE+V    E+EV 
Sbjct: 685  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 729

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 677 RNSLLINRYLETGI---IDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719
           RN+  ++R+L       +D   L  G +  GL N GNTC++NS+LQ
Sbjct: 72  RNNNSLSRWLPRSKFTHLDEEVLKRGGFIAGLVNDGNTCFMNSVLQ 117

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            YSL +V +H G  +YGHY  + K     G W + +DE+V    E+EV 
Sbjct: 681  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 725

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 677 RNSLLINRYLETGI---IDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719
           RN+  ++R+L       +D   L  G +  GL N GNTC++NS+LQ
Sbjct: 72  RNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQ 117

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 698 AGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           + N   G  N GNTCY NS+LQ  + I  LR ++++Y
Sbjct: 107 SSNKVFGYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y+L +V +H G  +YGHY  + K     G+W + +DE+V    E+EV 
Sbjct: 678  YALRSVIVHYGSHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVL 722

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 692 DVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQ----SIVEYQKTLSEFHQSIGH 747
           + + L  G +  GL N GNTC++NS++Q       L Q     ++E  K L   +++   
Sbjct: 87  EATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSA 146

Query: 748 LESKRRIG 755
           +E +  +G
Sbjct: 147 VEEEGNLG 154

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L  V +H G + S GHY ++ K    +G W  Y+DE + +  E +V    E N    Y
Sbjct: 549  YQLTTVVVHEGRSLSSGHYIVHCKQP--DGTWATYDDEYINKITERDVLK--EPNA---Y 601

Query: 1217 FLVYVK 1222
            +L+Y +
Sbjct: 602  YLLYTR 607

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 20/26 (76%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+GNTCY++S+LQ  F  + LR
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLR 650

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217
            Y+L +V +H G  +YGHY  + K     G+W + +DE+V    E+EV      +T   + 
Sbjct: 679  YALRSVIVHYGTHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVL-----STPGIFM 730

Query: 1218 LVYVKNGQES 1227
            L Y  +  ES
Sbjct: 731  LFYEHDYNES 740

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 11/110 (10%)

Query: 1135 VYHRIAF-LEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYN 1192
            ++++I + +  K+SS FD+   + Y L  + +H G    +GHY    K S     W  ++
Sbjct: 550  LFNKIKYPITLKVSSTFDESVSKDYELGGLVVHIGIGPQHGHYISVCKTSDYG--WLLFD 607

Query: 1193 DESVTEAPESEVFNF-SEGNTA-TPYFLVY-----VKNGQESQIEPLHRV 1235
            DE+V    E  V +F  + N+A T Y L Y      +N + SQ E L  V
Sbjct: 608  DETVECISEDTVLSFVGDSNSAGTAYVLFYKEINSSRNVERSQNEHLENV 657

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIV 732
           GL N GNTCY NS+LQ  + ++  R++I+
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENIL 160

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            YSL +V +H G  +YGHY  + K     G W + +DE+V    E+EV 
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAFRK---YRGYWWRISDETVYIVDETEVL 621

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 25/53 (47%)

Query: 667 SSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719
           S   TK     N+    +     I D   +  G +  GL N GNTC++NS+LQ
Sbjct: 22  SYPFTKRMYNNNNFFSRKMYNNAINDKKFIKRGGYIAGLVNDGNTCFMNSVLQ 74

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATP 1215
            Y+L  V +H G+ S GHY+  IK +  +  W +++D+ V +  +++ F+ + G+   P
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNVTDQ-WFRFDDDKVWKVTKTQAFDENFGHDNLP 495

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSI 731
           G  N G TCYLNSLLQ YF     R+ +
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV 230

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 34/83 (40%), Gaps = 8/83 (9%)

Query: 1141 FLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAP 1200
            FL  +     DD     + L  +  HRG  + GHY  + K +   G W K+ND  V+   
Sbjct: 388  FLNMRNYCDGDDVPDIIFELIGIIAHRGTVNEGHYIAFTKVT--TGHWFKFNDSMVSSIT 445

Query: 1201 ESEVFNFSEGNTATPYFLVYVKN 1223
            E E+           Y L YV N
Sbjct: 446  EEELL------QEQAYLLFYVVN 462

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            YSL +V +H G  +YGHY  + K     G W + +DE+V    E+EV 
Sbjct: 644  YSLRSVIVHYGTHNYGHYIAFRK---FRGCWWRISDETVYIVDEAEVL 688

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 675 QVRNSLLINRYL-ETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719
           + +N+ +  R++   G ID   L  G +  GL N GNTC++NS+LQ
Sbjct: 62  KFKNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQ 107

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 672 KIGQVRNSLLINRYLETGIIDVSCLP---AGNWPTGLNNIGNTCYLNSLLQYYFCISPLR 728
           K  Q R SL++ R  +  I  +   P        TGL N+GNTCY+NS+LQ  F     R
Sbjct: 644 KYHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFR 703

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G W  Y+DE + +  E +V    E N    Y
Sbjct: 669  YQLLSVVVHEGRSLSSGHYIAHCKQP--DGTWATYDDEYINKISERDV--LKEPNA---Y 721

Query: 1217 FLVYVK 1222
            +L+Y +
Sbjct: 722  YLLYTR 727

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGH-LESKR 752
           TGL N+GNTCY+NS++Q  F     R   +   K  S   QS G+ L S R
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFIS-SKYKSYLQQSRGNRLHSPR 651

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G W  Y+DE + +  E EV    E N    Y
Sbjct: 662  YELLSVVVHEGRSLSSGHYIAHCKQP--DGSWATYDDEYINKITEREV--LKERNA---Y 714

Query: 1217 FLVYVK 1222
            +++Y +
Sbjct: 715  YVLYTR 720

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIV--EYQKTLSEFHQSIGHLESK 751
           TGL N+GNTCY+NS++Q  F     R   +  +Y+  L     +  H   K
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIRSNGSHYSPK 659

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
            Anc_8.202 YER151C
          Length = 854

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 64/136 (47%), Gaps = 14/136 (10%)

Query: 1092 LLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFD 1151
            L++ KRF     + N D +  N   +  +I+  + KI +++ S  H +   E+ LS H  
Sbjct: 727  LVQLKRF---SFVNNEDKD--NNMMNYNSINGRIEKIRKKI-SYGHELVIPEESLSPHSW 780

Query: 1152 DFKQEGYSLFAVFIHRGEAS-YGHYW--IYIKDSGKNGIWRKYNDESVTEAPESEVFNFS 1208
                  Y L  V  H G +S  GHY   ++ K + K   W + +D ++TE  + +V    
Sbjct: 781  SQTNRKYQLTGVIYHHGLSSDGGHYTADVFNKTADK---WYRIDDINITELKKDDVLKGG 837

Query: 1209 E--GNTATPYFLVYVK 1222
            E   +T T Y L+Y K
Sbjct: 838  EDGTDTRTAYILMYQK 853

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFN 1206
            YSL +V +H G  +YGHY  + K     G+W + +DE+     E+EV +
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAFRK---FRGVWWRISDETAYIVDEAEVLS 719

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+GNTCY+NS+LQ  F     R
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFR 633

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 696 LPAGNWPT---GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           LP G+  T   G  N GNTCY NS+LQ  + ++  R  I++Y
Sbjct: 105 LPFGSGSTKVFGYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 26/37 (70%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSE 740
           G  N GNTCY NS+LQ  + +S +R++I+++ +  +E
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQFPEKPNE 178

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%)

Query: 696 LPAGN-WPTGLNNIGNTCYLNSLLQYYF 722
           LPA   +  GLNN+GN+CY+NS+LQ  F
Sbjct: 305 LPASKEYGCGLNNLGNSCYMNSVLQVLF 332

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G W  Y+DE + +  E +V   +       Y
Sbjct: 644  YQLLSVVVHEGRSLSSGHYIAHCKQP--DGSWATYDDEYINKISERDVLKETNA-----Y 696

Query: 1217 FLVYVK 1222
            +L+Y +
Sbjct: 697  YLLYTR 702

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFS 1208
            Y L +V +H G  +YGHY  + K     G W + +DE+V    E+EV + S
Sbjct: 658  YVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVLSTS 705

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 689 GIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719
           G +D   L  G +  GL N GNTC++NS++Q
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQ 108

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 703  TGLNNIGNTCYLNSLLQYYFCISPLRQ 729
            TGL N+ NTCY+NS+LQ  F  S  R 
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRN 1131

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217
            Y L +V +H G  +YGHY  + K     G W + +DE+V    E+EV      +T + + 
Sbjct: 672  YELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSVFM 723

Query: 1218 LVY 1220
            L Y
Sbjct: 724  LFY 726

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 63/150 (42%), Gaps = 30/150 (20%)

Query: 691 IDVSCLPAGNWPTGLNNIGNTCYLNSLLQ----YYFCISPLRQSIVEY--QKTLSEF--- 741
           I  + +  G +  GL N GNTC++NS+LQ     +  +  L + I++   QK L E    
Sbjct: 23  IQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDEEIIKQFKQKQLQELEEL 82

Query: 742 -------HQSIGHLE----------SKRRIGGREVSEAEVERSIQFVYQLRDL---FTDM 781
                  H    H +           KR+    + ++ ++   + F   L+DL     D 
Sbjct: 83  HKKSDSAHNHHNHQQDDKKSKNKSYGKRKKKLTKTNDDDMSTDVSFSISLKDLLDKLNDK 142

Query: 782 VHTENRYVTPTKELAYLAFAPS-NIEVEFE 810
            + E +Y      L  ++ AP+ NI + +E
Sbjct: 143 YYRERKYYRTNNLLKTMSKAPNKNIILGYE 172

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G W  Y+DE + +  E E+    E N    Y
Sbjct: 755  YQLLSVVVHEGRSLSSGHYIAHCKQP--DGSWATYDDEYINKISEREM--LKEPN---AY 807

Query: 1217 FLVYVK 1222
            +L+Y +
Sbjct: 808  YLLYTR 813

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIV-----EYQ 735
           TGL N+GNTCY+N +LQ  F  + L+   +     EYQ
Sbjct: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQ 685

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 696 LPAGNWPT---GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           LP G+      G  N GNTCY NS+LQ  + +  LR  ++EY
Sbjct: 133 LPYGDGSNKVFGYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 15/54 (27%)

Query: 690 IIDVSCLPAGNWPT---------------GLNNIGNTCYLNSLLQYYFCISPLR 728
           II+   L  G WP+               GL+N+GNTCY+NS LQ    I  LR
Sbjct: 261 IIETRNLNDGKWPSYFFMYNNPMTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLR 314

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQ 729
           +GL N+GNTCY+NS+LQ  F  +  R 
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRN 472

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 21/33 (63%)

Query: 696 LPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLR 728
           L  G+  TGL N+GNTCY+NS LQ    I  LR
Sbjct: 357 LEPGSGTTGLVNLGNTCYMNSALQCLVHIPQLR 389

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 12/94 (12%)

Query: 1149 HFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEA-PESEVFNF 1207
            H DD +   Y L+AV  H G    GHY  Y+K+   +  W  ++D  VTE  PE+ +   
Sbjct: 1045 HKDDPRGSIYDLYAVDNHYGGLGGGHYTAYVKNFA-DSKWYYFDDSRVTETVPENSI--- 1100

Query: 1208 SEGNTATPYFLVYV---KNGQESQIEPLHRVTTK 1238
                + + Y L Y+   K+G E     L  +  K
Sbjct: 1101 ----SGSAYLLFYIRRAKDGNELGSHELQEIIRK 1130

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 1135 VYHRIAF-LEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYN 1192
            ++++I + L   +SS F+    + Y L  V IH G    +GHY + I  + K G W  Y+
Sbjct: 577  LFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSGPQHGHY-VCICRNEKFG-WLLYD 634

Query: 1193 DESVTEAPESEVFNFSE--GNTATPYFLVY 1220
            DE+V    E  V  F+   G+  T Y L Y
Sbjct: 635  DETVESIKEETVLQFTGHPGDQTTAYVLFY 664

 Score = 35.8 bits (81), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 686 LETGIIDVSCLPAGNWPT---GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           L T I D+  +P G+      G  N GNTCY NS+LQ  + I   R +++ Y
Sbjct: 116 LFTTITDL--MPYGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 165

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLR 728
           GLNN+GNTCY+NS LQ    I  LR
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLR 367

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           G  N GNTCY NS+LQ  +  S LR +++ Y
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILY 158

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G W  Y+DE + +  E +V    E N    Y
Sbjct: 657  YQLLSVVVHEGRSLSSGHYIAHCKQP--DGNWATYDDEYINKISERDV--LKEPNA---Y 709

Query: 1217 FLVYVK 1222
            +L+Y +
Sbjct: 710  YLLYTR 715

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa] {ON}
            Anc_1.137 YJL197W
          Length = 1178

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 11/73 (15%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEA-PESEVFNFSEGNTATPY 1216
            Y L AV  H G    GHY  Y+K + K   W  ++D  VTE  PES +         + Y
Sbjct: 959  YDLIAVDNHFGGLGGGHYTAYVKTNDK---WFYFDDSRVTETKPESSI-------AGSAY 1008

Query: 1217 FLVYVKNGQESQI 1229
             L Y++  +  +I
Sbjct: 1009 LLFYLRRTESGKI 1021

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+GNTCY+NS LQ    I  LR
Sbjct: 302 TGLTNLGNTCYMNSALQCLVHIPELR 327

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217
            Y L  +  H G  + GHY  + K   +NG W K+ND  VT+  E +V           Y 
Sbjct: 401  YELIGIISHTGSVNEGHYVAFCKI--ENGEWFKFNDSMVTKILEKDVL------KEQAYL 452

Query: 1218 LVYV 1221
            L Y+
Sbjct: 453  LFYI 456

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFN 1206
            Y L  V  H+G  + GHY    K +G+   W K+ND  V+   + E  N
Sbjct: 403  YELIGVVAHKGTVNEGHYVATTKVAGRQ--WFKFNDSMVSSVTQEEALN 449

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            YSL +V +H G  +YGHY  + +     G W + +DE+V    E+EV 
Sbjct: 654  YSLRSVVVHYGTHNYGHYIAFRR---YRGYWWRISDETVYIVDETEVL 698

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           G  N GNTCY NS+LQ  + ++ LR +I+++
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNILQF 547

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 1158 YSLFAVFIHRGEASY-GHYWIYIKDSGKNGIWRKYNDESV 1196
            Y L+ +  H+G ++  GHY  YI+   ++G W  YNDE +
Sbjct: 707  YKLYGIVCHKGNSTQSGHYVAYIRQ--RDGQWTLYNDEKI 744

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 697 PAGNWPTGLNNIGNTCYLNSLLQYYF 722
           P+     GL N+GN+CYLNS+LQ  F
Sbjct: 314 PSKEVGCGLINMGNSCYLNSVLQCLF 339

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G W  Y+DE + +  E ++           Y
Sbjct: 395  YQLISVVVHEGRSLSSGHYIAHCKQP--DGSWSTYDDEYINKISEKQML-----KEPGAY 447

Query: 1217 FLVYVK 1222
            +LVY +
Sbjct: 448  YLVYTR 453

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 696 LPAGNWPT---GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           LP G+      G  N GNTCY NS+LQ  + +  LR +++E+
Sbjct: 133 LPYGDGSNKVFGYENFGNTCYCNSVLQVIYNLPELRVNLLEF 174

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 36.2 bits (82), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 1135 VYHRIAF-LEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYN 1192
            ++ ++++ L+ K+SS F+    + Y L  + +H G    +GHY    K+  K G W  ++
Sbjct: 589  LFDKVSYPLDLKVSSTFNPSISKNYELSGIVVHMGGGPQHGHYISLCKNE-KFG-WLLFD 646

Query: 1193 DESVTEAPESEVFNFS--EGNTATPYFLVYVKNGQESQIE 1230
            DE+V    E  V  ++  +    T Y L Y    QESQ E
Sbjct: 647  DETVEAISEQAVLQYTGDKDTMTTAYVLFY----QESQKE 682

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           G  N GNTCY NS+LQ  + +   R  ++ Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 36.2 bits (82), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 686 LETGIIDVSCLPAG---NWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           L T   D+  LP G   N   G  N GNTCY NS+LQ  + ++  R ++++Y
Sbjct: 128 LSTHTTDL--LPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFN 1206
            Y+L  V +H G+ S GHY+  I+  G +  W +++D+ V    + + F+
Sbjct: 441  YNLHGVLVHAGDISTGHYYTMIR-PGVSDEWYRFDDDKVWRVTKKQAFD 488

 Score = 35.8 bits (81), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVE 733
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYE 233

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 10/76 (13%)

Query: 662 QFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPT---GLNNIGNTCYLNSLL 718
           Q L+S+S  T I    + LL  +  E+       +P G+      G  N GNTCY NS+L
Sbjct: 87  QSLLSTSVDTAIDLNSSGLLFTKITES-------MPFGDGSNKVFGYENFGNTCYCNSVL 139

Query: 719 QYYFCISPLRQSIVEY 734
           Q  + ++  R  ++++
Sbjct: 140 QCLYNLTEFRLLLLQH 155

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 1158 YSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216
            Y L +V +H G + S GHY  + K    +G W  Y+DE + +  E ++           Y
Sbjct: 627  YQLISVVVHEGRSLSSGHYIAHCKQP--DGSWATYDDEYINKITEKQML-----KEPGAY 679

Query: 1217 FLVYVK 1222
            +L+Y +
Sbjct: 680  YLIYTR 685

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 17/26 (65%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL NIG TCY+NS+LQ  F     R
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFR 581

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 36.2 bits (82), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+G+TCY+NS+LQ  F     R
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFR 638

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 35.8 bits (81), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y L ++  H+G  + GHY + +K +  +G W K+ND  V+   E E  
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVKVN--DGQWFKFNDSMVSAITEEEAL 478

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 35.8 bits (81), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+G TCY+NS+LQ  F  +  R
Sbjct: 599 TGLRNLGATCYINSMLQCLFATNMFR 624

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 35.4 bits (80), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y L  +  H+G  + GHY    K  G  G W K+ND  VT   E +V 
Sbjct: 394  YELIGLISHQGSVNQGHYTSICKIPG--GQWFKFNDSMVTAVAEIDVL 439

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 6/102 (5%)

Query: 1133 ASVYHRIAF-LEQKLSSHFDDFKQEGYSLFAVFIHRGEA-SYGHYWIYIKDSGKNGIWRK 1190
            + ++++I + L   + S FD+   + Y L  V +H G + ++GHY + I    K G W  
Sbjct: 557  SKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVLHVGASPTHGHY-VSICKHEKYG-WLM 614

Query: 1191 YNDESVTEAPESEVFNF--SEGNTATPYFLVYVKNGQESQIE 1230
            Y+DE++   PE  V +      N  T Y L Y +  Q  + +
Sbjct: 615  YDDETIESIPEEAVTSHVGEPNNPITAYVLFYSEKIQNKKTQ 656

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           G  N G+TCY NS+LQ  + +   R+SI+++
Sbjct: 122 GYENFGHTCYCNSVLQCIYNLPEFRKSILQF 152

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+GNTCY+NS LQ    I  LR
Sbjct: 293 TGLYNLGNTCYMNSALQCLVHIPELR 318

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+GNTCY+NS LQ    I  LR
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLR 389

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 12/80 (15%)

Query: 1151 DDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTE-APESEVFNFSE 1209
            DD +   Y L+AV  H G    GHY  Y+K+   N  W  ++D  VTE  PE+ +     
Sbjct: 1041 DDPRGSIYDLYAVDNHYGGLGGGHYTAYVKNFANNK-WYYFDDSRVTETVPENSI----- 1094

Query: 1210 GNTATPYFLVYV---KNGQE 1226
                + Y L Y+   K+G E
Sbjct: 1095 --AGSAYLLFYIRRPKDGDE 1112

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 696 LPAG---NWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           LP G   N   G  N GNTCY NS+LQ  + +   R +I++Y
Sbjct: 116 LPFGDGSNKVFGYENFGNTCYCNSVLQCLYNLPEFRLNILQY 157

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+ NTCY+NS+LQ  F  +  R
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFR 771

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N+GNTCY+NS LQ    I  LR
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLR 389

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 9/73 (12%)

Query: 1151 DDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTE-APESEVFNFSE 1209
            DD +   Y L+AV  H G    GHY  Y+K+   N  W  ++D  VTE APE+ +     
Sbjct: 1045 DDPRGLIYDLYAVDNHYGGLGGGHYTAYVKNFADNK-WYYFDDSRVTETAPENSI----- 1098

Query: 1210 GNTATPYFLVYVK 1222
                + Y L Y++
Sbjct: 1099 --AGSAYLLFYIR 1109

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 8/64 (12%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217
            Y L A+  H G    GHY    + +G   IW K+ND  VT   E ++           Y 
Sbjct: 409  YKLSAIISHHGTVHQGHYTTICRINGD--IWAKFNDSMVTVISEEDMLK------EQAYL 460

Query: 1218 LVYV 1221
            L YV
Sbjct: 461  LYYV 464

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           G  N GNTCY NS+LQ  + +   R  ++EY
Sbjct: 162 GYENFGNTCYCNSVLQCLYHLPEFRLRVLEY 192

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 1147 SSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFN 1206
            SS FD    + Y L  V +H G   +  +++ +  +   G W  ++DE+V    ES V +
Sbjct: 600  SSTFDSSVSKSYRLQGVVVHMGNGPHHGHYVSLCHTELFG-WLLFDDETVESVDESYVLD 658

Query: 1207 F--SEGNTATPYFLVYVK-NGQESQIEPL 1232
            F  S  +  T Y L Y + +G E  ++ +
Sbjct: 659  FVGSHESPTTAYVLFYSEIDGSERAVQEI 687

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIV--EYQKTLSE 740
           TGL N+GNTCY+NS LQ    +  LR   +   Y+K ++E
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINE 400

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 41/88 (46%), Gaps = 15/88 (17%)

Query: 1146 LSSHF---DDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEA-PE 1201
            LS H    DD +   Y L+AV  H G    GHY  Y+K+   N  W  ++D  VTE  PE
Sbjct: 1036 LSEHVVYKDDPRGSIYDLYAVDNHYGGLGGGHYTAYVKNFMDNK-WYYFDDSRVTETVPE 1094

Query: 1202 SEVFNFSEGNTATPYFLVYV---KNGQE 1226
            + V         + Y L Y+   K+G E
Sbjct: 1095 NSV-------AGSAYLLFYIRRTKDGNE 1115

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 41/101 (40%), Gaps = 14/101 (13%)

Query: 1127 KIDEELASVYHRIAF-LEQKLSSHFDDFKQE-----GYSLFAVFIHRGEASYGHYWIYIK 1180
            +++ + A +  R+ F L   L  H    + E      Y L  V  H+G    GHY    K
Sbjct: 352  QLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIAYDLLNVVSHQGTVDQGHYTTVSK 411

Query: 1181 DSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFLVYV 1221
               ++G W K+ND  VT   E +V           Y L Y+
Sbjct: 412  T--EDGQWFKFNDSVVTSVTEEQVLE------QQAYLLFYI 444

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLR 728
           GL+N+GNTCY+NS LQ    I  LR
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLR 348

 Score = 33.1 bits (74), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 1149 HFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEA-PESEVFNF 1207
            H DD +   Y L+AV  H G    GHY  Y+K+   N  W  ++D  V E  PE  V   
Sbjct: 953  HKDDPRGTVYDLYAVDNHYGGLGGGHYTAYVKNFIDNK-WYYFDDSRVYETDPEKSV--- 1008

Query: 1208 SEGNTATPYFLVYVKNG 1224
                + + Y L Y++ G
Sbjct: 1009 ----SGSAYLLFYLRRG 1021

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 696 LPAGNWPT---GLNNIGNTCYLNSLLQYYFCISPLRQSIVEY 734
           LP G+      G  N GNTCY NS+LQ  F +   R  I+++
Sbjct: 112 LPYGDGSNKIFGYENFGNTCYCNSILQCLFFLDDFRIDILKH 153

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y L +V +H G  +YGHY  + +     G W + +DESV    E EV 
Sbjct: 681  YVLRSVIVHYGTHNYGHYIAFRR---FRGCWWRISDESVYIVDEQEVL 725

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL N  NTCY+NS++Q  F  +P R
Sbjct: 292 TGLQNPCNTCYINSIIQCLFGSTPFR 317

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 25/64 (39%), Gaps = 8/64 (12%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217
            Y L AV  H G  + GHY    K  G  G W ++ND  +    E E            Y 
Sbjct: 394  YELVAVISHEGSVNQGHYTSMCKIPG--GQWFRFNDSMIVSISEEEALR------QQAYL 445

Query: 1218 LVYV 1221
            L YV
Sbjct: 446  LFYV 449

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
            (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217
            Y+L+AV  H G    GHY  Y+    KNG W  ++D    +A   +     E  T + Y 
Sbjct: 361  YNLYAVACHFGTLYGGHYTAYVNKEDKNG-WCYFDDTCWRKAKSED-----ECITTSAYV 414

Query: 1218 LVY 1220
            L Y
Sbjct: 415  LFY 417

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 18/25 (72%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLR 728
           G+ N+GNTCY+NS+LQ  F  +  R
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFR 238

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
            YBR058C
          Length = 780

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 1158 YSLFAVFIHRGEASY-GHYWIYIKDS-GKNGIWRKYNDESVTEAPESEVFNFSE 1209
            Y L AV  H+G +++ GHY  +I+ S  +   W  YNDE +  A E    NF E
Sbjct: 717  YKLVAVVCHKGNSAHSGHYVAFIRKSVEQEEKWVLYNDEKIVVAVED---NFEE 767

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%)

Query: 696 LPAGNWPTGLNNIGNTCYLNSLLQ 719
           LP  ++  GL N+GN+CYLNS+LQ
Sbjct: 316 LPNKDYGCGLINLGNSCYLNSVLQ 339

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
           TGL+N+GN+CY+NS LQ    I  L+
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELK 359

>YDL103C Chr4 complement(275148..276581) [1434 bp, 477 aa] {ON}
           QRI1UDP-N-acetylglucosamine pyrophosphorylase, catalyzes
           the formation of UDP-N-acetylglucosamine (UDP-GlcNAc),
           which is important in cell wall biosynthesis, protein
           N-glycosylation, and GPI anchor biosynthesis
          Length = 477

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 278 LNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEYQPPDLTDY 337
           L+R+  +++L  +      ++S+  PA L E  Q  +  + A+   +T +E  P   T Y
Sbjct: 23  LSRKDQEELLSNLEQ----ISSKRSPAKLLEDCQNAIKFSLANSSKDTGVEISPLPPTSY 78

Query: 338 VNNLSVRKLREEYTRKCLELVFLGKMAVALMS 369
            + +   K   EY R  LE +  G++AV LM+
Sbjct: 79  ESLIGNSKKENEYWRLGLEAIGKGEVAVILMA 110

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 8/86 (9%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAE 763
           GL N+GN+CY+N ++Q   CI      I  +     E      H+    R+G + V    
Sbjct: 606 GLENMGNSCYMNCIIQ---CILGTHDLIKIFLNNSYE-----KHINLSSRLGSKGVLAKN 657

Query: 764 VERSIQFVYQLRDLFTDMVHTENRYV 789
             R I  +Y      T   HTE + V
Sbjct: 658 FARLIHTMYMHAVPSTINKHTEKKIV 683

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205
            Y L  V  H G  + GHY   +K    N  W K+ND  VT   E EV 
Sbjct: 380  YELNGVISHIGTVNEGHYIATLKLDSNN--WFKFNDSMVTSISEEEVL 425

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 3/23 (13%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCIS 725
           TGL N+GNTCY+NS LQ   CI+
Sbjct: 321 TGLVNLGNTCYMNSALQ---CIT 340

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 22/28 (78%), Gaps = 1/28 (3%)

Query: 696 LPAGN-WPTGLNNIGNTCYLNSLLQYYF 722
           L AG+ +  GL N+GN+CYLNS+LQ ++
Sbjct: 318 LKAGDDFGVGLINLGNSCYLNSILQCFY 345

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 683 NRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQ 729
           N++  +     + L A +   GL+N+GNTCY+NS LQ    I  L +
Sbjct: 319 NQHWPSNFFHYNKLNAPSGIMGLSNLGNTCYMNSALQCLLHIPELNE 365

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
            YDR069C
          Length = 986

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 6/65 (9%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217
            Y L+ V  H G    GHY  Y+    KNG W  ++D S        + N  E  T++ Y 
Sbjct: 922  YKLYGVACHFGSLYGGHYTAYVDKGIKNG-WYYFDDTSC-----RPIKNSMEPITSSAYV 975

Query: 1218 LVYVK 1222
            L Y +
Sbjct: 976  LFYKR 980

>Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {ON}
            complement(78247..80715) [2469 nt, 823 aa]
          Length = 822

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 42/91 (46%), Gaps = 8/91 (8%)

Query: 1137 HRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEAS-YGHYW--IYIKDSGKNGIWRKYND 1193
            H +    + LS    D K   Y L  V  H G +S  GHY   +Y K+  K   W + +D
Sbjct: 732  HELTIPLESLSPASIDTKNRAYELTGVIYHHGLSSDGGHYTADVYHKELDK---WYRIDD 788

Query: 1194 ESVTEAPESEVFNFSE-GN-TATPYFLVYVK 1222
             ++ E  + +V    E GN T T Y L+Y K
Sbjct: 789  VNIIELEKDDVLKGGEDGNDTRTAYILIYRK 819

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 704 GLNNIGNTCYLNSLLQYYFCISPLRQSIV 732
           GL+N+GNTCY+NS LQ    I  +R   V
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFV 350

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 12/76 (15%)

Query: 700 NWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVE--YQKTLSEFHQSIGHLESKRRIGGR 757
           N+  GL N+GN+CY+N +LQ     + L Q  +   Y+K          H+    ++G +
Sbjct: 580 NFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEK----------HININSKLGSK 629

Query: 758 EVSEAEVERSIQFVYQ 773
            V      R    ++Q
Sbjct: 630 GVLARYFARLAHIMHQ 645

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 1/25 (4%)

Query: 696 LPAGN-WPTGLNNIGNTCYLNSLLQ 719
           LPA N +  GL N+GN+CYLNS++Q
Sbjct: 315 LPASNEYGCGLINLGNSCYLNSVMQ 339

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (66%)

Query: 696 LPAGNWPTGLNNIGNTCYLNSLLQ 719
           +   N   GL N+GNTCY+NS LQ
Sbjct: 342 MTPSNGTVGLGNLGNTCYMNSALQ 365

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728
            GL N GNTCY+NS++Q  F    LR
Sbjct: 238 VGLRNQGNTCYINSMVQCLFGTKVLR 263

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 33.1 bits (74), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 13/96 (13%)

Query: 1137 HRIAFLEQKLSS-----HFDDFKQEGYSLFAVFIHRGEAS-YGHYW--IYIKDSGKNGIW 1188
            H +   E+ +SS     H        Y L  V  H G +S  GHY   +Y K+  K   W
Sbjct: 815  HELIIPEESMSSITLKNHTSGVDDRRYKLTGVIYHHGVSSDGGHYTADVYHKEHNK---W 871

Query: 1189 RKYNDESVTEAPESEVFNFSE--GNTATPYFLVYVK 1222
             + +D ++TE  + +V    E   ++ T Y L+Y K
Sbjct: 872  YRIDDVNITELEDDDVLKGGEEASDSRTAYILMYQK 907

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 32.7 bits (73), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 19/23 (82%)

Query: 697 PAGNWPTGLNNIGNTCYLNSLLQ 719
           P+ ++  GL N+GN+CYLNS++Q
Sbjct: 317 PSKDYGCGLINLGNSCYLNSVMQ 339

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 8/64 (12%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217
            + L A+  H+G    GHY    + +G   +W K+ND  VT   E ++           Y 
Sbjct: 412  FKLSAIIPHQGTVDKGHYTTICRINGD--VWAKFNDSMVTLISEEDMLK------EQAYL 463

Query: 1218 LVYV 1221
            L YV
Sbjct: 464  LYYV 467

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNF--SEGNTATP 1215
            Y L  + +H G +    +++ I  + K G W  ++DE+ +   E EV +F   E +  T 
Sbjct: 672  YKLQGIVVHMGSSPQQGHYVAICKTDKYG-WLLFDDETASWINEEEVLSFIGDEKSQNTA 730

Query: 1216 YFLVY 1220
            Y L Y
Sbjct: 731  YVLFY 735

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 132,385,570
Number of extensions: 6034835
Number of successful extensions: 18427
Number of sequences better than 10.0: 218
Number of HSP's gapped: 18654
Number of HSP's successfully gapped: 318
Length of query: 1241
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1120
Effective length of database: 39,606,813
Effective search space: 44359630560
Effective search space used: 44359630560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)